BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2218

Length=828
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616512.1|  PREDICTED: serine decarboxylase                    346   6e-113   Nicotiana tomentosiformis
ref|XP_009784234.1|  PREDICTED: serine decarboxylase                    343   7e-112   Nicotiana sylvestris
ref|XP_011101473.1|  PREDICTED: serine decarboxylase-like               341   2e-110   
ref|XP_003593130.1|  Histidine decarboxylase                            333   3e-110   
ref|XP_006362822.1|  PREDICTED: histidine decarboxylase-like isof...    338   6e-110   Solanum tuberosum [potatoes]
ref|XP_004237774.1|  PREDICTED: serine decarboxylase                    336   3e-109   Solanum lycopersicum
gb|ACJ85197.1|  unknown                                                 332   2e-107   Medicago truncatula
ref|XP_003593129.1|  Histidine decarboxylase                            332   2e-107   Medicago truncatula
ref|XP_011656638.1|  PREDICTED: serine decarboxylase isoform X1         329   2e-106   Cucumis sativus [cucumbers]
ref|XP_010108654.1|  Histidine decarboxylase                            329   2e-106   Morus notabilis
ref|XP_004140972.1|  PREDICTED: serine decarboxylase isoform X2         329   3e-106   Cucumis sativus [cucumbers]
ref|XP_008381807.1|  PREDICTED: histidine decarboxylase                 326   2e-105   Malus domestica [apple tree]
ref|XP_002306690.1|  serine decarboxylase family protein                326   3e-105   Populus trichocarpa [western balsam poplar]
gb|KHG24953.1|  Histidine decarboxylase                                 326   4e-105   Gossypium arboreum [tree cotton]
ref|XP_009368241.1|  PREDICTED: serine decarboxylase-like               326   4e-105   
ref|XP_008441526.1|  PREDICTED: histidine decarboxylase isoform X2      326   4e-105   
ref|XP_008441525.1|  PREDICTED: histidine decarboxylase isoform X1      326   4e-105   Cucumis melo [Oriental melon]
ref|XP_009343619.1|  PREDICTED: serine decarboxylase-like               326   4e-105   Pyrus x bretschneideri [bai li]
ref|XP_009368490.1|  PREDICTED: serine decarboxylase-like               326   4e-105   Pyrus x bretschneideri [bai li]
ref|XP_003547587.1|  PREDICTED: histidine decarboxylase                 325   7e-105   Glycine max [soybeans]
ref|XP_004290538.1|  PREDICTED: serine decarboxylase                    325   8e-105   Fragaria vesca subsp. vesca
ref|XP_010500117.1|  PREDICTED: serine decarboxylase-like               323   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_011044197.1|  PREDICTED: serine decarboxylase-like               323   4e-104   Populus euphratica
gb|KJB16468.1|  hypothetical protein B456_002G231300                    323   6e-104   Gossypium raimondii
ref|XP_002302186.1|  serine decarboxylase family protein                322   6e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011042836.1|  PREDICTED: serine decarboxylase-like               322   6e-104   Populus euphratica
ref|NP_001241244.1|  uncharacterized protein LOC100795577               323   7e-104   Glycine max [soybeans]
ref|XP_012066036.1|  PREDICTED: serine decarboxylase                    323   7e-104   Jatropha curcas
gb|KHN26720.1|  Histidine decarboxylase                                 323   8e-104   Glycine soja [wild soybean]
ref|XP_010260914.1|  PREDICTED: serine decarboxylase-like               322   1e-103   Nelumbo nucifera [Indian lotus]
ref|XP_007201012.1|  hypothetical protein PRUPE_ppa005028mg             322   1e-103   Prunus persica
ref|XP_008243632.1|  PREDICTED: histidine decarboxylase-like            322   2e-103   Prunus mume [ume]
ref|XP_010519398.1|  PREDICTED: serine decarboxylase-like               322   2e-103   Tarenaya hassleriana [spider flower]
ref|XP_008339120.1|  PREDICTED: histidine decarboxylase-like            321   2e-103   Malus domestica [apple tree]
emb|CDX80723.1|  BnaC08g05570D                                          322   3e-103   
ref|XP_010461415.1|  PREDICTED: serine decarboxylase-like               321   3e-103   Camelina sativa [gold-of-pleasure]
ref|XP_004485538.1|  PREDICTED: histidine decarboxylase-like isof...    321   3e-103   Cicer arietinum [garbanzo]
ref|XP_010530241.1|  PREDICTED: serine decarboxylase                    322   3e-103   Tarenaya hassleriana [spider flower]
ref|XP_007019463.1|  Pyridoxal phosphate (PLP)-dependent transfer...    321   4e-103   Theobroma cacao [chocolate]
ref|XP_002533017.1|  group II plp decarboxylase, putative               320   5e-103   Ricinus communis
dbj|BAE07183.1|  putative serine decarboxylase                          320   7e-103   Beta vulgaris [beet]
ref|XP_010680495.1|  PREDICTED: serine decarboxylase                    320   7e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_175036.1|  serine decarboxylase 1                                320   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145064.1|  PREDICTED: serine decarboxylase                    319   1e-102   Brassica rapa
ref|XP_010241731.1|  PREDICTED: serine decarboxylase-like               319   2e-102   Nelumbo nucifera [Indian lotus]
ref|XP_007159060.1|  hypothetical protein PHAVU_002G204900g             317   3e-102   Phaseolus vulgaris [French bean]
ref|XP_006393773.1|  hypothetical protein EUTSA_v10011430mg             318   4e-102   Eutrema salsugineum [saltwater cress]
ref|XP_007159059.1|  hypothetical protein PHAVU_002G204900g             318   5e-102   Phaseolus vulgaris [French bean]
emb|CDY59264.1|  BnaC09g51700D                                          318   5e-102   Brassica napus [oilseed rape]
ref|XP_010479021.1|  PREDICTED: serine decarboxylase                    318   7e-102   Camelina sativa [gold-of-pleasure]
dbj|BAA78331.1|  serine decarboxylase                                   317   1e-101   Brassica napus [oilseed rape]
gb|EYU17447.1|  hypothetical protein MIMGU_mgv1a005353mg                317   1e-101   Erythranthe guttata [common monkey flower]
emb|CDY30753.1|  BnaC05g51500D                                          316   2e-101   Brassica napus [oilseed rape]
gb|KFK24263.1|  hypothetical protein AALP_AAs40498U000700               317   2e-101   Arabis alpina [alpine rockcress]
emb|CDY41717.1|  BnaA09g15450D                                          316   2e-101   Brassica napus [oilseed rape]
gb|KJB16469.1|  hypothetical protein B456_002G231300                    316   3e-101   Gossypium raimondii
ref|XP_010063879.1|  PREDICTED: serine decarboxylase-like               316   3e-101   
ref|XP_009107655.1|  PREDICTED: serine decarboxylase-like               316   4e-101   Brassica rapa
emb|CDY48944.1|  BnaA08g04700D                                          315   5e-101   Brassica napus [oilseed rape]
gb|KJB16470.1|  hypothetical protein B456_002G231300                    315   6e-101   Gossypium raimondii
gb|KCW71161.1|  hypothetical protein EUGRSUZ_F04257                     316   1e-100   Eucalyptus grandis [rose gum]
ref|XP_006854520.1|  PREDICTED: serine decarboxylase 1                  315   1e-100   Amborella trichopoda
gb|EPS66281.1|  serine decarboxylase                                    310   1e-99    Genlisea aurea
emb|CBI18554.3|  unnamed protein product                                309   3e-99    Vitis vinifera
gb|KHN39188.1|  Histidine decarboxylase                                 311   3e-99    Glycine soja [wild soybean]
ref|NP_001242861.1|  uncharacterized protein LOC100792053               309   4e-99    
ref|XP_009113392.1|  PREDICTED: serine decarboxylase-like               310   8e-99    Brassica rapa
ref|XP_002266398.1|  PREDICTED: serine decarboxylase                    310   8e-99    Vitis vinifera
emb|CAN70523.1|  hypothetical protein VITISV_034634                     309   9e-99    Vitis vinifera
ref|XP_010241734.1|  PREDICTED: serine decarboxylase 1-like             309   1e-98    Nelumbo nucifera [Indian lotus]
ref|XP_007148444.1|  hypothetical protein PHAVU_006G209300g             309   1e-98    Phaseolus vulgaris [French bean]
ref|XP_006584560.1|  PREDICTED: uncharacterized protein LOC100792...    309   1e-98    
gb|KJB59410.1|  hypothetical protein B456_009G253400                    309   1e-98    Gossypium raimondii
ref|XP_006584563.1|  PREDICTED: uncharacterized protein LOC100792...    308   2e-98    Glycine max [soybeans]
ref|XP_006584565.1|  PREDICTED: uncharacterized protein LOC100792...    306   7e-98    Glycine max [soybeans]
gb|KHG04394.1|  Histidine decarboxylase                                 307   8e-98    Gossypium arboreum [tree cotton]
ref|XP_003575093.1|  PREDICTED: serine decarboxylase 1                  306   8e-98    Brachypodium distachyon [annual false brome]
ref|XP_006307198.1|  hypothetical protein CARUB_v10008789mg             308   1e-97    
ref|XP_002893962.1|  EMB1075                                            306   1e-97    
ref|XP_009406072.1|  PREDICTED: serine decarboxylase 1-like             306   1e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008645766.1|  PREDICTED: histidine decarboxylase-like            306   2e-97    
ref|XP_010931002.1|  PREDICTED: serine decarboxylase 1                  306   2e-97    Elaeis guineensis
ref|XP_008781392.1|  PREDICTED: serine decarboxylase 1                  306   3e-97    Phoenix dactylifera
ref|XP_006472964.1|  PREDICTED: histidine decarboxylase-like isof...    305   3e-97    Citrus sinensis [apfelsine]
ref|XP_006434436.1|  hypothetical protein CICLE_v10000775mg             305   3e-97    Citrus clementina [clementine]
gb|KDO83688.1|  hypothetical protein CISIN_1g011842mg                   305   3e-97    Citrus sinensis [apfelsine]
ref|XP_006434437.1|  hypothetical protein CICLE_v10000775mg             307   5e-97    
ref|XP_004952686.1|  PREDICTED: histidine decarboxylase-like            305   7e-97    Setaria italica
ref|XP_003579728.1|  PREDICTED: serine decarboxylase 1                  303   2e-96    Brachypodium distachyon [annual false brome]
ref|XP_008218831.1|  PREDICTED: histidine decarboxylase-like            301   7e-96    Prunus mume [ume]
gb|KJB59411.1|  hypothetical protein B456_009G253400                    302   8e-96    Gossypium raimondii
ref|XP_009416900.1|  PREDICTED: serine decarboxylase 1-like             301   1e-95    
ref|XP_002976233.1|  hypothetical protein SELMODRAFT_175502             301   2e-95    
ref|XP_008678685.1|  PREDICTED: histidine decarboxylase-like            301   2e-95    Zea mays [maize]
ref|XP_002987141.1|  hypothetical protein SELMODRAFT_158539             301   2e-95    
ref|XP_002452231.1|  hypothetical protein SORBIDRAFT_04g022140          301   2e-95    Sorghum bicolor [broomcorn]
ref|XP_006648711.1|  PREDICTED: histidine decarboxylase-like            300   4e-95    
ref|XP_007227607.1|  hypothetical protein PRUPE_ppa020363mg             298   8e-95    Prunus persica
sp|Q6ESZ9.1|SDC1_ORYSJ  RecName: Full=Serine decarboxylase 1            298   2e-94    Oryza sativa Japonica Group [Japonica rice]
gb|EAY86197.1|  hypothetical protein OsI_07573                          296   1e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_009420591.1|  PREDICTED: serine decarboxylase 1-like             292   4e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001761266.1|  predicted protein                                  282   2e-88    
gb|KJB59412.1|  hypothetical protein B456_009G253400                    273   8e-85    Gossypium raimondii
ref|XP_001754291.1|  predicted protein                                  268   3e-83    
gb|EMS65243.1|  Histidine decarboxylase                                 256   2e-79    Triticum urartu
emb|CDP11372.1|  unnamed protein product                                256   6e-79    Coffea canephora [robusta coffee]
ref|XP_010675834.1|  PREDICTED: serine decarboxylase-like               251   2e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676037.1|  PREDICTED: serine decarboxylase-like               249   9e-76    
ref|XP_003566804.1|  PREDICTED: serine decarboxylase 1-like             232   9e-69    Brachypodium distachyon [annual false brome]
ref|XP_001689659.1|  serine decarboxylase                               220   3e-65    Chlamydomonas reinhardtii
gb|EMT14427.1|  Histidine decarboxylase                                 222   7e-65    
gb|AFW62562.1|  hypothetical protein ZEAMMB73_033583                    219   1e-64    
ref|XP_011401256.1|  Histidine decarboxylase                            220   3e-64    Auxenochlorella protothecoides
ref|XP_006851377.2|  PREDICTED: serine decarboxylase                    210   4e-64    
gb|KIZ00141.1|  histidine decarboxylase                                 219   8e-64    Monoraphidium neglectum
ref|XP_005845371.1|  hypothetical protein CHLNCDRAFT_53969              216   6e-63    Chlorella variabilis
ref|XP_002953989.1|  serine decarboxylase                               216   1e-62    Volvox carteri f. nagariensis
ref|XP_002456988.1|  hypothetical protein SORBIDRAFT_03g046840          211   8e-61    Sorghum bicolor [broomcorn]
gb|KDD76585.1|  hypothetical protein H632_c172p0                        202   2e-57    Helicosporidium sp. ATCC 50920
ref|XP_006663420.1|  PREDICTED: histidine decarboxylase-like            200   6e-57    Oryza brachyantha
ref|XP_005646136.1|  serine decarboxylase                               196   3e-56    Coccomyxa subellipsoidea C-169
gb|EAY77466.1|  hypothetical protein OsI_32510                          192   7e-54    Oryza sativa Indica Group [Indian rice]
gb|EMS49846.1|  Histidine decarboxylase                                 189   1e-53    Triticum urartu
ref|XP_006661594.1|  PREDICTED: histidine decarboxylase-like            190   4e-53    Oryza brachyantha
sp|Q8RV06.1|SDC2_ORYSJ  RecName: Full=Serine decarboxylase 2            190   5e-53    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ18332.1|  hypothetical protein OsJ_33863                          187   3e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006364728.1|  PREDICTED: histidine decarboxylase-like            186   1e-51    
gb|AGT16577.1|  histidine decarboxylase-like protein                    182   7e-51    Saccharum hybrid cultivar R570
ref|XP_004245427.1|  PREDICTED: histidine decarboxylase-like            184   1e-50    Solanum lycopersicum
ref|XP_002178784.1|  predicted protein                                  181   1e-50    Phaeodactylum tricornutum CCAP 1055/1
ref|NP_001233852.1|  aromatic amino acid decarboxylase 1B               184   2e-50    
ref|XP_010325179.1|  PREDICTED: histidine decarboxylase-like isof...    183   2e-50    
ref|XP_006365168.1|  PREDICTED: histidine decarboxylase-like            183   2e-50    Solanum tuberosum [potatoes]
ref|XP_004245279.1|  PREDICTED: histidine decarboxylase-like            183   2e-50    Solanum lycopersicum
ref|XP_004245280.1|  PREDICTED: histidine decarboxylase-like isof...    183   2e-50    
ref|XP_006365087.1|  PREDICTED: histidine decarboxylase-like            183   2e-50    Solanum tuberosum [potatoes]
ref|XP_006365166.1|  PREDICTED: histidine decarboxylase-like            183   3e-50    Solanum tuberosum [potatoes]
gb|EMT14424.1|  Histidine decarboxylase                                 182   3e-50    
ref|XP_006364727.1|  PREDICTED: histidine decarboxylase-like            182   4e-50    
gb|EEC76705.1|  hypothetical protein OsI_14710                          181   5e-50    Oryza sativa Indica Group [Indian rice]
gb|ABA93664.1|  retrotransposon protein, putative, unclassified         187   8e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002292250.1|  histidine decarboxylase                            179   1e-49    Thalassiosira pseudonana CCMP1335
ref|XP_004245144.1|  PREDICTED: histidine decarboxylase                 181   1e-49    Solanum lycopersicum
ref|XP_006365163.1|  PREDICTED: histidine decarboxylase-like isof...    181   1e-49    Solanum tuberosum [potatoes]
ref|XP_006591667.1|  PREDICTED: histidine decarboxylase-like            174   1e-49    Glycine max [soybeans]
ref|XP_006365167.1|  PREDICTED: histidine decarboxylase-like            181   1e-49    Solanum tuberosum [potatoes]
ref|NP_001233845.1|  aromatic amino acid decarboxylase 1A               181   1e-49    Solanum lycopersicum
ref|XP_004245145.1|  PREDICTED: histidine decarboxylase-like            181   1e-49    Solanum lycopersicum
ref|XP_006365165.1|  PREDICTED: histidine decarboxylase-like            181   1e-49    
gb|KHN16991.1|  Histidine decarboxylase                                 179   2e-49    Glycine soja [wild soybean]
ref|XP_006365162.1|  PREDICTED: histidine decarboxylase-like isof...    180   2e-49    Solanum tuberosum [potatoes]
ref|XP_006365164.1|  PREDICTED: histidine decarboxylase-like isof...    180   3e-49    
ref|XP_009622262.1|  PREDICTED: LOW QUALITY PROTEIN: histidine de...    179   3e-49    
gb|KJE90702.1|  serine decarboxylase                                    183   4e-49    Capsaspora owczarzaki ATCC 30864
ref|XP_004364837.2|  serine decarboxylase                               183   4e-49    Capsaspora owczarzaki ATCC 30864
gb|EJK75470.1|  hypothetical protein THAOC_02802                        180   4e-49    Thalassiosira oceanica
ref|XP_009602156.1|  PREDICTED: histidine decarboxylase-like            179   5e-49    Nicotiana tomentosiformis
gb|AES62380.2|  serine decarboxylase                                    178   9e-49    Medicago truncatula
ref|XP_009779195.1|  PREDICTED: histidine decarboxylase-like            177   2e-48    Nicotiana sylvestris
ref|XP_009774334.1|  PREDICTED: histidine decarboxylase-like            177   2e-48    Nicotiana sylvestris
ref|XP_004245281.1|  PREDICTED: histidine decarboxylase-like            177   4e-48    Solanum lycopersicum
ref|XP_004496485.1|  PREDICTED: histidine decarboxylase-like            176   8e-48    Cicer arietinum [garbanzo]
ref|XP_009600675.1|  PREDICTED: histidine decarboxylase-like            176   9e-48    
ref|XP_009601848.1|  PREDICTED: histidine decarboxylase-like isof...    176   1e-47    
ref|XP_003592126.1|  Histidine decarboxylase                            176   1e-47    
ref|XP_003535572.1|  PREDICTED: histidine decarboxylase-like            176   1e-47    Glycine max [soybeans]
ref|XP_011082256.1|  PREDICTED: serine decarboxylase-like               174   2e-47    
ref|XP_003535578.1|  PREDICTED: histidine decarboxylase-like            174   2e-47    
ref|XP_004245146.1|  PREDICTED: histidine decarboxylase-like            174   3e-47    Solanum lycopersicum
gb|KEH43660.1|  serine decarboxylase                                    176   4e-47    Medicago truncatula
gb|AHG12639.1|  histidine decarboxylase                                 174   4e-47    Nicotiana tabacum [American tobacco]
ref|XP_011081981.1|  PREDICTED: histidine decarboxylase-like isof...    174   5e-47    Sesamum indicum [beniseed]
ref|XP_011081982.1|  PREDICTED: histidine decarboxylase-like isof...    174   5e-47    Sesamum indicum [beniseed]
gb|EYU30500.1|  hypothetical protein MIMGU_mgv1a023109mg                172   8e-47    Erythranthe guttata [common monkey flower]
ref|XP_006357083.1|  PREDICTED: histidine decarboxylase-like            172   4e-46    Solanum tuberosum [potatoes]
ref|XP_006366216.1|  PREDICTED: histidine decarboxylase-like            171   5e-46    
ref|NP_001233859.1|  aromatic amino acid decarboxylase 2                171   5e-46    Solanum lycopersicum
ref|XP_003607343.1|  Aromatic amino acid decarboxylase 1B               167   6e-46    
ref|XP_006367691.1|  PREDICTED: histidine decarboxylase-like            171   9e-46    Solanum tuberosum [potatoes]
ref|XP_002679079.1|  predicted protein                                  170   1e-45    Naegleria gruberi strain NEG-M
ref|XP_004244519.1|  PREDICTED: histidine decarboxylase                 171   1e-45    Solanum lycopersicum
gb|AES89540.2|  serine decarboxylase                                    167   1e-45    Medicago truncatula
ref|XP_006357084.1|  PREDICTED: histidine decarboxylase-like            170   2e-45    Solanum tuberosum [potatoes]
ref|XP_006346847.1|  PREDICTED: histidine decarboxylase-like            170   2e-45    
ref|NP_001234136.2|  histidine decarboxylase                            169   3e-45    Solanum lycopersicum
ref|XP_003592132.1|  FAR1-related protein                               175   3e-45    
ref|XP_009789723.1|  PREDICTED: histidine decarboxylase-like            169   3e-45    Nicotiana sylvestris
ref|XP_003607341.1|  Embryo defective 1075-like protein                 169   3e-45    
sp|Q7X8D4.2|SDC3_ORYSJ  RecName: Full=Serine decarboxylase 3            169   4e-45    Oryza sativa Japonica Group [Japonica rice]
gb|EYU19378.1|  hypothetical protein MIMGU_mgv1a006611mg                168   5e-45    Erythranthe guttata [common monkey flower]
ref|XP_009620691.1|  PREDICTED: histidine decarboxylase-like            168   7e-45    Nicotiana tomentosiformis
ref|XP_011082255.1|  PREDICTED: serine decarboxylase-like               168   8e-45    Sesamum indicum [beniseed]
ref|XP_009769413.1|  PREDICTED: histidine decarboxylase-like isof...    168   1e-44    Nicotiana sylvestris
ref|XP_009599698.1|  PREDICTED: histidine decarboxylase-like            167   1e-44    Nicotiana tomentosiformis
gb|AIE54278.1|  aromatic amino acid decarboxylase 2                     167   2e-44    Nicotiana tabacum [American tobacco]
ref|XP_004244809.1|  PREDICTED: histidine decarboxylase-like            167   2e-44    Solanum lycopersicum
ref|XP_003592128.1|  Embryo defective 1075-like protein                 165   8e-44    
ref|XP_003592129.1|  Serine decarboxylase                               165   1e-43    
sp|P54772.1|DCHS_SOLLC  RecName: Full=Histidine decarboxylase; Sh...    162   6e-43    Solanum lycopersicum
gb|KHN17002.1|  Histidine decarboxylase                                 161   4e-42    Glycine soja [wild soybean]
gb|EYU29207.1|  hypothetical protein MIMGU_mgv1a026642mg                156   5e-41    Erythranthe guttata [common monkey flower]
ref|XP_009601849.1|  PREDICTED: histidine decarboxylase-like isof...    156   7e-41    Nicotiana tomentosiformis
ref|WP_026730962.1|  histidine decarboxylase                            152   2e-39    
ref|XP_003619923.1|  L-tyrosine decarboxylase                           148   5e-38    
gb|EEE60437.1|  hypothetical protein OsJ_13648                          147   7e-38    Oryza sativa Japonica Group [Japonica rice]
ref|WP_045055559.1|  histidine decarboxylase                            147   8e-38    Aliterella atlantica
ref|WP_015112001.1|  Histidine decarboxylase                            147   9e-38    Nostoc sp. PCC 7107
ref|WP_016870188.1|  histidine decarboxylase                            141   2e-35    Fischerella muscicola
ref|WP_044451446.1|  histidine decarboxylase                            138   2e-35    
ref|WP_017312078.1|  histidine decarboxylase                            140   4e-35    Fischerella sp. PCC 9339
ref|WP_009455225.1|  histidine decarboxylase                            140   5e-35    Fischerella thermalis
ref|WP_026721610.1|  histidine decarboxylase                            139   2e-34    Fischerella sp. PCC 9431
gb|EYU24758.1|  hypothetical protein MIMGU_mgv1a026373mg                137   2e-34    Erythranthe guttata [common monkey flower]
ref|WP_012408195.1|  histidine decarboxylase                            137   5e-34    Nostoc punctiforme
dbj|BAH97114.1|  amino acid decarboxylase                               134   3e-33    Naegleria fowleri [brain-eating amoeba]
ref|WP_016859640.1|  histidine decarboxylase                            135   5e-33    Fischerella muscicola
ref|XP_002454879.1|  hypothetical protein SORBIDRAFT_03g000687          123   8e-31    
gb|KEH26770.1|  histidine decarboxylase-like protein                    122   8e-31    Medicago truncatula
ref|XP_002444261.1|  hypothetical protein SORBIDRAFT_07g019126          122   4e-30    
ref|WP_041885112.1|  histidine decarboxylase                            124   2e-29    Pedobacter lusitanus
gb|ELU52247.1|  PLP-dependent enzyme, glutamate decarboxylase           119   2e-28    Vibrio campbellii CAIM 519 = NBRC 15631
ref|WP_036288070.1|  histidine decarboxylase                            120   7e-28    
ref|WP_013663956.1|  histidine decarboxylase                            120   9e-28    Sphingobacterium sp. 21
ref|WP_038863593.1|  histidine decarboxylase                            119   2e-27    Vibrio campbellii
ref|WP_037437993.1|  histidine decarboxylase                            119   2e-27    Pedobacter antarcticus
ref|XP_005840580.1|  hypothetical protein GUITHDRAFT_156940             119   2e-27    Guillardia theta CCMP2712
ref|WP_033002296.1|  histidine decarboxylase                            119   2e-27    
gb|ERB65930.1|  hypothetical protein N779_07565                         112   7e-27    Vibrio coralliilyticus OCN008
gb|KFF73912.1|  histidine decarboxylase                                 117   8e-27    Chryseobacterium sp. P1-3
ref|WP_014680343.1|  histidine decarboxylase                            116   2e-26    Solitalea canadensis
ref|WP_041881750.1|  histidine decarboxylase                            115   4e-26    Pedobacter lusitanus
ref|WP_014680621.1|  histidine decarboxylase                            115   4e-26    Solitalea canadensis
ref|WP_026731780.1|  histidine decarboxylase                            115   4e-26    
ref|WP_019275400.1|  histidine decarboxylase                            115   6e-26    Vibrio coralliilyticus
ref|WP_006960325.1|  MULTISPECIES: histidine decarboxylase              114   8e-26    Vibrio
ref|WP_045985226.1|  histidine decarboxylase                            114   8e-26    Vibrio coralliilyticus
ref|WP_043010788.1|  histidine decarboxylase                            114   8e-26    Vibrio coralliilyticus
ref|WP_018151708.1|  hypothetical protein                               114   1e-25    Leeia oryzae
ref|WP_042556656.1|  histidine decarboxylase                            114   1e-25    Pseudomonas fulva
ref|WP_004737502.1|  histidine decarboxylase                            114   1e-25    Vibrio splendidus
ref|WP_040121251.1|  histidine decarboxylase                            114   1e-25    Vibrio coralliilyticus
ref|WP_029274788.1|  histidine decarboxylase                            114   1e-25    Pedobacter borealis
ref|WP_026362388.1|  histidine decarboxylase                            114   1e-25    
gb|KJG12110.1|  histidine decarboxylase                                 109   2e-25    Raoultella planticola
ref|WP_039472909.1|  histidine decarboxylase                            113   2e-25    Pedobacter kyungheensis
ref|WP_009963501.1|  histidine decarboxylase                            113   3e-25    Verrucomicrobium spinosum
ref|WP_038170807.1|  histidine decarboxylase                            113   3e-25    Verrucomicrobium sp. BvORR106
ref|WP_025146293.1|  histidine decarboxylase                            112   3e-25    Pedobacter jeongneungensis
ref|XP_008620940.1|  histidine decarboxylase                            112   4e-25    Saprolegnia diclina VS20
ref|WP_045958062.1|  histidine decarboxylase                            112   4e-25    Xenorhabdus poinarii
ref|WP_038258978.1|  histidine decarboxylase                            112   4e-25    Xenorhabdus bovienii
ref|WP_043188769.1|  histidine decarboxylase                            112   7e-25    Pseudomonas rhizosphaerae
ref|WP_014718553.1|  MULTISPECIES: histidine decarboxylase              112   7e-25    Pseudomonas
ref|WP_005788362.1|  histidine decarboxylase                            111   1e-24    Pseudomonas synxantha
ref|WP_014201338.1|  histidine decarboxylase                            111   1e-24    Owenweeksia hongkongensis
ref|WP_020302734.1|  histidine decarboxylase                            111   1e-24    Pseudomonas sp. CF150
ref|WP_009841733.1|  histidine decarboxylase                            111   1e-24    Vibrio sp. AND4
gb|KIP17071.1|  histidine decarboxylase                                 111   2e-24    Burkholderia sp. MSHR3999
ref|WP_046120161.1|  pyridoxal-dependent decarboxylase                  110   2e-24    
ref|WP_011142216.1|  histidine decarboxylase                            110   2e-24    Gloeobacter violaceus
ref|WP_042585292.1|  histidine decarboxylase                            110   2e-24    
ref|WP_019817102.1|  histidine decarboxylase                            110   2e-24    Pseudomonas
ref|WP_045975916.1|  histidine decarboxylase                            110   3e-24    Vibrio neptunius
sp|P05034.2|DCHS_MORMO  RecName: Full=Histidine decarboxylase; Sh...    109   4e-24    Morganella morganii
ref|WP_025152530.1|  histidine decarboxylase                            109   4e-24    Morganella morganii
ref|WP_004234859.1|  MULTISPECIES: histidine decarboxylase              109   4e-24    Morganella
ref|WP_025665600.1|  histidine decarboxylase                            109   4e-24    Aquimarina megaterium
gb|AAA25071.1|  histidine decarboxylase                                 109   4e-24    Raoultella planticola
ref|WP_013661870.1|  histidine decarboxylase                            109   4e-24    Marinomonas mediterranea
ref|WP_004869084.1|  MULTISPECIES: histidine decarboxylase              109   4e-24    Enterobacteriaceae
ref|WP_010913856.1|  histidine decarboxylase                            109   4e-24    Mesorhizobium japonicum
gb|KGR35339.1|  histidine decarboxylase                                 109   5e-24    Vibrio campbellii
ref|WP_005427952.1|  histidine decarboxylase                            109   5e-24    Vibrio campbellii
ref|WP_045378494.1|  histidine decarboxylase                            109   5e-24    Vibrio campbellii
ref|WP_038890337.1|  histidine decarboxylase                            109   5e-24    Vibrio campbellii
ref|WP_045368827.1|  histidine decarboxylase                            109   5e-24    Vibrio campbellii
ref|WP_045398307.1|  histidine decarboxylase                            109   5e-24    Vibrio campbellii
ref|WP_045452728.1|  histidine decarboxylase                            109   5e-24    Vibrio campbellii
ref|WP_024474395.1|  histidine decarboxylase                            109   6e-24    Morganella morganii
ref|WP_005131724.1|  histidine decarboxylase                            109   6e-24    
ref|WP_005084750.1|  MULTISPECIES: histidine decarboxylase              108   7e-24    
ref|YP_001340499.1|  histidine decarboxylase                            108   7e-24    
ref|WP_005196164.1|  histidine decarboxylase                            108   7e-24    
ref|WP_023248740.1|  histidine decarboxylase                            108   8e-24    
ref|WP_001750840.1|  histidine decarboxylase                            108   8e-24    
ref|WP_004639823.1|  histidine decarboxylase                            108   9e-24    
ref|WP_005533429.1|  histidine decarboxylase                            108   9e-24    
ref|WP_010647516.1|  histidine decarboxylase                            108   9e-24    
ref|WP_012127831.1|  histidine decarboxylase                            108   9e-24    
ref|WP_041764715.1|  hypothetical protein                               108   1e-23    
gb|EMT14426.1|  hypothetical protein F775_23387                         102   1e-23    
ref|WP_035090976.1|  histidine decarboxylase                            108   1e-23    
gb|EZH75803.1|  histidine decarboxylase                                 108   1e-23    
ref|WP_034119545.1|  histidine decarboxylase                            108   1e-23    
dbj|BAC87908.1|  probable acinetobactin biosynthesis protein            108   1e-23    
ref|WP_034238501.1|  histidine decarboxylase                            108   1e-23    
gb|ESG76598.1|  histidine decarboxylase                                 107   2e-23    
ref|WP_027411177.1|  histidine decarboxylase                            107   2e-23    
dbj|GAE88421.1|  pyridoxal-dependent decarboxylase [ [                  107   3e-23    
gb|KDO21825.1|  hypothetical protein SPRG_12642                         107   3e-23    
sp|P95477.1|DCHS_PSEFL  RecName: Full=Histidine decarboxylase; Sh...    107   3e-23    
ref|WP_019104578.1|  hypothetical protein                               105   3e-23    
ref|WP_038505799.1|  histidine decarboxylase                            107   3e-23    
ref|WP_013621330.1|  histidine decarboxylase                            107   4e-23    
ref|WP_034646581.1|  histidine decarboxylase                            107   4e-23    
gb|EXE40895.1|  histidine decarboxylase                                 105   4e-23    
ref|WP_000603885.1|  histidine decarboxylase                            107   4e-23    
ref|WP_000603884.1|  histidine decarboxylase                            106   4e-23    
ref|WP_025821204.1|  histidine decarboxylase                            106   4e-23    
ref|WP_036788792.1|  MULTISPECIES: histidine decarboxylase              106   4e-23    
ref|WP_000603864.1|  histidine decarboxylase                            106   5e-23    
ref|WP_034524496.1|  histidine decarboxylase                            106   5e-23    
ref|WP_043144304.1|  histidine decarboxylase                            106   5e-23    
ref|WP_031380129.1|  histidine decarboxylase                            106   5e-23    
ref|WP_004746555.1|  histidine decarboxylase                            106   5e-23    
gb|AAO65983.1|  putative pyridoxal 5' phosphate-dependent histidi...    106   5e-23    
ref|WP_034760693.1|  histidine decarboxylase                            106   5e-23    
dbj|BAE94284.1|  histidine decarboxylase                                106   5e-23    
ref|WP_045790969.1|  histidine decarboxylase                            106   5e-23    
emb|CAN84646.1|  histidine decarboxylase                                106   5e-23    
gb|KGY51676.1|  histidine decarboxylase                                 106   5e-23    
ref|WP_017787016.1|  histidine decarboxylase                            106   5e-23    
gb|EQC02399.1|  histidine decarboxylase                                 106   5e-23    
ref|WP_043170531.1|  MULTISPECIES: histidine decarboxylase              106   5e-23    
ref|WP_041204738.1|  histidine decarboxylase                            106   5e-23    
gb|EHI50832.1|  histidine decarboxylase                                 106   5e-23    
ref|WP_042467211.1|  histidine decarboxylase                            106   6e-23    
gb|ABO92295.1|  histidine decarboxylase                                 106   6e-23    
ref|WP_017784253.1|  histidine decarboxylase                            106   6e-23    
ref|WP_034885662.1|  pyridoxal-dependent decarboxylase                  106   6e-23    
ref|WP_000603865.1|  histidine decarboxylase                            106   6e-23    
gb|ERE46826.1|  hypothetical protein N036_34105                         105   6e-23    
ref|WP_017779468.1|  histidine decarboxylase                            106   6e-23    
gb|AFY36874.1|  Histidine decarboxylase                                 108   6e-23    
ref|WP_045132719.1|  histidine decarboxylase                            106   6e-23    
ref|WP_045131090.1|  histidine decarboxylase                            106   7e-23    
ref|WP_045153999.1|  histidine decarboxylase                            106   7e-23    
ref|WP_044119331.1|  histidine decarboxylase                            105   7e-23    
ref|WP_000603877.1|  histidine decarboxylase                            106   7e-23    
ref|WP_014207282.1|  histidine decarboxylase                            105   7e-23    
ref|WP_002126558.1|  histidine decarboxylase                            106   7e-23    
emb|CBV42710.1|  histidine decarboxylase                                106   7e-23    
ref|WP_031978061.1|  histidine decarboxylase                            106   7e-23    
ref|WP_041602526.1|  histidine decarboxylase                            105   8e-23    
ref|WP_011533709.1|  histidine decarboxylase                            106   8e-23    
ref|WP_032060642.1|  histidine decarboxylase                            105   8e-23    
ref|WP_030424673.1|  histidine decarboxylase                            105   8e-23    
ref|WP_000603879.1|  histidine decarboxylase                            105   8e-23    
ref|WP_000603876.1|  histidine decarboxylase                            105   8e-23    
gb|KGF60681.1|  histidine decarboxylase                                 105   8e-23    
ref|WP_000603874.1|  histidine decarboxylase                            105   8e-23    
ref|WP_021511013.1|  histidine decarboxylase                            105   8e-23    
ref|WP_031995260.1|  histidine decarboxylase                            105   8e-23    
ref|WP_031955420.1|  histidine decarboxylase                            105   9e-23    
ref|WP_024436628.1|  histidine decarboxylase                            105   9e-23    
ref|WP_004840538.1|  histidine decarboxylase                            105   9e-23    
ref|WP_034281999.1|  histidine decarboxylase                            105   9e-23    
ref|WP_026632650.1|  histidine decarboxylase                            105   9e-23    
ref|WP_005068053.1|  MULTISPECIES: histidine decarboxylase              105   9e-23    
ref|WP_000603878.1|  histidine decarboxylase                            105   9e-23    
ref|WP_000603871.1|  histidine decarboxylase                            105   9e-23    
ref|WP_032037888.1|  histidine decarboxylase                            105   9e-23    
ref|WP_032009129.1|  histidine decarboxylase                            105   9e-23    
ref|WP_000603872.1|  histidine decarboxylase                            105   9e-23    
ref|WP_032055342.1|  MULTISPECIES: histidine decarboxylase              105   9e-23    
ref|WP_032045777.1|  histidine decarboxylase                            105   9e-23    
ref|WP_017815795.1|  histidine decarboxylase                            105   9e-23    
ref|WP_005073362.1|  histidine decarboxylase                            105   9e-23    
ref|WP_032035746.1|  histidine decarboxylase                            105   9e-23    
ref|WP_032004531.1|  histidine decarboxylase                            105   9e-23    
ref|WP_017386577.1|  MULTISPECIES: histidine decarboxylase              105   9e-23    
ref|WP_000603866.1|  histidine decarboxylase                            105   9e-23    
ref|WP_002058887.1|  histidine decarboxylase                            105   9e-23    
ref|WP_002118388.1|  MULTISPECIES: histidine decarboxylase              105   9e-23    
ref|WP_031976591.1|  histidine decarboxylase                            105   9e-23    
ref|WP_000603870.1|  histidine decarboxylase                            105   9e-23    
ref|WP_000603861.1|  histidine decarboxylase                            105   9e-23    
ref|WP_000603863.1|  histidine decarboxylase                            105   9e-23    
ref|WP_031965236.1|  histidine decarboxylase                            105   1e-22    
ref|WP_005128217.1|  histidine decarboxylase                            105   1e-22    
ref|WP_000603875.1|  histidine decarboxylase                            105   1e-22    
ref|WP_044101067.1|  histidine decarboxylase                            105   1e-22    
ref|WP_031993225.1|  histidine decarboxylase                            105   1e-22    
ref|WP_039098800.1|  histidine decarboxylase                            105   1e-22    
ref|WP_024433575.1|  histidine decarboxylase                            105   1e-22    
ref|WP_033851982.1|  histidine decarboxylase                            105   1e-22    
ref|WP_031964057.1|  histidine decarboxylase                            105   1e-22    
ref|WP_017480701.1|  MULTISPECIES: histidine decarboxylase              105   1e-22    
ref|WP_005138337.1|  histidine decarboxylase                            105   1e-22    
ref|WP_000603869.1|  histidine decarboxylase                            105   1e-22    
ref|WP_043639836.1|  histidine decarboxylase                            105   1e-22    
ref|WP_039759067.1|  histidine decarboxylase                            105   1e-22    
ref|WP_032058148.1|  histidine decarboxylase                            105   1e-22    
ref|WP_032058746.1|  histidine decarboxylase                            105   1e-22    
ref|WP_002046800.1|  histidine decarboxylase                            105   1e-22    
ref|WP_033847713.1|  histidine decarboxylase                            105   1e-22    
ref|WP_032043772.1|  histidine decarboxylase                            105   1e-22    
ref|WP_032027924.1|  histidine decarboxylase                            105   1e-22    
ref|WP_023896388.1|  Histidine decarboxylase                            105   1e-22    
ref|WP_032017576.1|  histidine decarboxylase                            105   1e-22    
ref|WP_000603873.1|  histidine decarboxylase                            105   1e-22    
ref|WP_002132193.1|  histidine decarboxylase                            105   1e-22    
ref|WP_032063040.1|  histidine decarboxylase                            105   1e-22    
ref|WP_017725496.1|  histidine decarboxylase                            105   1e-22    
ref|WP_043592636.1|  histidine decarboxylase                            105   1e-22    
ref|WP_031948968.1|  histidine decarboxylase                            105   1e-22    
ref|WP_000603862.1|  histidine decarboxylase                            105   1e-22    
ref|WP_000603868.1|  histidine decarboxylase                            105   1e-22    
ref|WP_024439211.1|  histidine decarboxylase                            105   1e-22    
ref|WP_000603867.1|  histidine decarboxylase                            105   1e-22    
ref|WP_032874071.1|  histidine decarboxylase                            105   1e-22    
ref|WP_002069908.1|  histidine decarboxylase                            105   1e-22    
ref|WP_009507303.1|  histidine decarboxylase                            105   1e-22    
gb|AII01327.1|  histidine decarboxylase                                 105   1e-22    
ref|WP_005123263.1|  histidine decarboxylase                            105   1e-22    
ref|WP_042050131.1|  histidine decarboxylase                            105   1e-22    
ref|WP_010521317.1|  histidine decarboxylase                            105   1e-22    
ref|WP_017781294.1|  histidine decarboxylase                            105   1e-22    
ref|WP_042005730.1|  histidine decarboxylase                            105   1e-22    
ref|WP_017764935.1|  histidine decarboxylase                            105   1e-22    
ref|WP_045967955.1|  histidine decarboxylase                            105   2e-22    
ref|WP_010635694.1|  MULTISPECIES: histidine decarboxylase              105   2e-22    
gb|AHV37347.1|  histidine decarboxylase                                 105   2e-22    
ref|WP_043706361.1|  histidine decarboxylase                            104   2e-22    
ref|WP_020457998.1|  histidine decarboxylase                            104   2e-22    
ref|WP_023062889.1|  histidine decarboxylase                            104   2e-22    
ref|WP_036985757.1|  histidine decarboxylase                            104   2e-22    
ref|WP_003516909.1|  histidine decarboxylase                            104   3e-22    
gb|EYE31204.1|  histidine decarboxylase domain protein                  100   3e-22    
ref|WP_003514849.1|  histidine decarboxylase                            104   3e-22    
ref|WP_038006112.1|  histidine decarboxylase                            104   3e-22    
ref|WP_017055794.1|  histidine decarboxylase                            104   3e-22    
ref|WP_005306879.1|  MULTISPECIES: histidine decarboxylase              104   3e-22    
gb|EIJ36795.1|  Pyridoxal-dependent decarboxylase                       103   4e-22    
ref|WP_040174945.1|  histidine decarboxylase                            102   4e-22    
ref|WP_040841268.1|  hypothetical protein                               103   4e-22    
ref|WP_032068226.1|  histidine decarboxylase                            103   4e-22    
ref|WP_032866759.1|  histidine decarboxylase                            103   4e-22    
gb|KDW84229.1|  histidine decarboxylase domain protein                  100   5e-22    
ref|WP_031316740.1|  histidine decarboxylase                            103   5e-22    
gb|ERE63402.1|  hypothetical protein N036_41465                         100   5e-22    
ref|WP_045962181.1|  histidine decarboxylase                            102   9e-22    
ref|WP_004401828.1|  histidine decarboxylase                            102   9e-22    
ref|WP_022610851.1|  Histidine decarboxylase                            102   9e-22    
ref|WP_022551512.1|  Histidine decarboxylase                            102   9e-22    
ref|WP_032001354.1|  histidine decarboxylase                            102   9e-22    
ref|WP_005109677.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000603881.1|  histidine decarboxylase                            102   1e-21    
ref|WP_042506313.1|  histidine decarboxylase                            102   1e-21    
ref|WP_045902414.1|  histidine decarboxylase                            102   1e-21    
ref|WP_031961008.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000927250.1|  histidine decarboxylase                            102   1e-21    
ref|WP_042499973.1|  histidine decarboxylase                            102   1e-21    
ref|WP_016653750.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000603882.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000603883.1|  histidine decarboxylase                            102   1e-21    
ref|WP_015192440.1|  Histidine decarboxylase                            104   1e-21    
ref|WP_000603880.1|  histidine decarboxylase                            102   1e-21    
ref|WP_032000503.1|  histidine decarboxylase                            102   1e-21    
ref|WP_005301029.1|  histidine decarboxylase                            102   1e-21    
dbj|BAE94285.1|  histidine decarboxylase                                102   1e-21    
ref|WP_022589616.1|  Histidine decarboxylase                            102   1e-21    
ref|WP_010181748.1|  histidine decarboxylase                            102   1e-21    
ref|WP_013995757.1|  histidine decarboxylase                            102   1e-21    
ref|WP_016529303.1|  histidine decarboxylase                            102   1e-21    
ref|WP_007138876.1|  histidine decarboxylase                            102   1e-21    
ref|WP_017497877.1|  histidine decarboxylase                            102   2e-21    
ref|WP_008878268.1|  Pyridoxal-dependent decarboxylase                  101   2e-21    
ref|WP_012166190.1|  histidine decarboxylase                            103   2e-21    
ref|WP_004863422.1|  histidine decarboxylase                            101   2e-21    
ref|WP_008032061.1|  Pyridoxal-dependent decarboxylase                  102   3e-21    
ref|WP_011154645.1|  histidine decarboxylase                            101   4e-21    
ref|WP_020977926.1|  histidine decarboxylase                            100   4e-21    
ref|WP_015369839.1|  histidine decarboxylase                            100   4e-21    
ref|WP_039045861.1|  histidine decarboxylase                            100   5e-21    
ref|WP_010864579.1|  histidine decarboxylase                            100   5e-21    
ref|WP_026037108.1|  histidine decarboxylase                            100   5e-21    
ref|WP_039116802.1|  histidine decarboxylase                          99.8    1e-20    
ref|WP_038239506.1|  histidine decarboxylase                          99.4    1e-20    
ref|WP_010473064.1|  histidine decarboxylase                            101   1e-20    
ref|WP_040574889.1|  hypothetical protein                             98.6    3e-20    
ref|WP_004156018.1|  histidine decarboxylase                          97.8    5e-20    
ref|WP_038349211.1|  histidine decarboxylase                          97.8    5e-20    
ref|WP_019504461.1|  hypothetical protein                             99.0    8e-20    
gb|AFW71721.1|  hypothetical protein ZEAMMB73_965103                  92.8    1e-19    
gb|KIP17195.1|  hypothetical protein KY49_6986                        96.3    2e-19    
ref|WP_036146264.1|  histidine decarboxylase                          96.3    2e-19    
ref|WP_024740708.1|  histidine decarboxylase                          96.3    2e-19    
ref|WP_038267770.1|  histidine decarboxylase                          95.9    2e-19    
gb|AFW62561.1|  hypothetical protein ZEAMMB73_005785                  91.7    3e-19    
gb|AFK39410.1|  unknown                                               94.7    4e-19    
ref|WP_040734242.1|  hypothetical protein                             94.7    4e-19    
ref|WP_033424613.1|  hypothetical protein                             94.7    5e-19    
ref|WP_038528108.1|  histidine decarboxylase                          94.7    6e-19    
gb|EWC64176.1|  Siderophore biosynthesis L-2,4-diaminobutyrate de...  94.0    1e-18    
ref|WP_006995234.1|  MULTISPECIES: histidine decarboxylase            94.0    1e-18    
ref|WP_005692801.1|  histidine decarboxylase                          94.0    1e-18    
ref|XP_009609584.1|  PREDICTED: histidine decarboxylase-like          92.8    1e-18    
dbj|GAD76103.1|  hypothetical protein VAZ01S_036_00470                93.6    1e-18    
ref|WP_033003777.1|  histidine decarboxylase                          93.6    2e-18    



>ref|XP_009616512.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
 ref|XP_009616514.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
Length=487

 Score =   346 bits (888),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 177/196 (90%), Gaps = 3/196 (2%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            E+ AD R + T  V EPVPP V+SD +D   A N G+  KREIVLGRN+HTTCL VTEPD
Sbjct  19   EVAADSRLDLTT-VAEPVPPVVKSDDVDG--AVNDGEEQKREIVLGRNIHTTCLAVTEPD  75

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            AD+ESTGDKEAYMASVLARYRKTL +RTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPF
Sbjct  76   ADDESTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFDYGALTQLQHFSINNLGDPF  135

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            IESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREVFP+GILY
Sbjct  136  IESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVFPEGILY  195

Query  779  ASRESHYSVFKAARMY  826
            AS+ESHYSVFKAARMY
Sbjct  196  ASKESHYSVFKAARMY  211



>ref|XP_009784234.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
 ref|XP_009784235.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
Length=487

 Score =   343 bits (881),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 178/196 (91%), Gaps = 3/196 (2%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            E+ AD +F+ TA V EPVP  V+S+ +D   A N G+  KREIVLGRN+HTTCL VTEPD
Sbjct  19   EVAADSQFDLTA-VAEPVPAVVKSEDVDG--AVNDGEEQKREIVLGRNIHTTCLAVTEPD  75

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            AD+ESTGDKEAYMASVLARYRKTL +RTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPF
Sbjct  76   ADDESTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFDYGALTQLQHFSINNLGDPF  135

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            IESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREVFP+GILY
Sbjct  136  IESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVFPEGILY  195

Query  779  ASRESHYSVFKAARMY  826
            AS+ESHYSVFKAARMY
Sbjct  196  ASKESHYSVFKAARMY  211



>ref|XP_011101473.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
 ref|XP_011101480.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=517

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 173/190 (91%), Gaps = 10/190 (5%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADK-REIVLGRNVHTTCLEVTEPDADNEST  436
            F+P A+VTEPVPP   S         NG  A+K REIVLG+NVHTTCLEVTEPDAD+EST
Sbjct  35   FDPMAVVTEPVPPVADS---------NGHDAEKGREIVLGKNVHTTCLEVTEPDADDEST  85

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  616
            GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYG
Sbjct  86   GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYG  145

Query  617  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESH  796
            VHSRQFEVGVLDWFARLW+IEK++YWGYITNCGTEGNLHGILVGREVFPDGILYAS+ESH
Sbjct  146  VHSRQFEVGVLDWFARLWEIEKNDYWGYITNCGTEGNLHGILVGREVFPDGILYASKESH  205

Query  797  YSVFKAARMY  826
            YSVFKAARMY
Sbjct  206  YSVFKAARMY  215



>ref|XP_003593130.1| Histidine decarboxylase [Medicago truncatula]
Length=311

 Score =   333 bits (854),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 176/198 (89%), Gaps = 4/198 (2%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAA--NGGKADKREIVLGRNVHTTCLEVTE  412
            EL  D  F+ +AI+ +PVPP V +D       A  NGGK +KREIVLGRN+HTTCLEVTE
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVAADNGIGKEEAKINGGK-EKREIVLGRNIHTTCLEVTE  76

Query  413  PDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGD  592
            P+AD+E TGD++A+MASVLARYRK+L ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGD
Sbjct  77   PEADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFDYGALSQLQHFSINNLGD  136

Query  593  PFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGI  772
            PFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREV PDGI
Sbjct  137  PFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVLPDGI  196

Query  773  LYASRESHYSVFKAARMY  826
            LYASRESHYS+FKAARMY
Sbjct  197  LYASRESHYSIFKAARMY  214



>ref|XP_006362822.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362823.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   338 bits (868),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = +2

Query  248  ADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADN  427
            AD RF+PTA+V E VP  V+S+ +D+     GG+  +REIVLGRN+HT+   VTEPDAD+
Sbjct  21   ADVRFDPTAVVPELVPAVVKSEGVDAA-VNGGGEEQEREIVLGRNIHTSSFSVTEPDADD  79

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  607
            +STGDKEAYMASVLARYRKTL +RTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  80   DSTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFDYGALTQLQHFSINNLGDPFIES  139

Query  608  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  787
            NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFP+GILYAS+
Sbjct  140  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPEGILYASK  199

Query  788  ESHYSVFKAARMY  826
            ESHYS+FKAARMY
Sbjct  200  ESHYSIFKAARMY  212



>ref|XP_004237774.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
 ref|XP_010320069.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
Length=482

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 175/193 (91%), Gaps = 2/193 (1%)
 Frame = +2

Query  248  ADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADN  427
            AD RF+PTA+V E VP  V+S+ +D+     GG+  KREIVLGRN+HT+   VTEPDAD+
Sbjct  21   ADVRFDPTAVVPELVPAVVKSE-VDAA-VNGGGQEQKREIVLGRNIHTSSFSVTEPDADD  78

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  607
            +STGDKEAYMASVLARYRKTL +RTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  79   DSTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFDYGALTQLQHFSINNLGDPFIES  138

Query  608  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  787
            NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFP+GILYAS+
Sbjct  139  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPEGILYASK  198

Query  788  ESHYSVFKAARMY  826
            ESHYS+FKAARMY
Sbjct  199  ESHYSIFKAARMY  211



>gb|ACJ85197.1| unknown [Medicago truncatula]
Length=486

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 176/198 (89%), Gaps = 4/198 (2%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAA--NGGKADKREIVLGRNVHTTCLEVTE  412
            EL  D  F+ +AI+ +PVPP V +D       A  NGGK +KREIVLGRN+HTTCLEVTE
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVAADNGIGKEEAKINGGK-EKREIVLGRNIHTTCLEVTE  76

Query  413  PDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGD  592
            P+AD+E TGD++A+MASVLARYRK+L ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGD
Sbjct  77   PEADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFDYGALSQLQHFSINNLGD  136

Query  593  PFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGI  772
            PFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREV PDGI
Sbjct  137  PFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVLPDGI  196

Query  773  LYASRESHYSVFKAARMY  826
            LYASRESHYS+FKAARMY
Sbjct  197  LYASRESHYSIFKAARMY  214



>ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63380.1| serine decarboxylase [Medicago truncatula]
Length=486

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 176/198 (89%), Gaps = 4/198 (2%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAA--NGGKADKREIVLGRNVHTTCLEVTE  412
            EL  D  F+ +AI+ +PVPP V +D       A  NGGK +KREIVLGRN+HTTCLEVTE
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVAADNGIGKEEAKINGGK-EKREIVLGRNIHTTCLEVTE  76

Query  413  PDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGD  592
            P+AD+E TGD++A+MASVLARYRK+L ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGD
Sbjct  77   PEADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFDYGALSQLQHFSINNLGD  136

Query  593  PFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGI  772
            PFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREV PDGI
Sbjct  137  PFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVLPDGI  196

Query  773  LYASRESHYSVFKAARMY  826
            LYASRESHYS+FKAARMY
Sbjct  197  LYASRESHYSIFKAARMY  214



>ref|XP_011656638.1| PREDICTED: serine decarboxylase isoform X1 [Cucumis sativus]
 ref|XP_011656639.1| PREDICTED: serine decarboxylase isoform X1 [Cucumis sativus]
Length=486

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 170/194 (88%), Gaps = 3/194 (2%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  424
            G+F+   + ++P+PP   S+    L+     +  +  KREIVLGRNVHTTCL +TEPDA+
Sbjct  20   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTTCLSITEPDAN  79

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  604
            +ESTGDKEAYMASVLARYRK L+ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGDPFIE
Sbjct  80   DESTGDKEAYMASVLARYRKNLLERTKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIE  139

Query  605  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS  784
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREV PDGILYAS
Sbjct  140  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVLPDGILYAS  199

Query  785  RESHYSVFKAARMY  826
            RE+HYSVFKAARMY
Sbjct  200  RETHYSVFKAARMY  213



>ref|XP_010108654.1| Histidine decarboxylase [Morus notabilis]
 gb|EXC19910.1| Histidine decarboxylase [Morus notabilis]
Length=483

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 172/196 (88%), Gaps = 7/196 (4%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            E+     F+P A+V EP+PP V S+ +       G +  KREIVLGRNVHTTCL VTEP+
Sbjct  25   EILLTEDFDPAAVVAEPLPPVVMSNGV-------GKEIKKREIVLGRNVHTTCLAVTEPE  77

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            A++E TGDK+AYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPF
Sbjct  78   ANDELTGDKDAYMASVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPF  137

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            IESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREVF DG+LY
Sbjct  138  IESNYGVHSRQFEVGVLDWFARLWEIEKEEYWGYITNCGTEGNLHGILVGREVFLDGVLY  197

Query  779  ASRESHYSVFKAARMY  826
            AS+ESHYSVFKAARMY
Sbjct  198  ASKESHYSVFKAARMY  213



>ref|XP_004140972.1| PREDICTED: serine decarboxylase isoform X2 [Cucumis sativus]
 gb|KGN46150.1| hypothetical protein Csa_6G057160 [Cucumis sativus]
Length=481

 Score =   329 bits (843),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 170/194 (88%), Gaps = 3/194 (2%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  424
            G+F+   + ++P+PP   S+    L+     +  +  KREIVLGRNVHTTCL +TEPDA+
Sbjct  15   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTTCLSITEPDAN  74

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  604
            +ESTGDKEAYMASVLARYRK L+ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGDPFIE
Sbjct  75   DESTGDKEAYMASVLARYRKNLLERTKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIE  134

Query  605  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS  784
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREV PDGILYAS
Sbjct  135  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVLPDGILYAS  194

Query  785  RESHYSVFKAARMY  826
            RE+HYSVFKAARMY
Sbjct  195  RETHYSVFKAARMY  208



>ref|XP_008381807.1| PREDICTED: histidine decarboxylase [Malus domestica]
Length=479

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 177/199 (89%), Gaps = 4/199 (2%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQS-DKLD--SPPAANGGKADKREIVLGRNVHTTCLEVT  409
            E+ +D  F+PTA+V EP+PP V S D  D     A +   + ++++VLGRNVHTTCL VT
Sbjct  11   EMLSDD-FDPTAVVAEPLPPVVTSTDDCDLLGKLAEDRKGSREKQMVLGRNVHTTCLAVT  69

Query  410  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLG  589
            EP+++++ TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLG
Sbjct  70   EPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYPYNLDFDYGALTQLQHFSINNLG  129

Query  590  DPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDG  769
            DPFIESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHG+LVGREVFPDG
Sbjct  130  DPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVLVGREVFPDG  189

Query  770  ILYASRESHYSVFKAARMY  826
            ILYASRESHYS+FKAARMY
Sbjct  190  ILYASRESHYSIFKAARMY  208



>ref|XP_002306690.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE93686.1| serine decarboxylase family protein [Populus trichocarpa]
Length=478

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 169/190 (89%), Gaps = 9/190 (5%)
 Frame = +2

Query  260  FNPTAIVT-EPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  436
            F+ +A+V  EP+PP V         A NG K + REIVLG+NVHTTCLEVTEP+A++E T
Sbjct  20   FDISAVVQPEPLPPIV--------AAENGDKQNGREIVLGKNVHTTCLEVTEPEANDEFT  71

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  616
            GDKEAYMASVLARYRK L+ERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYG
Sbjct  72   GDKEAYMASVLARYRKNLMERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYG  131

Query  617  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESH  796
            VHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREVFPDG+LYASRESH
Sbjct  132  VHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVFPDGVLYASRESH  191

Query  797  YSVFKAARMY  826
            YSVFKAARMY
Sbjct  192  YSVFKAARMY  201



>gb|KHG24953.1| Histidine decarboxylase [Gossypium arboreum]
Length=478

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 165/191 (86%), Gaps = 6/191 (3%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNES  433
            G F PTAI  EP+PP V  + +D P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAIEVEPLPPVVPENGVDKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  613
            TGDKEA MA VLARYRK L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNY
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNY  136

Query  614  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRES  793
            GVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRES
Sbjct  137  GVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRES  196

Query  794  HYSVFKAARMY  826
            HYSVFKAARMY
Sbjct  197  HYSVFKAARMY  207



>ref|XP_009368241.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 177/199 (89%), Gaps = 4/199 (2%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQS-DKLD--SPPAANGGKADKREIVLGRNVHTTCLEVT  409
            E+ +D  F+PTA+V EP+PP V S D  D     A +   + ++++VLGRNVHTTCL VT
Sbjct  11   EMLSDD-FDPTAVVAEPLPPVVTSTDDCDLLGKLAEDHKGSREKQMVLGRNVHTTCLAVT  69

Query  410  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLG  589
            EP+++++ TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLG
Sbjct  70   EPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYPYNLDFDYGALTQLQHFSINNLG  129

Query  590  DPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDG  769
            DPFIESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHG+LVGREVFPDG
Sbjct  130  DPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVLVGREVFPDG  189

Query  770  ILYASRESHYSVFKAARMY  826
            ILYASRESHYS+FKAARMY
Sbjct  190  ILYASRESHYSIFKAARMY  208



>ref|XP_008441526.1| PREDICTED: histidine decarboxylase isoform X2 [Cucumis melo]
Length=481

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 170/194 (88%), Gaps = 3/194 (2%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  424
            G+F+   + ++P+PP   S+    L+     +  +  KREIVLGRNVHT+CL +TEPDA+
Sbjct  15   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTSCLSITEPDAN  74

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  604
            +ESTGDKEAYMASVLARYRK+L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIE
Sbjct  75   DESTGDKEAYMASVLARYRKSLLERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIE  134

Query  605  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS  784
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREV  DGILYAS
Sbjct  135  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVLSDGILYAS  194

Query  785  RESHYSVFKAARMY  826
            RESHYSVFKAARMY
Sbjct  195  RESHYSVFKAARMY  208



>ref|XP_008441525.1| PREDICTED: histidine decarboxylase isoform X1 [Cucumis melo]
Length=486

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 170/194 (88%), Gaps = 3/194 (2%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  424
            G+F+   + ++P+PP   S+    L+     +  +  KREIVLGRNVHT+CL +TEPDA+
Sbjct  20   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTSCLSITEPDAN  79

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  604
            +ESTGDKEAYMASVLARYRK+L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIE
Sbjct  80   DESTGDKEAYMASVLARYRKSLLERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIE  139

Query  605  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS  784
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREV  DGILYAS
Sbjct  140  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVLSDGILYAS  199

Query  785  RESHYSVFKAARMY  826
            RESHYSVFKAARMY
Sbjct  200  RESHYSVFKAARMY  213



>ref|XP_009343619.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 177/199 (89%), Gaps = 4/199 (2%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQS-DKLD--SPPAANGGKADKREIVLGRNVHTTCLEVT  409
            E+ +D  F+PTA+V EP+PP V S D  D     A +   + ++++VLGRNVHTTCL VT
Sbjct  11   EMLSDD-FDPTAVVAEPLPPVVTSTDDCDLLGKLAEDHKGSREKQMVLGRNVHTTCLAVT  69

Query  410  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLG  589
            EP+++++ TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLG
Sbjct  70   EPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYPYNLDFDYGALTQLQHFSINNLG  129

Query  590  DPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDG  769
            DPFIESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHG+LVGREVFPDG
Sbjct  130  DPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVLVGREVFPDG  189

Query  770  ILYASRESHYSVFKAARMY  826
            ILYASRESHYS+FKAARMY
Sbjct  190  ILYASRESHYSIFKAARMY  208



>ref|XP_009368490.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 3/192 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  430
            F+PTA+VTEP+PP V S     L    A +     ++++VLGRNVHTTCL VTEP+ ++E
Sbjct  17   FDPTAVVTEPLPPVVTSTADCDLIGKLAEDHKGTREKQMVLGRNVHTTCLAVTEPEPNDE  76

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  610
             TGDK+AYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESN
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESN  136

Query  611  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRE  790
            YGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHG+LVGREVFPDGILYASRE
Sbjct  137  YGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVLVGREVFPDGILYASRE  196

Query  791  SHYSVFKAARMY  826
            SHYS+FKAARMY
Sbjct  197  SHYSIFKAARMY  208



>ref|XP_003547587.1| PREDICTED: histidine decarboxylase [Glycine max]
 gb|KHN33495.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   325 bits (834),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+ TA++ +PVP  V  + +    A      +KREIVLGRNVHTTCLEVTEP+AD+E TG
Sbjct  25   FDATAVIIDPVPSAVVDNGILKEEAQINKGKEKREIVLGRNVHTTCLEVTEPEADDEITG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            D+EA+MASVLARY++ L ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGV
Sbjct  85   DREAHMASVLARYKRALTERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESNYGV  144

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY
Sbjct  145  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  204

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  205  SVFKAARMY  213



>ref|XP_004290538.1| PREDICTED: serine decarboxylase [Fragaria vesca subsp. vesca]
Length=476

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 172/194 (89%), Gaps = 12/194 (6%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD-----KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  424
            F+PTA+V EP+PP V ++     K+   P       +KREIVLGRNVHTTCL VTEPDA+
Sbjct  18   FDPTAVVAEPLPPVVTTNGNLIGKVAEDP-------NKREIVLGRNVHTTCLAVTEPDAN  70

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  604
            +E TGDK+AYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG LSQLQHFSINNLGDPFIE
Sbjct  71   DEFTGDKDAYMASVLARYRKTLMERTKHHLGYPYNLDFDYGALSQLQHFSINNLGDPFIE  130

Query  605  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS  784
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREV PDGILYAS
Sbjct  131  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVHPDGILYAS  190

Query  785  RESHYSVFKAARMY  826
            +++HYS+FKAARMY
Sbjct  191  KDTHYSIFKAARMY  204



>ref|XP_010500117.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=481

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+PTA+VTEP+P PV +++ ++    NG   D RE+VLGRN+HTT L VTEP+ +++ TG
Sbjct  24   FDPTAVVTEPLPSPVTTNE-ENLKKTNGVGGD-REMVLGRNIHTTSLAVTEPEVNDDFTG  81

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  82   DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  141

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE+FPDGILYASRESHY
Sbjct  142  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMFPDGILYASRESHY  201

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  202  SVFKAARMY  210



>ref|XP_011044197.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=478

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 168/190 (88%), Gaps = 9/190 (5%)
 Frame = +2

Query  260  FNPTAIVT-EPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  436
            F+ +A+V  EP+PP +         A NG K + REIVLG+NVHTTCLEVTEP+A++E T
Sbjct  20   FDISAVVQPEPLPPIL--------AAENGDKQNGREIVLGKNVHTTCLEVTEPEANDEFT  71

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  616
            GDKEAYMASVLARYRK L+ERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYG
Sbjct  72   GDKEAYMASVLARYRKNLMERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYG  131

Query  617  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESH  796
            VHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREV PDG+LYASRESH
Sbjct  132  VHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVLPDGVLYASRESH  191

Query  797  YSVFKAARMY  826
            YSVFKAARMY
Sbjct  192  YSVFKAARMY  201



>gb|KJB16468.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=478

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 165/191 (86%), Gaps = 6/191 (3%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNES  433
            G F PTA+  EP+PP V  + ++ P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAMKVEPLPPVVPENGVEKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  613
            TGDKEA MA VLARYRK L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNY
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNY  136

Query  614  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRES  793
            GVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGTEGNLHGILVGREVFPDG+LYASRES
Sbjct  137  GVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGILVGREVFPDGVLYASRES  196

Query  794  HYSVFKAARMY  826
            HYSVFKAARMY
Sbjct  197  HYSVFKAARMY  207



>ref|XP_002302186.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE81459.1| serine decarboxylase family protein [Populus trichocarpa]
Length=463

 Score =   322 bits (826),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +2

Query  332  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            A NG K + REIVLGRNVHTTCLEVTEP+A++ESTGDKEAYMASVLARYRK L+ERTK+H
Sbjct  27   AENGDKQNGREIVLGRNVHTTCLEVTEPEANDESTGDKEAYMASVLARYRKNLMERTKHH  86

Query  512  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  691
            LGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEK EY
Sbjct  87   LGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKSEY  146

Query  692  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  147  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  191



>ref|XP_011042836.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
 ref|XP_011042837.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=463

 Score =   322 bits (826),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +2

Query  332  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            A NG K ++REIVLG+NVHTTCLEVTEP+A++ESTGDKEAYMASVLARYRK L+ERTK+H
Sbjct  27   AENGDKQNEREIVLGKNVHTTCLEVTEPEANDESTGDKEAYMASVLARYRKNLMERTKHH  86

Query  512  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  691
            LGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEK EY
Sbjct  87   LGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKSEY  146

Query  692  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  147  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  191



>ref|NP_001241244.1| uncharacterized protein LOC100795577 [Glycine max]
 gb|ACU18100.1| unknown [Glycine max]
Length=483

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+ TA++ +PVP  V  + +    A      +KREIVLGRN+HT+CLEVTEP+AD+E TG
Sbjct  23   FDATAVIIDPVPLAVVDNGIVKEEAQIIKGKEKREIVLGRNIHTSCLEVTEPEADDEVTG  82

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            D+EA+MASVLARY++ L ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGV
Sbjct  83   DREAHMASVLARYKRALTERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESNYGV  142

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY
Sbjct  143  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  202

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  203  SVFKAARMY  211



>ref|XP_012066036.1| PREDICTED: serine decarboxylase [Jatropha curcas]
 ref|XP_012066037.1| PREDICTED: serine decarboxylase [Jatropha curcas]
 gb|KDP43008.1| hypothetical protein JCGZ_25194 [Jatropha curcas]
Length=484

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 172/196 (88%), Gaps = 3/196 (2%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            E+ A+  F+  A++ EP+PP V +++  +       K + REIVLGRN+HT CLEVTEPD
Sbjct  20   EILAED-FDLRAVIKEPLPPVVTAEEEVAGEEET--KQNGREIVLGRNLHTECLEVTEPD  76

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            A++E TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  77   ANDEHTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDYGALGQLQHFSINNLGDPF  136

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            IESNYGVHSRQFEVGVLDWFARLW+IEKD+YWGYITNCGTEGNLHGILVGREV PDGILY
Sbjct  137  IESNYGVHSRQFEVGVLDWFARLWEIEKDQYWGYITNCGTEGNLHGILVGREVLPDGILY  196

Query  779  ASRESHYSVFKAARMY  826
            ASRESHYSVFKAARMY
Sbjct  197  ASRESHYSVFKAARMY  212



>gb|KHN26720.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   323 bits (827),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+ TA++ +PVP  V  + +    A      +KREIVLGRN+HT+CLEVTEP+AD+E TG
Sbjct  25   FDATAVIIDPVPLAVVDNGIVKEEAQIIKGKEKREIVLGRNIHTSCLEVTEPEADDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            D+EA+MASVLARY++ L ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGV
Sbjct  85   DREAHMASVLARYKRALTERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESNYGV  144

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY
Sbjct  145  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  204

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  205  SVFKAARMY  213



>ref|XP_010260914.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 169/196 (86%), Gaps = 16/196 (8%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKAD-------KREIVLGRNVHTTCLEVTEPD  418
            F+P A++++P+PP V           NGG  D        REIVLG+NVHT CL VTEPD
Sbjct  25   FDPIAMISDPLPPQV---------VENGGIVDDEAEDKQNREIVLGKNVHTMCLAVTEPD  75

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            AD+E TG++EAYMASVLARYR++L+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPF
Sbjct  76   ADDEVTGEREAYMASVLARYRRSLIERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPF  135

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            IESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREVFPDGILY
Sbjct  136  IESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVFPDGILY  195

Query  779  ASRESHYSVFKAARMY  826
            ASRESHYSVFKAARMY
Sbjct  196  ASRESHYSVFKAARMY  211



>ref|XP_007201012.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
 gb|EMJ02211.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
Length=480

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD---KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  430
            F+PTA+V EP+P  V SD    L    A +   + ++ +VLGRNVHTTCL VTEP+A++E
Sbjct  17   FDPTAVVAEPLPTVVTSDVNCDLIGKLAEDLKGSLEKPMVLGRNVHTTCLAVTEPEANDE  76

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  610
             TGDK+AYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESN
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESN  136

Query  611  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRE  790
            YGVHSRQFEVGVLDWFARLW+IEK +YWGYITNCGTEGNLHG+LVGREVFPDGILYASRE
Sbjct  137  YGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGVLVGREVFPDGILYASRE  196

Query  791  SHYSVFKAARMY  826
            SHYS+FKAARMY
Sbjct  197  SHYSIFKAARMY  208



>ref|XP_008243632.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=480

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD---KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  430
            F+PTA+V EP+P  V SD    L    A +   + ++ +VLGRNVHTTCL VTEP+A++E
Sbjct  17   FDPTAVVAEPLPTVVTSDVNCDLIGKFAEDLKSSLEKPMVLGRNVHTTCLAVTEPEANDE  76

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  610
             TGDK+AYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESN
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESN  136

Query  611  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRE  790
            YGVHSRQFEVGVLDWFARLW+IEK +YWGYITNCGTEGNLHG+LVGREVFPDGILYASRE
Sbjct  137  YGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGVLVGREVFPDGILYASRE  196

Query  791  SHYSVFKAARMY  826
            SHYS+FKAARMY
Sbjct  197  SHYSIFKAARMY  208



>ref|XP_010519398.1| PREDICTED: serine decarboxylase-like [Tarenaya hassleriana]
Length=489

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 169/199 (85%), Gaps = 13/199 (7%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQS----------DKLDSPPAANGGKADKREIVLGRNVHTTCLEVT  409
            F+PTA+V EP+PP  ++          D        NGG+   +EIVLGRNVHT+CL VT
Sbjct  23   FDPTAVVVEPLPPLAETANGIGYSGEDDVFQVKEMLNGGE---KEIVLGRNVHTSCLAVT  79

Query  410  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLG  589
            EP+A++E TGDKEAYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L QLQHFSINNLG
Sbjct  80   EPEANDEFTGDKEAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALGQLQHFSINNLG  139

Query  590  DPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDG  769
            DPFIESNYGVHSR FEVGVLDWFARLW+IEKD+YWGYITNCGTEGNLHGILVGREVFPDG
Sbjct  140  DPFIESNYGVHSRPFEVGVLDWFARLWEIEKDDYWGYITNCGTEGNLHGILVGREVFPDG  199

Query  770  ILYASRESHYSVFKAARMY  826
            +LYAS ESHYSVFKAARMY
Sbjct  200  VLYASCESHYSVFKAARMY  218



>ref|XP_008339120.1| PREDICTED: histidine decarboxylase-like [Malus domestica]
Length=479

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  430
            F+PTA+VTEP+PP + S     L    A +     ++++VLGRNVHTTCL VTEP+ ++E
Sbjct  17   FDPTAVVTEPLPPVLTSTADCDLIGKLAEDHKGTREKQMVLGRNVHTTCLAVTEPEPNDE  76

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  610
             TGDK+AYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESN
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESN  136

Query  611  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRE  790
            YGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHG+LVGREVFP GILYASRE
Sbjct  137  YGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVLVGREVFPVGILYASRE  196

Query  791  SHYSVFKAARMY  826
            SHYS+FKAARMY
Sbjct  197  SHYSIFKAARMY  208



>emb|CDX80723.1| BnaC08g05570D [Brassica napus]
Length=489

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 173/204 (85%), Gaps = 11/204 (5%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPV--------QSDKLDSPPAANGGKADKREIVLGRNVHTT  394
            ++ +DG F+PTA+  EP+P PV        + + L      NGG   +RE+VLGRNVHTT
Sbjct  18   DILSDG-FDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVNGG--GEREMVLGRNVHTT  74

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFS  574
             L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFS
Sbjct  75   SLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFS  134

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            INNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE
Sbjct  135  INNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGRE  194

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            VFPDGILYAS ESHYSVFKAARMY
Sbjct  195  VFPDGILYASSESHYSVFKAARMY  218



>ref|XP_010461415.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=485

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPP--AANGGKADKREIVLGRNVHTTCLEVTEPDADNES  433
            F+PTA+VTEP+P PV ++  +         G    RE+VLGRN+HTT L VTEP+ +++ 
Sbjct  24   FDPTAVVTEPLPSPVTTNGTEGEENLKKTNGVGGDREMVLGRNIHTTSLAVTEPEVNDDF  83

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  613
            TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNY
Sbjct  84   TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNY  143

Query  614  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRES  793
            GVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE+FPDGILYASRES
Sbjct  144  GVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMFPDGILYASRES  203

Query  794  HYSVFKAARMY  826
            HYSVFKAARMY
Sbjct  204  HYSVFKAARMY  214



>ref|XP_004485538.1| PREDICTED: histidine decarboxylase-like isoform X1 [Cicer arietinum]
 ref|XP_004485539.1| PREDICTED: histidine decarboxylase-like isoform X2 [Cicer arietinum]
 ref|XP_004485540.1| PREDICTED: histidine decarboxylase-like isoform X3 [Cicer arietinum]
Length=485

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+  AI+ +P+P  V  + +    A      +KR+IVLGRN+HT+CLEVTEP+AD+E TG
Sbjct  25   FDVAAIIKDPLPSLVAENGIVKEEAQINEGNEKRKIVLGRNIHTSCLEVTEPEADDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            D+EA+MASVLARYR++L ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGV
Sbjct  85   DREAHMASVLARYRRSLTERTKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGV  144

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREV PDGILYASRESHY
Sbjct  145  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVLPDGILYASRESHY  204

Query  800  SVFKAARMY  826
            S+FKAARMY
Sbjct  205  SIFKAARMY  213



>ref|XP_010530241.1| PREDICTED: serine decarboxylase [Tarenaya hassleriana]
Length=498

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 172/207 (83%), Gaps = 21/207 (10%)
 Frame = +2

Query  260  FNPTAIVTEPVPP-----------------PVQSD-KLDSPPAANGGKADKREIVLGRNV  385
            F+PTA+V EP+PP                 PV+   K  +    NGG+   +EIVLGRNV
Sbjct  24   FDPTAVVAEPLPPLAETVNGVGDFEEDDVCPVKEKVKNTTTTEMNGGE---KEIVLGRNV  80

Query  386  HTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQ  565
            HTTCL VTEP+A+++ TGDKEAYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L QLQ
Sbjct  81   HTTCLAVTEPEANDDFTGDKEAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALGQLQ  140

Query  566  HFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILV  745
            HFSINNLGDPFIESNYGVHSR FEVGVLDWFARLW+IEKD+YWGYITNCGTEGNLHGILV
Sbjct  141  HFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIEKDDYWGYITNCGTEGNLHGILV  200

Query  746  GREVFPDGILYASRESHYSVFKAARMY  826
            GREVFPDG+LYASRESHYSVFKAARMY
Sbjct  201  GREVFPDGVLYASRESHYSVFKAARMY  227



>ref|XP_007019463.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOY16688.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=491

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 173/197 (88%), Gaps = 10/197 (5%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANG------GKADK--REIVLGRNVHTTCLEVTEP  415
            F+PTA+V EP+PP V +   D  P+ +       GK  K  REIVLGRNVHT+CL VTEP
Sbjct  25   FDPTAVVAEPLPPVVTA--ADGGPSESEEEEEGVGKPVKKSREIVLGRNVHTSCLAVTEP  82

Query  416  DADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDP  595
            +A++E TGDK+AYMA VLARYRKTL+ERTK+HLGYPYNLDF+YG L+QLQHFSINNLGDP
Sbjct  83   EANDEFTGDKDAYMAGVLARYRKTLMERTKHHLGYPYNLDFEYGALAQLQHFSINNLGDP  142

Query  596  FIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGIL  775
            FIESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGTEGNLHGILVGREVFPDGIL
Sbjct  143  FIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVFPDGIL  202

Query  776  YASRESHYSVFKAARMY  826
            YASRESHYS+FKAARMY
Sbjct  203  YASRESHYSIFKAARMY  219



>ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis]
 gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis]
Length=471

 Score =   320 bits (821),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 168/196 (86%), Gaps = 16/196 (8%)
 Frame = +2

Query  242  LFADGRFNPTAIVT-EPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            L  D   + TAIV  EP+P  V+++               REIVLG+NVHT+CLEVTEPD
Sbjct  19   LREDIDLDLTAIVAAEPLPEVVENE---------------REIVLGKNVHTSCLEVTEPD  63

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            AD+E TGDK+AYMASVLARYRKTL+ERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  64   ADDELTGDKDAYMASVLARYRKTLIERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPF  123

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            IESNYGVHSRQFEVGVLDWFARLW+IE++EYWGYITNCGTEGNLHGILVGREVFPDG+LY
Sbjct  124  IESNYGVHSRQFEVGVLDWFARLWEIERNEYWGYITNCGTEGNLHGILVGREVFPDGVLY  183

Query  779  ASRESHYSVFKAARMY  826
            ASRESHYSVFKAARMY
Sbjct  184  ASRESHYSVFKAARMY  199



>dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris]
Length=487

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD-KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  436
             +PTA+V EP+PP    D ++         +  +REIVLGRN+H++CL++TEP+ ++E T
Sbjct  26   LDPTAVVLEPLPPVANGDVEVGVMKKMKTTENGEREIVLGRNIHSSCLDITEPEDNDELT  85

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  616
            GDKEAYMASVLARYR++L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYG
Sbjct  86   GDKEAYMASVLARYRQSLLERTKYHLGYPYNLDFDYGALNQLQHFSINNLGDPFIESNYG  145

Query  617  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESH  796
            VHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS+ESH
Sbjct  146  VHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASKESH  205

Query  797  YSVFKAARMY  826
            YS+FKAARMY
Sbjct  206  YSLFKAARMY  215



>ref|XP_010680495.1| PREDICTED: serine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD-KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  436
             +PTA+V EP+PP    D ++         +  +REIVLGRN+H++CL++TEP+ ++E T
Sbjct  26   LDPTAVVLEPLPPVANGDVEVGVMKKMKTTENGEREIVLGRNIHSSCLDITEPEDNDELT  85

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  616
            GDKEAYMASVLARYR++L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYG
Sbjct  86   GDKEAYMASVLARYRQSLLERTKYHLGYPYNLDFDYGALNQLQHFSINNLGDPFIESNYG  145

Query  617  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESH  796
            VHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS+ESH
Sbjct  146  VHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASKESH  205

Query  797  YSVFKAARMY  826
            YS+FKAARMY
Sbjct  206  YSLFKAARMY  215



>ref|NP_175036.1| serine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q9MA74.1|SDC1_ARATH RecName: Full=Serine decarboxylase; Short=AtSDC; AltName: Full=Protein 
EMBRYO DEFECTIVE 1075; AltName: Full=Serine decarboxylase 
1; Short=AtSDC1 [Arabidopsis thaliana]
 gb|AAF63121.1|AC009526_6 Putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK25943.1|AF360233_1 putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK77493.1|AF389349_1 serine decarboxylase [Arabidopsis thaliana]
 gb|AAK64091.1| putative histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79456.1| histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79457.1| histidine decarboxylase [Arabidopsis thaliana]
 gb|AEE31989.1| serine decarboxylase 1 [Arabidopsis thaliana]
Length=482

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 4/189 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+PTA+VTEP+PPPV     +   A  GG   +RE+VLGRN+HTT L VTEP+ ++E TG
Sbjct  27   FDPTAVVTEPLPPPVT----NGIGADKGGGGGEREMVLGRNIHTTSLAVTEPEVNDEFTG  82

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            DKEAYMASVLARYRKTLVERTK HLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  83   DKEAYMASVLARYRKTLVERTKNHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  142

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE+FPDGILYASRESHY
Sbjct  143  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMFPDGILYASRESHY  202

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  203  SVFKAARMY  211



>ref|XP_009145064.1| PREDICTED: serine decarboxylase [Brassica rapa]
 emb|CDY40942.1| BnaAnng06510D [Brassica napus]
Length=472

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 170/196 (87%), Gaps = 13/196 (7%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            E+ +D  F+PTA+VTEP+P PV           NGG   +RE+VLGRNVHTT L VTEP+
Sbjct  19   EILSDD-FDPTAVVTEPLPSPV----------TNGG--GEREMVLGRNVHTTSLAVTEPE  65

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            +++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  66   SNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPF  125

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            IESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE+ PDGILY
Sbjct  126  IESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMLPDGILY  185

Query  779  ASRESHYSVFKAARMY  826
            AS ESHYSVFKAARMY
Sbjct  186  ASTESHYSVFKAARMY  201



>ref|XP_010241731.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
 ref|XP_010241733.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
             + T +++EP+ P   ++++ S          KREIVLGRNVHT CL VTEPDAD+E TG
Sbjct  25   IDATTVISEPLSPV--NEEIVSDETKKSDVEQKREIVLGRNVHTMCLAVTEPDADDEVTG  82

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            ++EAYMASVLARYRK+L+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGV
Sbjct  83   EREAYMASVLARYRKSLIERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGV  142

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFA LW++EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY
Sbjct  143  HSRQFEVGVLDWFAHLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  202

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  203  SVFKAARMY  211



>ref|XP_007159060.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 ref|XP_007159061.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31054.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31055.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=454

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLD---SPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  430
            FN TA +T+ V  P+ +++ D      A NG +  +R IVLGRN+HT CLEV+EPD D+E
Sbjct  25   FNSTAFITDHVHVPLMAEEDDIAGKGEAQNGTENGERNIVLGRNIHTMCLEVSEPDIDDE  84

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  610
             TG++EAYMASVLA+Y+K+L ERTKYHLGYPYNLDFDY  LSQLQHFSINNLGDPFIESN
Sbjct  85   VTGEREAYMASVLAKYKKSLTERTKYHLGYPYNLDFDYEALSQLQHFSINNLGDPFIESN  144

Query  611  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRE  790
            YGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS E
Sbjct  145  YGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASEE  204

Query  791  SHYSVFKAARMY  826
            SHYSVFKAARMY
Sbjct  205  SHYSVFKAARMY  216



>ref|XP_006393773.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
 gb|ESQ31059.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
Length=489

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 174/204 (85%), Gaps = 11/204 (5%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQ----SDKLDSPP----AANGGKADKREIVLGRNVHTT  394
            E+ +D  F+PTA+VTEP+PP +     +D  +  P      NGG    RE+VLGRNVHTT
Sbjct  18   EILSDD-FDPTAVVTEPLPPSLTNGTGADHGEENPRKTVVTNGG--GDREMVLGRNVHTT  74

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFS  574
             L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFS
Sbjct  75   SLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFS  134

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            INNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE
Sbjct  135  INNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGRE  194

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            +FPDGILYAS ESHYSVFKAARMY
Sbjct  195  MFPDGILYASSESHYSVFKAARMY  218



>ref|XP_007159059.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31053.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=494

 Score =   318 bits (816),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLD---SPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  430
            FN TA +T+ V  P+ +++ D      A NG +  +R IVLGRN+HT CLEV+EPD D+E
Sbjct  65   FNSTAFITDHVHVPLMAEEDDIAGKGEAQNGTENGERNIVLGRNIHTMCLEVSEPDIDDE  124

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  610
             TG++EAYMASVLA+Y+K+L ERTKYHLGYPYNLDFDY  LSQLQHFSINNLGDPFIESN
Sbjct  125  VTGEREAYMASVLAKYKKSLTERTKYHLGYPYNLDFDYEALSQLQHFSINNLGDPFIESN  184

Query  611  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRE  790
            YGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS E
Sbjct  185  YGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASEE  244

Query  791  SHYSVFKAARMY  826
            SHYSVFKAARMY
Sbjct  245  SHYSVFKAARMY  256



>emb|CDY59264.1| BnaC09g51700D [Brassica napus]
Length=470

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F PTA++ EP+P P   + L      NG    +RE+VLGRNVHTT L VTEP++++E TG
Sbjct  12   FVPTAVINEPLPCP--EENLKKTKVING--RGEREMVLGRNVHTTSLAVTEPESNDEFTG  67

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  68   DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  127

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGREVFPDGILYAS ESHY
Sbjct  128  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREVFPDGILYASSESHY  187

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  188  SVFKAARMY  196



>ref|XP_010479021.1| PREDICTED: serine decarboxylase [Camelina sativa]
Length=490

 Score =   318 bits (814),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 169/196 (86%), Gaps = 7/196 (4%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLD-------SPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            F+PTA+VTEP+P PV ++  +       +     GG    RE+VLGRN+HTT L VTEP+
Sbjct  24   FDPTAVVTEPLPSPVTTNGTEGEENLKKTNGVGGGGGGGDREMVLGRNIHTTSLAVTEPE  83

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
             ++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  84   VNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPF  143

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            IESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE+FPDGILY
Sbjct  144  IESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMFPDGILY  203

Query  779  ASRESHYSVFKAARMY  826
            ASRESHYSVFKAARMY
Sbjct  204  ASRESHYSVFKAARMY  219



>dbj|BAA78331.1| serine decarboxylase [Brassica napus]
Length=490

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 171/204 (84%), Gaps = 10/204 (5%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPV--------QSDKLDSPPAANGGKADKREIVLGRNVHTT  394
            ++ ++G F+PTA+  EP+P PV        + D L        G  + RE+VLGRNVHTT
Sbjct  18   DILSEG-FDPTAVAPEPLPLPVTNGTGADQEEDNLKKTKVVTNGGGE-REMVLGRNVHTT  75

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFS  574
             L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFS
Sbjct  76   SLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFS  135

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            INNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE
Sbjct  136  INNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGRE  195

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            VFPDGILYAS ESHYSVFKAARMY
Sbjct  196  VFPDGILYASSESHYSVFKAARMY  219



>gb|EYU17447.1| hypothetical protein MIMGU_mgv1a005353mg [Erythranthe guttata]
Length=487

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 159/165 (96%), Gaps = 1/165 (1%)
 Frame = +2

Query  335  ANGGKADK-REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            +NG +  K REIVLG+NVHTTCLEVTEPDAD+ESTGDK+AYMASVLARYRKTL+ERT++H
Sbjct  51   SNGEEVVKPREIVLGKNVHTTCLEVTEPDADDESTGDKDAYMASVLARYRKTLLERTQHH  110

Query  512  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  691
            LGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKD+Y
Sbjct  111  LGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDDY  170

Query  692  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            WGYITNCGTEGNLHGILVGREVFPDG+LYAS+ESHYSVFKAARMY
Sbjct  171  WGYITNCGTEGNLHGILVGREVFPDGVLYASKESHYSVFKAARMY  215



>emb|CDY30753.1| BnaC05g51500D [Brassica napus]
Length=472

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 169/196 (86%), Gaps = 13/196 (7%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            E+ +D  F+PTA+VTEP+P PV           NGG   +R +VLGRNVHTT L VTEP+
Sbjct  19   EILSDD-FDPTAVVTEPLPSPV----------TNGG--GERVMVLGRNVHTTSLAVTEPE  65

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            +++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  66   SNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPF  125

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            IESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE+ PDGILY
Sbjct  126  IESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMLPDGILY  185

Query  779  ASRESHYSVFKAARMY  826
            AS ESHYSVFKAARMY
Sbjct  186  ASTESHYSVFKAARMY  201



>gb|KFK24263.1| hypothetical protein AALP_AAs40498U000700 [Arabis alpina]
Length=489

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 171/202 (85%), Gaps = 10/202 (5%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQS------DKLDSPPAANGGKADKREIVLGRNVHTTCL  400
            E+  D  F+PTA+V EP+P P+ +      ++       NGG+   RE+VLGRNVHTT L
Sbjct  21   EILGDD-FDPTAVVAEPLPSPLTNGHVADEEEKVKKTKVNGGE---REMVLGRNVHTTSL  76

Query  401  EVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSIN  580
             VTEP+ ++E TGDKEAYMASVLARYRKTLVERTK HLGYPYNLDFDYG L QLQHFSIN
Sbjct  77   AVTEPEVNDEFTGDKEAYMASVLARYRKTLVERTKNHLGYPYNLDFDYGALGQLQHFSIN  136

Query  581  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVF  760
            NLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE+F
Sbjct  137  NLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMF  196

Query  761  PDGILYASRESHYSVFKAARMY  826
            PDGILYASRESHYSVFKAARMY
Sbjct  197  PDGILYASRESHYSVFKAARMY  218



>emb|CDY41717.1| BnaA09g15450D [Brassica napus]
Length=467

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F PTA++ EP+P P   + L      NG    +RE+VLGRNVHTT L VTEP++++E TG
Sbjct  12   FVPTAVINEPLPWP--EENLKKTKVING--RGEREMVLGRNVHTTSLAVTEPESNDEFTG  67

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  68   DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  127

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGREVFPDGILYAS ESHY
Sbjct  128  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREVFPDGILYASSESHY  187

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  188  SVFKAARMY  196



>gb|KJB16469.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=477

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 164/191 (86%), Gaps = 7/191 (4%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNES  433
            G F PTA+  EP+PP V  + ++ P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAMKVEPLPPVVPENGVEKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  613
            TGDKEA MA VLARYRK L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNY
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNY  136

Query  614  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRES  793
            GVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGTEGNLHGILVG EVFPDG+LYASRES
Sbjct  137  GVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGILVG-EVFPDGVLYASRES  195

Query  794  HYSVFKAARMY  826
            HYSVFKAARMY
Sbjct  196  HYSVFKAARMY  206



>ref|XP_010063879.1| PREDICTED: serine decarboxylase-like [Eucalyptus grandis]
Length=477

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQS----DKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADN  427
            F+P A+  EP+P  V             AA  G   KREIVLGRNVHTTCL + EPDA++
Sbjct  13   FDPAAVAPEPLPAAVAELNGNGVGGGKAAAAAGDGGKREIVLGRNVHTTCLAIEEPDAND  72

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  607
            E TGDK+AYMA VLARYRKTLVERTK HLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  73   ELTGDKDAYMAGVLARYRKTLVERTKQHLGYPYNLDFDYGALAQLQHFSINNLGDPFIES  132

Query  608  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  787
            NYGVHSRQFEVGVLDWFARLW+IEK +YWGYITNCGTEGNLHGILVGREVFPDGILYASR
Sbjct  133  NYGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGILVGREVFPDGILYASR  192

Query  788  ESHYSVFKAARMY  826
            ESHYSVFKAARMY
Sbjct  193  ESHYSVFKAARMY  205



>ref|XP_009107655.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=490

 Score =   316 bits (809),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 173/205 (84%), Gaps = 12/205 (6%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPV---------QSDKLDSPPAANGGKADKREIVLGRNVHT  391
            ++ ++G F+PTA+  EP+P PV         + +   +    NGG   +RE+VLGRNVHT
Sbjct  18   DILSEG-FDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVINGG--GEREMVLGRNVHT  74

Query  392  TCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHF  571
            T L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHF
Sbjct  75   TSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHF  134

Query  572  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGR  751
            SINNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGR
Sbjct  135  SINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGR  194

Query  752  EVFPDGILYASRESHYSVFKAARMY  826
            EVFPDGILYAS ESHYSVFKAARMY
Sbjct  195  EVFPDGILYASSESHYSVFKAARMY  219



>emb|CDY48944.1| BnaA08g04700D [Brassica napus]
Length=490

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 173/205 (84%), Gaps = 12/205 (6%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPV---------QSDKLDSPPAANGGKADKREIVLGRNVHT  391
            ++ ++G F+PTA+  EP+P PV         + +   +    NGG   +RE+VLGRNVHT
Sbjct  18   DILSEG-FDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVINGG--GEREMVLGRNVHT  74

Query  392  TCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHF  571
            T L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHF
Sbjct  75   TSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHF  134

Query  572  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGR  751
            SINNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGR
Sbjct  135  SINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGR  194

Query  752  EVFPDGILYASRESHYSVFKAARMY  826
            EVFPDGILYAS ESHYSVFKAARMY
Sbjct  195  EVFPDGILYASSESHYSVFKAARMY  219



>gb|KJB16470.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=479

 Score =   315 bits (807),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 164/192 (85%), Gaps = 7/192 (4%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNES  433
            G F PTA+  EP+PP V  + ++ P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAMKVEPLPPVVPENGVEKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  613
            TGDKEA MA VLARYRK L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNY
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNY  136

Query  614  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGR-EVFPDGILYASRE  790
            GVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGTEGNLHGILVG  EVFPDG+LYASRE
Sbjct  137  GVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGILVGLVEVFPDGVLYASRE  196

Query  791  SHYSVFKAARMY  826
            SHYSVFKAARMY
Sbjct  197  SHYSVFKAARMY  208



>gb|KCW71161.1| hypothetical protein EUGRSUZ_F04257 [Eucalyptus grandis]
Length=517

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQS----DKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADN  427
            F+P A+  EP+P  V             AA  G   KREIVLGRNVHTTCL + EPDA++
Sbjct  53   FDPAAVAPEPLPAAVAELNGNGVGGGKAAAAAGDGGKREIVLGRNVHTTCLAIEEPDAND  112

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  607
            E TGDK+AYMA VLARYRKTLVERTK HLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  113  ELTGDKDAYMAGVLARYRKTLVERTKQHLGYPYNLDFDYGALAQLQHFSINNLGDPFIES  172

Query  608  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  787
            NYGVHSRQFEVGVLDWFARLW+IEK +YWGYITNCGTEGNLHGILVGREVFPDGILYASR
Sbjct  173  NYGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGILVGREVFPDGILYASR  232

Query  788  ESHYSVFKAARMY  826
            ESHYSVFKAARMY
Sbjct  233  ESHYSVFKAARMY  245



>ref|XP_006854520.1| PREDICTED: serine decarboxylase 1 [Amborella trichopoda]
 gb|ERN15987.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
Length=488

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 167/193 (87%), Gaps = 11/193 (6%)
 Frame = +2

Query  281  TEPVPPPVQSDKLDSP------PAANGGK-----ADKREIVLGRNVHTTCLEVTEPDADN  427
             EP+P  +   K+  P        A+ G+     + KREIVLGRNVHT+CLEVTEPDAD+
Sbjct  24   VEPLPEELNPKKIKVPLHLKNEDGADNGENSTLVSGKREIVLGRNVHTSCLEVTEPDADD  83

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  607
            E TGD+EA MAS+LARYRK+L+ERT++HLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  84   EVTGDREACMASILARYRKSLIERTRHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIES  143

Query  608  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  787
            NYGVHSRQFEVGVLDWFARLW++E++EYWGYITNCGTEGNLHGILVGREVFPDGILYAS+
Sbjct  144  NYGVHSRQFEVGVLDWFARLWELERNEYWGYITNCGTEGNLHGILVGREVFPDGILYASK  203

Query  788  ESHYSVFKAARMY  826
            ESHYSVFKAARMY
Sbjct  204  ESHYSVFKAARMY  216



>gb|EPS66281.1| serine decarboxylase, partial [Genlisea aurea]
Length=426

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +2

Query  362  EIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD  541
            EIVLGRNVHT+CLEVTEPDAD+ESTGDKEAYMASVLARYRK+L+ERT++HLGYPYNLDFD
Sbjct  1    EIVLGRNVHTSCLEVTEPDADDESTGDKEAYMASVLARYRKSLIERTQHHLGYPYNLDFD  60

Query  542  YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTE  721
            YG L QLQ FSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKD+YWGYITNCGTE
Sbjct  61   YGALGQLQPFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDDYWGYITNCGTE  120

Query  722  GNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            GNLHGILVGREVFPDGILYAS+ESHYSVFKAARMY
Sbjct  121  GNLHGILVGREVFPDGILYASKESHYSVFKAARMY  155



>emb|CBI18554.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  365  IVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY  544
            IVLGRNVHTTCL VTEPDA++E TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDY
Sbjct  13   IVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDY  72

Query  545  GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEG  724
            G LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGTEG
Sbjct  73   GALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEG  132

Query  725  NLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            NLHGILVGREV PDGILYAS+E+HYSVFKAARMY
Sbjct  133  NLHGILVGREVLPDGILYASQETHYSVFKAARMY  166



>gb|KHN39188.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            FN   I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  25   FNSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            ++EAYMA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGV
Sbjct  85   EREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGV  144

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS+ESHY
Sbjct  145  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASQESHY  204

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  205  SVFKAARMY  213



>ref|NP_001242861.1| uncharacterized protein LOC100792053 [Glycine max]
 gb|ACU18387.1| unknown [Glycine max]
Length=438

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+   I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  25   FSSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            ++EAYMA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGV
Sbjct  85   EREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGV  144

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS+ESHY
Sbjct  145  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASQESHY  204

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  205  SVFKAARMY  213



>ref|XP_009113392.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=477

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 164/197 (83%), Gaps = 10/197 (5%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPV--------QSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEP  415
            F PTA+  EP+P PV        + + L      NG    +RE+VLGRNVHTT L VTEP
Sbjct  12   FVPTAVFNEPLPWPVINGNKADHEGENLKKTKVMNG--RGEREMVLGRNVHTTSLAVTEP  69

Query  416  DADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDP  595
            ++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQ FSINNLGDP
Sbjct  70   ESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQQFSINNLGDP  129

Query  596  FIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGIL  775
             IESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGREVFPDGIL
Sbjct  130  VIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREVFPDGIL  189

Query  776  YASRESHYSVFKAARMY  826
            YAS ESHYSVFKAARMY
Sbjct  190  YASSESHYSVFKAARMY  206



>ref|XP_002266398.1| PREDICTED: serine decarboxylase [Vitis vinifera]
Length=482

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  365  IVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY  544
            IVLGRNVHTTCL VTEPDA++E TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDY
Sbjct  57   IVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDY  116

Query  545  GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEG  724
            G LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGTEG
Sbjct  117  GALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEG  176

Query  725  NLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            NLHGILVGREV PDGILYAS+E+HYSVFKAARMY
Sbjct  177  NLHGILVGREVLPDGILYASQETHYSVFKAARMY  210



>emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera]
Length=473

 Score =   309 bits (792),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  365  IVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY  544
            IVLGRNVHTTCL VTEPDA++E TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDY
Sbjct  48   IVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDY  107

Query  545  GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEG  724
            G LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGTEG
Sbjct  108  GALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEG  167

Query  725  NLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            NLHGILVGREV PDGILYAS+E+HYSVFKAARMY
Sbjct  168  NLHGILVGREVLPDGILYASQETHYSVFKAARMY  201



>ref|XP_010241734.1| PREDICTED: serine decarboxylase 1-like [Nelumbo nucifera]
Length=486

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F  T I+    P  V++    S  A  G +  +REIVLGRNVH   L VTEPD D E TG
Sbjct  25   FGGTVIIPNSFPTMVETRASISGEARRGEEKQRREIVLGRNVHKMSLPVTEPDVDEEMTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            +KEAYMAS+LA+YRK+LVERT++HLGYPYNLDFDYG L+QLQHFSINNLGDPFIES YGV
Sbjct  85   EKEAYMASILAKYRKSLVERTEHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESKYGV  144

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGTEGNLHGILVGREV PDGILYASRESHY
Sbjct  145  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVLPDGILYASRESHY  204

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  205  SVFKAARMY  213



>ref|XP_007148444.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
 gb|ESW20438.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
Length=483

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+ T++V +PVPP V  +  +        + +KR IVLGRN+HT  LEVTEPDAD++ TG
Sbjct  25   FDATSLVMDPVPPAVVDNGNEEVQVYK--EKEKRLIVLGRNIHTMSLEVTEPDADDDITG  82

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            D+EA++ASVLARY++ L ERTK+HLGYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGV
Sbjct  83   DREAHIASVLARYKRALTERTKHHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGV  142

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREVFP+GILYASRESHY
Sbjct  143  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVFPNGILYASRESHY  202

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  203  SVFKAARMY  211



>ref|XP_006584560.1| PREDICTED: uncharacterized protein LOC100792053 isoform X1 [Glycine 
max]
 ref|XP_006584561.1| PREDICTED: uncharacterized protein LOC100792053 isoform X2 [Glycine 
max]
 ref|XP_006584562.1| PREDICTED: uncharacterized protein LOC100792053 isoform X3 [Glycine 
max]
Length=485

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+   I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  25   FSSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            ++EAYMA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGV
Sbjct  85   EREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGV  144

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS+ESHY
Sbjct  145  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASQESHY  204

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  205  SVFKAARMY  213



>gb|KJB59410.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=476

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 158/172 (92%), Gaps = 7/172 (4%)
 Frame = +2

Query  332  AANG-----GKADK--REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  490
            AANG      K DK  REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKKSREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  491  VERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  670
            +ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW
Sbjct  95   MERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  154

Query  671  DIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            +IEK++YWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  155  EIEKNDYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  206



>ref|XP_006584563.1| PREDICTED: uncharacterized protein LOC100792053 isoform X4 [Glycine 
max]
 ref|XP_006584564.1| PREDICTED: uncharacterized protein LOC100792053 isoform X5 [Glycine 
max]
Length=468

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+   I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  8    FSSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  67

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            ++EAYMA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGV
Sbjct  68   EREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGV  127

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS+ESHY
Sbjct  128  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASQESHY  187

Query  800  SVFKAARMY  826
            SVFKAARMY
Sbjct  188  SVFKAARMY  196



>ref|XP_006584565.1| PREDICTED: uncharacterized protein LOC100792053 isoform X6 [Glycine 
max]
Length=458

 Score =   306 bits (785),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  275  IVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAY  454
            I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG++EAY
Sbjct  3    IMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTGEREAY  62

Query  455  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  634
            MA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGVHSRQF
Sbjct  63   MAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGVHSRQF  122

Query  635  EVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKA  814
            EVGVLDWFARLW++EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS+ESHYSVFKA
Sbjct  123  EVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASQESHYSVFKA  182

Query  815  ARMY  826
            ARMY
Sbjct  183  ARMY  186



>gb|KHG04394.1| Histidine decarboxylase [Gossypium arboreum]
Length=476

 Score =   307 bits (786),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 157/172 (91%), Gaps = 7/172 (4%)
 Frame = +2

Query  332  AANGGKA-------DKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  490
            AANG  A       + REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKESREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  491  VERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  670
            +ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW
Sbjct  95   MERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  154

Query  671  DIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            +IEK+++WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  155  EIEKNDFWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  206



>ref|XP_003575093.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=470

 Score =   306 bits (785),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  535
            KRE+VLGRNVH TC EV EPDAD+E TG++EA MASVLA YR++LVERTK+HLGYPYNLD
Sbjct  42   KREVVLGRNVHMTCFEVKEPDADDEETGEREATMASVLALYRRSLVERTKHHLGYPYNLD  101

Query  536  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  715
            FDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCG
Sbjct  102  FDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCG  161

Query  716  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  162  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  198



>ref|XP_006307198.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
 gb|EOA40096.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
Length=542

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 164/193 (85%), Gaps = 7/193 (4%)
 Frame = +2

Query  269  TAIVTEPVPPPVQS-----DKLDSP--PAANGGKADKREIVLGRNVHTTCLEVTEPDADN  427
            + ++ EP+P PV +     + L  P      GG    RE+VLGRN+HTT L VTEP+ ++
Sbjct  79   STVIAEPLPSPVTNGTGDEENLKKPNGAGGRGGGGGDREMVLGRNIHTTSLAVTEPEVND  138

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  607
            E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIES
Sbjct  139  EFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIES  198

Query  608  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  787
            NYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE+FPDGILYASR
Sbjct  199  NYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMFPDGILYASR  258

Query  788  ESHYSVFKAARMY  826
            ESHYSVFKAARMY
Sbjct  259  ESHYSVFKAARMY  271



>ref|XP_002893962.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70221.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 160/182 (88%), Gaps = 10/182 (5%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+PTA+VTEP+P         SP   NGG  + RE+VLGRN+HTT L VTEP+ ++E TG
Sbjct  27   FDPTAVVTEPLP---------SPTELNGGGGE-REMVLGRNIHTTSLAVTEPEVNDEFTG  76

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  619
            DKEAYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  77   DKEAYMASVLARYRKTLVERTKFHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  136

Query  620  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHY  799
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGTEGNLHGILVGRE+FPDGILYASRESHY
Sbjct  137  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMFPDGILYASRESHY  196

Query  800  SV  805
            SV
Sbjct  197  SV  198



>ref|XP_009406072.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 162/190 (85%), Gaps = 8/190 (4%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLD-SPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  436
            F+ T IV EPVP       LD        G A  REIVLGRNVHT C  + EP+ D+E T
Sbjct  25   FDTTDIV-EPVPT------LDLEGVGGEEGSAKTREIVLGRNVHTMCFTIKEPEVDDEVT  77

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  616
            G++EAYMASVLARYR++L+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYG
Sbjct  78   GEREAYMASVLARYRRSLIERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYG  137

Query  617  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESH  796
            VHSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREVFPDGILYAS+ESH
Sbjct  138  VHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVFPDGILYASKESH  197

Query  797  YSVFKAARMY  826
            YSVFKAARMY
Sbjct  198  YSVFKAARMY  207



>ref|XP_008645766.1| PREDICTED: histidine decarboxylase-like [Zea mays]
 gb|AFW71722.1| hypothetical protein ZEAMMB73_965103 [Zea mays]
Length=494

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 4/165 (2%)
 Frame = +2

Query  332  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            AANG    +REIV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERTK+H
Sbjct  63   AANG----RREIVMGRNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHH  118

Query  512  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  691
            LGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEY
Sbjct  119  LGYPYNLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEY  178

Query  692  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  179  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  223



>ref|XP_010931002.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
 ref|XP_010931003.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
Length=475

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 159/188 (85%), Gaps = 6/188 (3%)
 Frame = +2

Query  281  TEPVPPPVQSDKLDSPP--AANG----GKADKREIVLGRNVHTTCLEVTEPDADNESTGD  442
             EP+P      ++  P   A NG    G    REIVLGRNVH  C  + EP+AD+E TG+
Sbjct  16   VEPLPEEFDPKEISGPADSAPNGILGSGDGKNREIVLGRNVHKMCFAINEPEADDEVTGE  75

Query  443  KEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVH  622
            +EAYMASVLARYRK+LVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVH
Sbjct  76   REAYMASVLARYRKSLVERTKHHLGYPYNLDFDYGALNQLQHFSINNLGDPFIESNYGVH  135

Query  623  SRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYS  802
            SRQFEVGVLDWFARLW++E+ EYWGYITNCGTEGNLHG+LVGREVFPDG+LYASRESHYS
Sbjct  136  SRQFEVGVLDWFARLWELERSEYWGYITNCGTEGNLHGLLVGREVFPDGMLYASRESHYS  195

Query  803  VFKAARMY  826
            VFKAARMY
Sbjct  196  VFKAARMY  203



>ref|XP_008781392.1| PREDICTED: serine decarboxylase 1 [Phoenix dactylifera]
Length=475

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 158/186 (85%), Gaps = 2/186 (1%)
 Frame = +2

Query  275  IVTEPVPPPVQSDKLDSPP--AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKE  448
            ++ E   P   S  +DS P     G     REIVLGRNVH  C  + EP+AD+E TG++E
Sbjct  18   LLPEEFDPKEISAPVDSQPNGVLEGRDGKSREIVLGRNVHKLCFAINEPEADDEVTGERE  77

Query  449  AYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  628
            AYMASVLARYRK+L+ERTK+HLGYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGVHSR
Sbjct  78   AYMASVLARYRKSLIERTKHHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSR  137

Query  629  QFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF  808
            QFEVGVLDWFARLW++E++EYWGYITNCGTEGNLHG LVGREVFPDGILYASRESHYSVF
Sbjct  138  QFEVGVLDWFARLWELERNEYWGYITNCGTEGNLHGFLVGREVFPDGILYASRESHYSVF  197

Query  809  KAARMY  826
            KAARMY
Sbjct  198  KAARMY  203



>ref|XP_006472964.1| PREDICTED: histidine decarboxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006472965.1| PREDICTED: histidine decarboxylase-like isoform X2 [Citrus sinensis]
Length=476

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  347  KADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPY  526
            K  ++EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYPY
Sbjct  45   KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPY  104

Query  527  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYIT  706
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++E +EYWGYIT
Sbjct  105  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYIT  164

Query  707  NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  165  NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  204



>ref|XP_006434436.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47676.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=476

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  347  KADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPY  526
            K  ++EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYPY
Sbjct  45   KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPY  104

Query  527  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYIT  706
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++E +EYWGYIT
Sbjct  105  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYIT  164

Query  707  NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  165  NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  204



>gb|KDO83688.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
 gb|KDO83689.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
Length=476

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  347  KADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPY  526
            K  ++EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYPY
Sbjct  45   KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPY  104

Query  527  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYIT  706
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++E +EYWGYIT
Sbjct  105  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYIT  164

Query  707  NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  165  NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  204



>ref|XP_006434437.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47677.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=544

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  347  KADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPY  526
            K  ++EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYPY
Sbjct  113  KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPY  172

Query  527  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYIT  706
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++E +EYWGYIT
Sbjct  173  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYIT  232

Query  707  NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  233  NCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  272



>ref|XP_004952686.1| PREDICTED: histidine decarboxylase-like [Setaria italica]
Length=489

 Score =   305 bits (781),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 154/168 (92%), Gaps = 6/168 (4%)
 Frame = +2

Query  341  GGKAD------KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERT  502
            GGKA+      +REIV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERT
Sbjct  51   GGKAEGPTSNGRREIVMGRNVHTSCFAVKEPDADDEVTGEREATMASVLALYRRSLVERT  110

Query  503  KYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEK  682
            K+HLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK
Sbjct  111  KHHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEK  170

Query  683  DEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            DEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  171  DEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  218



>ref|XP_003579728.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=469

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDF  538
            REIV+GRNVH +C  V EPDAD+E TG++EA MA VLARYR+ L+ERTK+HLGYPYNLDF
Sbjct  42   REIVMGRNVHASCFAVKEPDADDEVTGEREATMAGVLARYRRCLIERTKHHLGYPYNLDF  101

Query  539  DYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGT  718
            DYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWD+EKDEYWGYITNCGT
Sbjct  102  DYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDLEKDEYWGYITNCGT  161

Query  719  EGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            EGNLHGILVGREVFPDG+LYASRESHYSVFKAARMY
Sbjct  162  EGNLHGILVGREVFPDGVLYASRESHYSVFKAARMY  197



>ref|XP_008218831.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=457

 Score =   301 bits (772),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  535
            KREI LGRNVHTTC EV+EPD D++STGD+EAYMASVLARYRK+L+ERTK+HLGYPYNLD
Sbjct  29   KREISLGRNVHTTCHEVSEPDDDDDSTGDREAYMASVLARYRKSLIERTKHHLGYPYNLD  88

Query  536  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  715
            FDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCG
Sbjct  89   FDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCG  148

Query  716  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TEGNLHGILVGREVFPDGILYAS++SHYSVFKAARMY
Sbjct  149  TEGNLHGILVGREVFPDGILYASKDSHYSVFKAARMY  185



>gb|KJB59411.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=475

 Score =   302 bits (773),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 157/172 (91%), Gaps = 8/172 (5%)
 Frame = +2

Query  332  AANG-----GKADK--REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  490
            AANG      K DK  REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKKSREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  491  VERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  670
            +ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW
Sbjct  95   MERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  154

Query  671  DIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            +IEK++YWGYITNCGTEGNLHGILVG EVFPDGILYASRESHYSVFKAARMY
Sbjct  155  EIEKNDYWGYITNCGTEGNLHGILVG-EVFPDGILYASRESHYSVFKAARMY  205



>ref|XP_009416900.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDF  538
            REIVLGRNVHT C  + EP+AD+E TG++EAYMASVLARYR++L++RTK+HLGYPYNLDF
Sbjct  52   REIVLGRNVHTMCFAIKEPEADDEVTGEREAYMASVLARYRRSLIDRTKHHLGYPYNLDF  111

Query  539  DYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGT  718
            DYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGT
Sbjct  112  DYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGT  171

Query  719  EGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            EGNLHGILVGREVFPDG+LYASRESHYS+FKAARMY
Sbjct  172  EGNLHGILVGREVFPDGVLYASRESHYSIFKAARMY  207



>ref|XP_002976233.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
 gb|EFJ22493.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
Length=472

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  ANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHL  514
            A G    +REIVLGRN+H  C  +TEP+ D+E TGDK+ YMA VLARYRKTLVERTKYHL
Sbjct  34   AIGKLRGEREIVLGRNLHDQCFSITEPEHDDEETGDKDVYMAGVLARYRKTLVERTKYHL  93

Query  515  GYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYW  694
            GYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK+EYW
Sbjct  94   GYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYW  153

Query  695  GYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            GYITNCGTEGNLHG+LVGREVFPDGILYAS++SHYSVFKA RMY
Sbjct  154  GYITNCGTEGNLHGLLVGREVFPDGILYASKDSHYSVFKAGRMY  197



>ref|XP_008678685.1| PREDICTED: histidine decarboxylase-like [Zea mays]
Length=489

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 152/165 (92%), Gaps = 4/165 (2%)
 Frame = +2

Query  332  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            AANG    KREIV+GRNVHT+C  V EPDAD+E TG++EA MAS+LA YR++LVERTK+H
Sbjct  58   AANG----KREIVMGRNVHTSCFAVKEPDADDEETGEREATMASILALYRRSLVERTKHH  113

Query  512  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  691
            LGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA LW++EKDEY
Sbjct  114  LGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFASLWELEKDEY  173

Query  692  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            WGYITNCGTEGNLHGILVGREVFP GILYASRESHYSVFKAARMY
Sbjct  174  WGYITNCGTEGNLHGILVGREVFPKGILYASRESHYSVFKAARMY  218



>ref|XP_002987141.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
 gb|EFJ11717.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
Length=472

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 154/184 (84%), Gaps = 5/184 (3%)
 Frame = +2

Query  290  VPPPVQSDKLDSPPAANGGKA-----DKREIVLGRNVHTTCLEVTEPDADNESTGDKEAY  454
            +P  +  D     P   G  A      +REIVLGRN+H  C  +TEP+ D+E TG+K+ Y
Sbjct  14   LPEEISIDSCGIEPDLEGADAIGKLRGEREIVLGRNLHDQCFSITEPEHDDEETGEKDVY  73

Query  455  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  634
            MA VLARYRKTLVERTKYHLGYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQF
Sbjct  74   MAGVLARYRKTLVERTKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQF  133

Query  635  EVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKA  814
            EVGVLDWFARLW++EK+EYWGYITNCGTEGNLHG+LVGREVFPDGILYAS++SHYSVFKA
Sbjct  134  EVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGLLVGREVFPDGILYASKDSHYSVFKA  193

Query  815  ARMY  826
             RMY
Sbjct  194  GRMY  197



>ref|XP_002452231.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
 gb|EES05207.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
Length=494

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  535
            +R IV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERTK+HLGYPYNLD
Sbjct  67   RRVIVMGRNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHHLGYPYNLD  126

Query  536  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  715
            FDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCG
Sbjct  127  FDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCG  186

Query  716  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  187  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  223



>ref|XP_006648711.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=467

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  535
            +REIVLGRNVHT    V EPDAD+E TG++EA MASVLA YRK+LVERTK+HLGYPYNLD
Sbjct  38   RREIVLGRNVHTASFAVKEPDADDEETGEREAAMASVLALYRKSLVERTKHHLGYPYNLD  97

Query  536  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  715
            FDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCG
Sbjct  98   FDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCG  157

Query  716  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TEGNLHGILVGREVFPDG+LYASRESHYSVFKAARMY
Sbjct  158  TEGNLHGILVGREVFPDGVLYASRESHYSVFKAARMY  194



>ref|XP_007227607.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
 gb|EMJ28806.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
Length=457

 Score =   298 bits (764),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  535
            KREI LGRNVHTTC EV+EPD D++STGD+EAYMASVLARYRK+L+ERTK+HLGYPYNLD
Sbjct  29   KREISLGRNVHTTCHEVSEPDDDDDSTGDREAYMASVLARYRKSLIERTKHHLGYPYNLD  88

Query  536  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  715
            FDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA LW++EK+EYWGYITNCG
Sbjct  89   FDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFALLWELEKNEYWGYITNCG  148

Query  716  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TEGNLHGILVGREVFPDGILYAS++SHYSVFKAARMY
Sbjct  149  TEGNLHGILVGREVFPDGILYASKDSHYSVFKAARMY  185



>sp|Q6ESZ9.1|SDC1_ORYSJ RecName: Full=Serine decarboxylase 1 [Oryza sativa Japonica Group]
 dbj|BAD28070.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD28221.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 gb|EAZ23358.1| hypothetical protein OsJ_07054 [Oryza sativa Japonica Group]
Length=482

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 155/186 (83%), Gaps = 8/186 (4%)
 Frame = +2

Query  269  TAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKE  448
             A+  E  P P + +   SP         +REIVLGRNVHT    V EPDAD+E TG++E
Sbjct  33   VAMEVESPPRPAEEEGEGSPT--------RREIVLGRNVHTASFAVKEPDADDEETGERE  84

Query  449  AYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  628
            A MASVLA YR+ LVERTK+HLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSR
Sbjct  85   AAMASVLALYRRNLVERTKHHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSR  144

Query  629  QFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF  808
            QFEVGVLDWFAR+W++EK+EYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF
Sbjct  145  QFEVGVLDWFARIWELEKNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF  204

Query  809  KAARMY  826
            KAARMY
Sbjct  205  KAARMY  210



>gb|EAY86197.1| hypothetical protein OsI_07573 [Oryza sativa Indica Group]
Length=484

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  344  GKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            G   +REIVLGRNVHT    V EPDAD+E TG++EA MASVLA YR+ LVERTK+HLGYP
Sbjct  52   GSPTRREIVLGRNVHTASFAVKEPDADDEETGEREAAMASVLALYRRNLVERTKHHLGYP  111

Query  524  YNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYI  703
            YNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFAR+W++EK+EYWGYI
Sbjct  112  YNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARIWELEKNEYWGYI  171

Query  704  TNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  172  TNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  212



>ref|XP_009420591.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score =   292 bits (748),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  344  GKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            G  + R IVLGRN+HT    + EP++D+E TG++E YMASVLA+YRK+LVERTK+HLGYP
Sbjct  41   GAGEDRAIVLGRNMHTVSFAIKEPESDDELTGEREGYMASVLAKYRKSLVERTKHHLGYP  100

Query  524  YNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYI  703
            YNLD DYG LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK EYWGYI
Sbjct  101  YNLDLDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKHEYWGYI  160

Query  704  TNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TNCGTEGNLHGILVGRE FPDGILYASRESHYSVFKAARMY
Sbjct  161  TNCGTEGNLHGILVGRESFPDGILYASRESHYSVFKAARMY  201



>ref|XP_001761266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73988.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +2

Query  383  VHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQL  562
            +H +  ++TEPD D+E TG+K+AYMASVLARYRK+L E++KYHLGYPYNLDFDYG LSQL
Sbjct  1    MHGSSFKITEPDHDDEVTGEKDAYMASVLARYRKSLTEKSKYHLGYPYNLDFDYGALSQL  60

Query  563  QHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGIL  742
            QHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCGTEGNLHGIL
Sbjct  61   QHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  120

Query  743  VGREVFPDGILYASRESHYSVFKAARMY  826
            VGREV PDGILYASR+SHYSVFKAARMY
Sbjct  121  VGREVLPDGILYASRDSHYSVFKAARMY  148



>gb|KJB59412.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=463

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 146/172 (85%), Gaps = 20/172 (12%)
 Frame = +2

Query  332  AANG-----GKADK--REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  490
            AANG      K DK  REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKKSREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  491  VERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  670
            +ERTK+HL             +QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW
Sbjct  95   MERTKHHL-------------AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  141

Query  671  DIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            +IEK++YWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY
Sbjct  142  EIEKNDYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  193



>ref|XP_001754291.1| predicted protein [Physcomitrella patens]
 gb|EDQ80741.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +2

Query  422  DNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFI  601
            D++ TGD++AYMA +LARYRKTLVE+TK+HLGYPYNLDFDYG LSQLQHFSINNLGDPFI
Sbjct  2    DDDVTGDRDAYMAGILARYRKTLVEKTKFHLGYPYNLDFDYGALSQLQHFSINNLGDPFI  61

Query  602  ESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYA  781
            ESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGTEGNLHGILVGREV PDGILYA
Sbjct  62   ESNYGVHSRQFEVGVLDWFARLWELEKEEYWGYITNCGTEGNLHGILVGREVLPDGILYA  121

Query  782  SRESHYSVFKAARMY  826
            SR+SHYSVFKAARMY
Sbjct  122  SRDSHYSVFKAARMY  136



>gb|EMS65243.1| Histidine decarboxylase [Triticum urartu]
Length=357

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  634
            MA VLARYR++LVERTK+HLGYPYNLDF+YG LSQLQHFSINNLGDPFIESNYGVHSRQF
Sbjct  1    MAGVLARYRRSLVERTKHHLGYPYNLDFEYGALSQLQHFSINNLGDPFIESNYGVHSRQF  60

Query  635  EVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKA  814
            EVGVLDWFARLWD+EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASR+SHYSVFKA
Sbjct  61   EVGVLDWFARLWDLEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRDSHYSVFKA  120

Query  815  ARMY  826
            ARMY
Sbjct  121  ARMY  124



>emb|CDP11372.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  634
            MASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQF
Sbjct  1    MASVLARYRKTLIERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQF  60

Query  635  EVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKA  814
            EVGVLDWFARLW+IEK EYWGYITNCGTEGNLHGILVGREV PDGILYASRESHYSVFKA
Sbjct  61   EVGVLDWFARLWEIEKSEYWGYITNCGTEGNLHGILVGREVLPDGILYASRESHYSVFKA  120

Query  815  ARMY  826
            ARMY
Sbjct  121  ARMY  124



>ref|XP_010675834.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +2

Query  350  ADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYN  529
            A ++EIVLGR +  +CL++ E DA+NE++G  +AYM +VLARY    +ERTK+ +GYP N
Sbjct  18   ACRKEIVLGRQIQPSCLDIREFDANNEASGATDAYMTAVLARYTHKFLERTKHFIGYPIN  77

Query  530  LDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITN  709
            LDFDY  L QL  FSINN+GDPFIESNYGVHS+ FEVG L+WFARLW+IEK+EYWGYITN
Sbjct  78   LDFDYRALDQLLQFSINNVGDPFIESNYGVHSKDFEVGTLNWFARLWEIEKEEYWGYITN  137

Query  710  CGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
             GTEGNLHGILVGRE+FPDGILYAS+ESHYSVFKAA MY
Sbjct  138  GGTEGNLHGILVGRELFPDGILYASKESHYSVFKAAHMY  176



>ref|XP_010676037.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  535
            ++EIVLGR +  +CL++ E DA+NES+   +AYM +VLARY    +ERTK+ +GYP NLD
Sbjct  20   RKEIVLGRQIQPSCLDIRELDANNESSEATDAYMTAVLARYTHKFLERTKHVIGYPINLD  79

Query  536  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  715
            FDY  L QL  FSINN+GDPFIESNYGVHS+ FEVG L+WFARLW+IEK+EYWGYITN G
Sbjct  80   FDYRALDQLLQFSINNVGDPFIESNYGVHSKDFEVGTLNWFARLWEIEKEEYWGYITNGG  139

Query  716  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TEGNLHGILVGREVFPDGILYAS+ESHYSVFKAA MY
Sbjct  140  TEGNLHGILVGREVFPDGILYASKESHYSVFKAAHMY  176



>ref|XP_003566804.1| PREDICTED: serine decarboxylase 1-like [Brachypodium distachyon]
Length=484

 Score =   232 bits (591),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINN  583
            V EP +D E+  ++ A +A++LA +   L ERT +HLGYPYNLDFD+  L+Q Q FSINN
Sbjct  64   VLEPPSDEEAAAERRAQVAALLASFGHHLRERTAHHLGYPYNLDFDFSPLTQFQSFSINN  123

Query  584  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFP  763
            LGDPFIESNYGVHSRQFEV VLDWFARLW++++DEYWGYITNCGTEGNLHG+LVGRE+FP
Sbjct  124  LGDPFIESNYGVHSRQFEVAVLDWFARLWELKQDEYWGYITNCGTEGNLHGLLVGRELFP  183

Query  764  DGILYASRESHYSVFKAARMY  826
            DGI+YAS ESHYSVFKAARMY
Sbjct  184  DGIMYASHESHYSVFKAARMY  204



>ref|XP_001689659.1| serine decarboxylase [Chlamydomonas reinhardtii]
 gb|EDP09397.1| serine decarboxylase, partial [Chlamydomonas reinhardtii]
Length=375

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  613
            T ++EA +A ++  Y K L ERT +H+GYPYNLDFDYG L  L  +SINNLGDPFIESNY
Sbjct  1    TQEREAQIAEMIGSYMKKLAERTHHHMGYPYNLDFDYGLLEGLTKYSINNLGDPFIESNY  60

Query  614  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRES  793
            GVHSR+FEVGVL+WFARLW+I+++EYWGYIT CGTEGNLHGILVGRE FPDG++YAS ES
Sbjct  61   GVHSREFEVGVLNWFARLWEIDEEEYWGYITTCGTEGNLHGILVGRENFPDGVMYASSES  120

Query  794  HYSVFKAARMY  826
            HYSVFKAARMY
Sbjct  121  HYSVFKAARMY  131



>gb|EMT14427.1| Histidine decarboxylase [Aegilops tauschii]
Length=488

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  634
            +A++LA + + L ERT +HLGYPYNLDFD+  ++Q Q+FSINNLGDPFIESNYGVHSRQF
Sbjct  88   VAALLAGFARHLQERTTHHLGYPYNLDFDFSVMAQFQNFSINNLGDPFIESNYGVHSRQF  147

Query  635  EVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKA  814
            EV VLDWFARLWD+++DEYWGYITNCGTEGNLHG+LVGRE+FPDGI+YAS ESHYSVFKA
Sbjct  148  EVAVLDWFARLWDLQQDEYWGYITNCGTEGNLHGLLVGRELFPDGIIYASCESHYSVFKA  207

Query  815  ARMY  826
            ARMY
Sbjct  208  ARMY  211



>gb|AFW62562.1| hypothetical protein ZEAMMB73_033583 [Zea mays]
Length=406

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  506  YHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKD  685
            +H GYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA LW++EKD
Sbjct  29   FHEGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFASLWELEKD  88

Query  686  EYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            EYWGYITNCGTEGNLHGILVGREVFP GILYASRESHYSVFKAARMY
Sbjct  89   EYWGYITNCGTEGNLHGILVGREVFPKGILYASRESHYSVFKAARMY  135



>ref|XP_011401256.1| Histidine decarboxylase [Auxenochlorella protothecoides]
 gb|KFM28243.1| Histidine decarboxylase [Auxenochlorella protothecoides]
Length=479

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  EAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHS  625
            EA +  V+  YR+ L +RT +H+GYPYNLDFDYG L  LQ F INNLGDPFIESNYGVHS
Sbjct  87   EARVRQVIEDYRQKLEDRTDHHMGYPYNLDFDYGPLEGLQKFCINNLGDPFIESNYGVHS  146

Query  626  RQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSV  805
            R+FE+GVL WFARLW+IE+DE+WGY+TNCGTEGNLHGILVGRE  PDG+LY+S ESHYSV
Sbjct  147  REFEIGVLQWFARLWEIEEDEFWGYVTNCGTEGNLHGILVGRETLPDGVLYSSAESHYSV  206

Query  806  FKAARMY  826
            FKAARMY
Sbjct  207  FKAARMY  213



>ref|XP_006851377.2| PREDICTED: serine decarboxylase, partial [Amborella trichopoda]
Length=178

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 130/169 (77%), Gaps = 10/169 (6%)
 Frame = +2

Query  257  RFNPTAIVTEPVPPPVQSDKLDSPPAANGGK-----ADKREIVLGRNVHTTCLEVTEPDA  421
            +FNP   +      P+  +  D+    + G+     + +REIVL  NVH +CLEVT+PDA
Sbjct  15   KFNPKETMG-----PLNLENGDALETLDNGENRSFDSGEREIVLESNVHLSCLEVTDPDA  69

Query  422  DNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFI  601
            D+E T +K+AYMAS+LARY+K L+ER K+ LGYP N+D DYG L+QLQ+F++NN+GDPFI
Sbjct  70   DDEVTREKDAYMASILARYQKLLIERAKHLLGYPCNMDLDYGALTQLQNFAMNNVGDPFI  129

Query  602  ESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVG  748
            ESNYGV SR FE+GVLDWFARLW++EK++YWGYIT+ GTEGN HGIL+G
Sbjct  130  ESNYGVQSRPFEIGVLDWFARLWELEKNKYWGYITSGGTEGNFHGILLG  178



>gb|KIZ00141.1| histidine decarboxylase [Monoraphidium neglectum]
Length=481

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +2

Query  449  AYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  628
            A +   + +Y K L ERTK+H+GYPYNLDFD+G L  L  +SINNLGDPFIESNYGVHSR
Sbjct  83   AAINETIQKYEKKLAERTKHHMGYPYNLDFDFGALEGLTRYSINNLGDPFIESNYGVHSR  142

Query  629  QFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF  808
            +FEVGVL+WFARLW+I+++EYWGYITNCGTEGNLHGILVGRE  PDGILYASRE+HYS+F
Sbjct  143  EFEVGVLNWFARLWEIDEEEYWGYITNCGTEGNLHGILVGRENLPDGILYASRETHYSIF  202

Query  809  KAARMY  826
            KAARMY
Sbjct  203  KAARMY  208



>ref|XP_005845371.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
 gb|EFN53269.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
Length=468

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEP-DADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  535
            +  ++  N+ T  L V EP + D E   + EA +  V+  Y++ L  RT +H+GYPYNLD
Sbjct  56   KSTIITHNI-TPALPVLEPGELDKE---ELEARINKVIDDYKEKLQLRTDHHMGYPYNLD  111

Query  536  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  715
            FDYG L  LQ + INNLGDPFIESNYGVHSR+FE+GVL WFARLW+IE D++WGYITNCG
Sbjct  112  FDYGPLEGLQKYCINNLGDPFIESNYGVHSREFEIGVLQWFARLWEIEVDDFWGYITNCG  171

Query  716  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TEGNLHGILVGRE  PDGILYASRE+HYS+FKA RMY
Sbjct  172  TEGNLHGILVGREALPDGILYASRETHYSIFKAGRMY  208



>ref|XP_002953989.1| serine decarboxylase [Volvox carteri f. nagariensis]
 gb|EFJ45018.1| serine decarboxylase [Volvox carteri f. nagariensis]
Length=473

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = +2

Query  389  TTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQH  568
            +T L V EP  +  +  ++EA +A ++  Y K L ERT +H+GYPYNLDFDYG L  L  
Sbjct  61   STALPVMEPHPEM-TEEEREARIAEMIGNYMKKLAERTHHHMGYPYNLDFDYGLLEGLTK  119

Query  569  FSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVG  748
            +SINNLGDPFIESNYGVHSR+FEVGVL+WFARLW+I+++EYWGYIT CGTEGNLHGILVG
Sbjct  120  YSINNLGDPFIESNYGVHSREFEVGVLNWFARLWEIDEEEYWGYITTCGTEGNLHGILVG  179

Query  749  REVFPDGILYASRESHYSVFKAARMY  826
            RE FPDGI+YAS ESHYSVFKAARMY
Sbjct  180  RENFPDGIMYASAESHYSVFKAARMY  205



>ref|XP_002456988.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
 gb|EES02108.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
Length=480

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ-LQHFSIN  580
            V EP AD E+  +++A +A +LA +R+ L +R+ +HLGYPYNLDFD+  L+  LQ   IN
Sbjct  58   VQEPPADEEALAERQAEVARLLAGFRRHLEDRSAHHLGYPYNLDFDFASLAPFLQGLCIN  117

Query  581  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVF  760
            NLGDPF+ESNYGVHSR  EV VLDWFARLWD+   +YWGY+T+CGTEGNLHG+LVGREVF
Sbjct  118  NLGDPFVESNYGVHSRPLEVAVLDWFARLWDLGPGDYWGYVTSCGTEGNLHGLLVGREVF  177

Query  761  PDGILYASRESHYSVFKAARMY  826
            PDG++YAS +SHYSVF+AARMY
Sbjct  178  PDGVMYASADSHYSVFRAARMY  199



>gb|KDD76585.1| hypothetical protein H632_c172p0 [Helicosporidium sp. ATCC 50920]
Length=483

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  EAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHS  625
            E+ ++ V+  Y+  L  RT +H+GYPYNLDFDYG L  LQ F INNLGDPFIESNYGVHS
Sbjct  87   ESRLSEVIQSYKNKLEHRTHHHMGYPYNLDFDYGPLECLQRFCINNLGDPFIESNYGVHS  146

Query  626  RQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSV  805
            R+FE+GVL WFA LW+IE ++ WGY+TNCGTEGNLHGIL+GRE  P G+LY+S  SHYSV
Sbjct  147  REFEIGVLHWFASLWEIEAEDMWGYVTNCGTEGNLHGILLGRETLPGGVLYSSAASHYSV  206

Query  806  FKAARMY  826
            FKAARMY
Sbjct  207  FKAARMY  213



>ref|XP_006663420.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=446

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  389  TTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQH  568
            T   ++ EP  D ++   +   + ++L  +RK L ER+ YHLGYP+NL+ D G + Q Q+
Sbjct  23   TDTYDIDEPPKDEQAATQRRLRIDNLLVNFRKQLQERSAYHLGYPFNLELDVGPVIQFQN  82

Query  569  FSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVG  748
            F +NN+GDPF+ESNYG+HSR+FEV VLDWFA  W++ KD+ WGY+T+ GTEGNLHG+LVG
Sbjct  83   FHVNNIGDPFMESNYGIHSRKFEVAVLDWFANFWELPKDQSWGYVTSGGTEGNLHGLLVG  142

Query  749  REVFPDGILYASRESHYSVFKAARMY  826
            RE+FPDGI+YAS++SHYSVFKAA+MY
Sbjct  143  RELFPDGIIYASKDSHYSVFKAAKMY  168



>ref|XP_005646136.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
 gb|EIE21592.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
Length=377

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  518  YPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWG  697
            YPYNLDFD+  L  LQ FSINNLGDPFIESNYGVHSR+FE+GVL WFARLW+I++DEYWG
Sbjct  8    YPYNLDFDFSALEGLQRFSINNLGDPFIESNYGVHSREFEIGVLQWFARLWEIDQDEYWG  67

Query  698  YITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            YITNCGTEGNLHGILVGRE  PDGILYAS E+HYSVFKAARMY
Sbjct  68   YITNCGTEGNLHGILVGRENLPDGILYASHETHYSVFKAARMY  110



>gb|EAY77466.1| hypothetical protein OsI_32510 [Oryza sativa Indica Group]
Length=467

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSI  577
            LE+ EP AD     +K+A ++ ++A Y + L  R+ YHLGYP N D+D+G L+   +FS+
Sbjct  46   LEIEEPPADEMEAAEKKAGISRLMAGYVQHLQHRSAYHLGYPLNFDYDFGPLAPFLNFSL  105

Query  578  NNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREV  757
            NN GDPF + N  VHSRQFEV VL+WFA  WD+++D++WGYIT+ GTEGNL+G+LVGRE+
Sbjct  106  NNAGDPFAKVNNSVHSRQFEVAVLNWFANFWDVQRDQFWGYITSGGTEGNLYGLLVGREL  165

Query  758  FPDGILYASRESHYSVFKAARMY  826
            FPDGILYAS +SHYSVFKAA+MY
Sbjct  166  FPDGILYASNDSHYSVFKAAKMY  188



>gb|EMS49846.1| Histidine decarboxylase [Triticum urartu]
Length=341

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  512  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  691
            +GYPYNLDFD+  ++Q Q FSINNLGDPFIESNYGVHSRQFEV VLDWFA LW++++D+Y
Sbjct  21   IGYPYNLDFDFSVMAQFQSFSINNLGDPFIESNYGVHSRQFEVAVLDWFACLWELQQDQY  80

Query  692  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAA  817
            WGYITNCGTEGNLHG+LVGRE+FPDGI+Y  RESHYSVFKA 
Sbjct  81   WGYITNCGTEGNLHGLLVGRELFPDGIIYTFRESHYSVFKAG  122



>ref|XP_006661594.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=461

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 121/171 (71%), Gaps = 3/171 (2%)
 Frame = +2

Query  314  KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLV  493
            ++D   AA     +K+   L R V    LE+ EP  D     +K+A +A ++A Y + L 
Sbjct  15   QVDVVAAACDMLGEKQ---LVRQVILEGLEIEEPPVDETEVAEKKAGIARLMAGYVQHLQ  71

Query  494  ERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWD  673
             R+ +HLGYP NLD+D+  L+   +FS+NN GDPF + N  VHSRQFEV VL WFA  W+
Sbjct  72   HRSAFHLGYPLNLDYDFSPLAPFLNFSLNNAGDPFCKVNSSVHSRQFEVAVLHWFADFWE  131

Query  674  IEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            +++DEYWGYIT+ GTEGNL+G+L+GRE+FPDGILYAS +SHYSVFKAA+MY
Sbjct  132  VQRDEYWGYITSGGTEGNLYGLLLGRELFPDGILYASYDSHYSVFKAAKMY  182



>sp|Q8RV06.1|SDC2_ORYSJ RecName: Full=Serine decarboxylase 2 [Oryza sativa Japonica Group]
 gb|AAG12476.2|AC037197_1 Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAL75763.1| Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAP51789.1| Histidine decarboxylase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ15061.1| hypothetical protein OsJ_30471 [Oryza sativa Japonica Group]
Length=467

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSI  577
            LE+ EP AD     +K+A ++ ++A Y + L  R+ YHLGYP N D+D+  L+   +FS+
Sbjct  46   LEIEEPPADEMEAAEKKAGISRLMAGYVQHLQHRSAYHLGYPLNFDYDFSPLAPFLNFSL  105

Query  578  NNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREV  757
            NN GDPF + N  VHSRQFEV VL+WFA  WD+++D++WGYIT+ GTEGNL+G+LVGRE+
Sbjct  106  NNAGDPFAKVNNSVHSRQFEVAVLNWFANFWDVQRDQFWGYITSGGTEGNLYGLLVGREL  165

Query  758  FPDGILYASRESHYSVFKAARMY  826
            FPDGILYAS +SHYSVFKAA+MY
Sbjct  166  FPDGILYASNDSHYSVFKAAKMY  188



>gb|EAZ18332.1| hypothetical protein OsJ_33863 [Oryza sativa Japonica Group]
Length=446

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINN  583
            + EP  D ++   ++  + ++L  +R+ L ER+ +HLG+P +   D G L+Q QHF INN
Sbjct  31   IDEPPEDAQAVLKRQHGIDNLLGHFRQHLQERSAHHLGHPLSQKLDVGPLAQFQHFHINN  90

Query  584  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFP  763
            +GDPF+ESNYG+HSRQFE  VLDWFA LW+I KD+YWGY+TN G+EGN  G+LVGRE++P
Sbjct  91   IGDPFVESNYGIHSRQFEYAVLDWFAHLWEIPKDQYWGYVTNGGSEGNYDGLLVGRELYP  150

Query  764  DGILYASRESHYSVFKAARMY  826
            +GI+YAS++SHYS+FKAA+MY
Sbjct  151  EGIIYASQDSHYSIFKAAKMY  171



>ref|XP_006364728.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=447

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +2

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  571
            CL V EP+ +NE++  K   +  +LA+Y +TL ++ KYH+GYP N+ +++   L+ L  F
Sbjct  29   CLSVVEPNIENETSSQK---LDIILAQYLETLSKQKKYHIGYPINMCYEHQAILAPLLQF  85

Query  572  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGR  751
            S+NN GDPF +S    HS+ FEV VLDWFA+LW+IEKDEYWGYIT+ GTEGNLHG+LVGR
Sbjct  86   SLNNCGDPFTQSPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGLLVGR  145

Query  752  EVFPDGILYASRESHYSVFKAARMY  826
            E+ P GILYAS++SHYS+FKAARMY
Sbjct  146  ELHPSGILYASKDSHYSIFKAARMY  170



>gb|AGT16577.1| histidine decarboxylase-like protein [Saccharum hybrid cultivar 
R570]
Length=375

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 109/142 (77%), Gaps = 4/142 (3%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ-LQHFSIN  580
            V EP AD ++  +++A +A +LA +R+ L +R+ +HLGYPYNLD D+  L+  LQ   IN
Sbjct  56   VEEPPADEDALAERQAEVALLLAGFRRHLEDRSAHHLGYPYNLDLDFAPLAPFLQGLCIN  115

Query  581  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVF  760
            NLGDPF+ESNYGVHSR  EV VLD FARLWD+   +Y    T+CGTEGNLHG+LVGREVF
Sbjct  116  NLGDPFVESNYGVHSRPMEVAVLDCFARLWDLGPGDY---ATSCGTEGNLHGLLVGREVF  172

Query  761  PDGILYASRESHYSVFKAARMY  826
             DG++YAS +SHYSVF+ ARMY
Sbjct  173  RDGVMYASADSHYSVFRVARMY  194



>ref|XP_004245427.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP  DN+        + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  57   LEVMEPALDNDGPS-----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFH  111

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  112  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWGIEKDQYWGYVTNGGTEGNLHGILLGRE  171

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P+GILYAS++SHYSVFKAARMY
Sbjct  172  LLPEGILYASKDSHYSVFKAARMY  195



>ref|XP_002178784.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49482.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=364

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +2

Query  458  ASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  637
            + +L  Y + L  ++  H GYPYNL FDY +L+Q   +SINNLGDPF+ SNYGVHSRQFE
Sbjct  1    SDILHAYDQLLQSKSSVHFGYPYNLMFDYTELAQFMKYSINNLGDPFVPSNYGVHSRQFE  60

Query  638  VGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAA  817
            V V+D+FA+LW +E D YWGY+T  GTEGNLHGIL+ RE FPDGILY S+E+HYSVFKAA
Sbjct  61   VAVIDFFAKLWKMETDSYWGYVTTSGTEGNLHGILLAREKFPDGILYTSQETHYSVFKAA  120

Query  818  RMY  826
            R Y
Sbjct  121  RYY  123



>ref|NP_001233852.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
 gb|ABE77150.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
Length=471

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP  +N         + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  57   LEVMEPSLNNNGPS-----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFH  111

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  112  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAKLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  171

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P+GILYAS++SHYSVFKAARMY
Sbjct  172  LLPEGILYASKDSHYSVFKAARMY  195



>ref|XP_010325179.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum lycopersicum]
Length=469

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP  +N+        + ++L  Y  TL  R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  50   LEVMEPALNNDGPS-----LDTILVNYLDTLTRRVNYHLGYPVNICYDHYASLAPLLQFH  104

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  105  LNNCGDPFLQNTVDFHSKDFEVTVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  164

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + PDGILYAS++SHYSVFKAARMY
Sbjct  165  LLPDGILYASKDSHYSVFKAARMY  188



>ref|XP_006365168.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 107/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+     +  + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKND-----DPSLDTILVNYLDTLKQRVNYHLGYPVNICYDHYATLAPLLQFH  110

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  170

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + PDGILYAS++SHYSVFKAARMY
Sbjct  171  LLPDGILYASKDSHYSVFKAARMY  194



>ref|XP_004245279.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 120/190 (63%), Gaps = 18/190 (9%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  439
              P ++    + P V + K    P  +G + + +            LEV EP   N+   
Sbjct  23   MTPRSLARRRLFPNVDNKKQKVAPPGDGPRKNLQ------------LEVMEPGLKNDGPS  70

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINNLGDPFIESNYG  616
                 + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F +NN GDPF+++   
Sbjct  71   -----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYATLAPLLQFHLNNCGDPFLQNTVD  125

Query  617  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESH  796
             HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE+ P+GILYAS++SH
Sbjct  126  FHSKDFEVAVLDWFAKLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPEGILYASKDSH  185

Query  797  YSVFKAARMY  826
            YSVFKAARMY
Sbjct  186  YSVFKAARMY  195



>ref|XP_004245280.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum lycopersicum]
Length=476

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP  +N+        + ++L  Y  TL  R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  57   LEVMEPALNNDGPS-----LDTILVNYLDTLTRRVNYHLGYPVNICYDHYASLAPLLQFH  111

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  112  LNNCGDPFLQNTVDFHSKDFEVTVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  171

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + PDGILYAS++SHYSVFKAARMY
Sbjct  172  LLPDGILYASKDSHYSVFKAARMY  195



>ref|XP_006365087.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=467

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+        + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  53   LEVMEPGLKNDGPS-----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFH  107

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VL+WFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  108  LNNCGDPFLQNTVDFHSKDFEVAVLNWFAQLWEIEKDQYWGYVTNGGTEGNLHGILIGRE  167

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + PDGILYAS++SHYSVFKAARMY
Sbjct  168  LLPDGILYASKDSHYSVFKAARMY  191



>ref|XP_006365166.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=469

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLTQRVNFHLGYPVNICYDHYATLAPLLQFH  110

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  170

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + PDGILYAS++SHYSVFKAARMY
Sbjct  171  LLPDGILYASKDSHYSVFKAARMY  194



>gb|EMT14424.1| Histidine decarboxylase [Aegilops tauschii]
Length=440

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  518  YPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWG  697
            YP+NLDFD+  L Q Q FSINNLG PFIESNYGVHSR+FEV VLDWFARLW+I++DEYWG
Sbjct  133  YPFNLDFDFSVLDQFQSFSINNLGGPFIESNYGVHSRRFEVAVLDWFARLWNIQQDEYWG  192

Query  698  YITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            YIT  GTEGNLHG+LVGRE+F DGI+YAS +SHYSVFKAARMY
Sbjct  193  YITTGGTEGNLHGLLVGREIFRDGIIYASCDSHYSVFKAARMY  235



>ref|XP_006364727.1| PREDICTED: histidine decarboxylase-like, partial [Solanum tuberosum]
Length=422

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 111/145 (77%), Gaps = 4/145 (3%)
 Frame = +2

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  571
            CL V EPD  +E++  +   +  +L +Y +TL ER KYH+GYP N+ +++   L+ L  F
Sbjct  6    CLSVVEPDIKDETSFQE---LDMILTQYLETLSERKKYHIGYPTNMHYEHHAILAPLLQF  62

Query  572  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGR  751
            S+NN GDPF +S    HS+ FEV VLDWFA+LW+I+KDEYWGYIT+ GTEGNLHG+LVGR
Sbjct  63   SLNNCGDPFTQSPADFHSKDFEVAVLDWFAQLWEIDKDEYWGYITSGGTEGNLHGLLVGR  122

Query  752  EVFPDGILYASRESHYSVFKAARMY  826
            E+ P GILYAS++SHYS+FKAAR+Y
Sbjct  123  ELLPTGILYASKDSHYSIFKAARLY  147



>gb|EEC76705.1| hypothetical protein OsI_14710 [Oryza sativa Indica Group]
Length=407

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINN  583
            + EP +       ++  MA++LA +++ L ER+ + +GYP N +FD+G + +  +  +NN
Sbjct  19   IDEPPSAASELEKRQDDMANLLATFKEHLQERSAHSIGYPINFEFDFGPVIEFLNMRLNN  78

Query  584  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFP  763
             GDPF+E NYG+HS++FE+ VLDWFARLW++ KD+YWGY+T+ GTEGN+HG+LVGRE+FP
Sbjct  79   AGDPFMECNYGIHSKKFEIAVLDWFARLWELPKDQYWGYVTSGGTEGNMHGLLVGRELFP  138

Query  764  DGILYASRESHYSVFKAARMY  826
            +GI+Y S +SHYS+FKAA+MY
Sbjct  139  EGIIYTSCDSHYSIFKAAKMY  159



>gb|ABA93664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1040

 Score =   187 bits (475),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINN  583
            + EP  D ++   ++  + ++L  +R+ L ER+ +HLG+P +   D G L+Q QHF INN
Sbjct  608  IDEPPEDAQAVLKRQHGIDNLLGHFRQHLQERSAHHLGHPLSQKLDVGPLAQFQHFHINN  667

Query  584  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFP  763
            +GDPF+ESNYG+HSRQFE  VLDWFA LW+I KD+YWGY+TN G+EGN  G+LVGRE++P
Sbjct  668  IGDPFVESNYGIHSRQFEYAVLDWFAHLWEIPKDQYWGYVTNGGSEGNYDGLLVGRELYP  727

Query  764  DGILYASRESHYSVFKAARMY  826
            +GI+YAS++SHYS+FKAA+MY
Sbjct  728  EGIIYASQDSHYSIFKAAKMY  748



>ref|XP_002292250.1| histidine decarboxylase [Thalassiosira pseudonana CCMP1335]
 gb|EED90225.1| histidine decarboxylase, partial [Thalassiosira pseudonana CCMP1335]
Length=369

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  458  ASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  637
            + +LA Y K L  ++  H GYPYNL +++ +L +   +SINNLGDPFI SNYGVHSRQFE
Sbjct  1    SDILASYDKLLKRKSSVHFGYPYNLMYNHEELYEFMKYSINNLGDPFITSNYGVHSRQFE  60

Query  638  VGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAA  817
              V+D+FA+LW  E D YWGY+T CGTEGNLHGIL+ RE  PDGILY+SRE+HYSVFKAA
Sbjct  61   CSVIDFFAKLWKAEPDSYWGYVTTCGTEGNLHGILLARECHPDGILYSSRETHYSVFKAA  120

Query  818  RMY  826
            R Y
Sbjct  121  RYY  123



>ref|XP_004245144.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=444

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +2

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  571
            CL V E D  NE++  K   +  +L +Y +TL +R KYH+GYP N+ +++   L+ L  F
Sbjct  29   CLSVVESDIKNETSFQK---LDMILTQYLETLSKRKKYHIGYPTNMHYEHHATLAPLLQF  85

Query  572  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGR  751
             +NN GDPF +     HS+ FEV VLDWFA+LW+IEKDEYWGYIT+ GTEGNLHG+LVGR
Sbjct  86   HLNNFGDPFAQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGLLVGR  145

Query  752  EVFPDGILYASRESHYSVFKAARMY  826
            E+ P GILYAS++SHYS+FKAARMY
Sbjct  146  ELLPSGILYASKDSHYSIFKAARMY  170



>ref|XP_006365163.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=470

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLTQRVNFHLGYPVNICYDHYASLAPLLQFH  110

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  170

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P+GILYAS++SHYSVFKAARMY
Sbjct  171  LLPEGILYASKDSHYSVFKAARMY  194



>ref|XP_006591667.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=220

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  563  QHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGIL  742
            +HFSINN GDPFIESNYGVHSRQFEVGVLDWFA LW++EKDEYWGYITN GTEGNLHGIL
Sbjct  72   KHFSINNPGDPFIESNYGVHSRQFEVGVLDWFAWLWELEKDEYWGYITNYGTEGNLHGIL  131

Query  743  VGREVFPDGILYASRESHYSVFKAARMY  826
            VGREVFP+GILYAS+ESHYSVFKAARMY
Sbjct  132  VGREVFPNGILYASQESHYSVFKAARMY  159



>ref|XP_006365167.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 105/144 (73%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLTQRVNFHLGYPVNICYDHYATLAPLLQFH  110

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  170

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + PDGILYAS++SHYSVFKA RMY
Sbjct  171  LLPDGILYASKDSHYSVFKATRMY  194



>ref|NP_001233845.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
 gb|ABE77149.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
Length=471

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+        + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  57   LEVMEPALKNDGPS-----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYATLAPLLQFH  111

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VL+WFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  112  LNNCGDPFLQNTVDFHSKDFEVAVLNWFAKLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  171

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P+GILYAS++SHYSVFKAARMY
Sbjct  172  LLPEGILYASKDSHYSVFKAARMY  195



>ref|XP_004245145.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=443

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 116/165 (70%), Gaps = 7/165 (4%)
 Frame = +2

Query  335  ANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHL  514
            A   K D   ++L +N+   C+ V EP+  NE +  K   +  +L ++ + L +R KYH+
Sbjct  11   AVSTKGDDTPLILRKNL---CVNVVEPNIKNEISSQK---LDIILTQFMEILSKRKKYHI  64

Query  515  GYPYNLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  691
            GYP N+ +++   L+ L  F +NN GDPF +     HS+ FEV VLDWFA+LW+IEKDEY
Sbjct  65   GYPINVCYEHHATLAPLLQFHLNNCGDPFTQHPTDFHSKDFEVAVLDWFAQLWEIEKDEY  124

Query  692  WGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            WGYIT+ GTEGNLHG+LVGRE+ P GILYAS++SHYS+FKAARMY
Sbjct  125  WGYITSGGTEGNLHGLLVGRELLPSGILYASKDSHYSIFKAARMY  169



>ref|XP_006365165.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=482

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  69   LEVLEPGLKNDGPS-----LDTILVNYLDTLTQRVNFHLGYPVNICYDHYATLAPLLQFH  123

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  124  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  183

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P+GILYAS++SHYSVFKAARMY
Sbjct  184  LLPEGILYASKDSHYSVFKAARMY  207



>gb|KHN16991.1| Histidine decarboxylase [Glycine soja]
Length=413

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +2

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            A  + +G+ +A +ASV+ +Y +TL +     LGYP N DFDY  L+ L HF +NN+GDPF
Sbjct  5    AITKCSGETQANLASVITQYVETLNQHNLRFLGYPTNQDFDYDALAPLLHFHLNNVGDPF  64

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
             ES++ ++S +FEV VLDWFA LW+I+K EYWGY+T  GTEGNLHGIL GRE FPDGILY
Sbjct  65   TESSFSLNSSKFEVCVLDWFANLWEIDKGEYWGYVTTGGTEGNLHGILTGREQFPDGILY  124

Query  779  ASRESHYSVFKAARMY  826
             S++SHYS+FKAARMY
Sbjct  125  TSQDSHYSIFKAARMY  140



>ref|XP_006365162.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
Length=470

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLKQRVNFHLGYPVNICYDHYATLAPLLQFH  110

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  170

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P+GILYAS++SHYSVFKAARMY
Sbjct  171  LLPEGILYASKDSHYSVFKAARMY  194



>ref|XP_006365164.1| PREDICTED: histidine decarboxylase-like isoform X3 [Solanum tuberosum]
Length=470

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLKQRVNFHLGYPVNICYDHYATLAPLLQFH  110

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  170

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P+GILYAS++SHYSVFKAARMY
Sbjct  171  LLPEGILYASKDSHYSVFKAARMY  194



>ref|XP_009622262.1| PREDICTED: LOW QUALITY PROTEIN: histidine decarboxylase-like 
[Nicotiana tomentosiformis]
Length=444

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  574
            L V EPD+ +  T  +E  +  +L +Y +TL  RT+YH+GYP N+ +++   L+ L  F 
Sbjct  28   LSVVEPDSKDNKTFSQE--LDRILTQYIETLSHRTEYHIGYPVNICYEHHAALAPLLQFH  85

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GTEGNLHG+L+GRE
Sbjct  86   LNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLLIGRE  145

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P GI+YAS++SHYS+FKAARMY
Sbjct  146  LHPTGIIYASKDSHYSIFKAARMY  169



>gb|KJE90702.1| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=683

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = +2

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            AD      ++A +      YR  L ERT YH GYPYNL FD   L    ++S NNLGD F
Sbjct  271  ADEREYAKRKAAVVQTFDAYRDFLAERTAYHFGYPYNLAFDNEHLHSFMNYSCNNLGDCF  330

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            + SNY VH+R+FE+GVLD+FA LW I +++YWGY+T+CGTEGNLHG+L+ RE  P GILY
Sbjct  331  VASNYEVHTRKFEIGVLDFFADLWKIPREDYWGYVTSCGTEGNLHGLLLARECLPTGILY  390

Query  779  ASRESHYSVFKAARMY  826
            ASRESHYSVFKAAR Y
Sbjct  391  ASRESHYSVFKAARYY  406



>ref|XP_004364837.2| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=692

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = +2

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            AD      ++A +      YR  L ERT YH GYPYNL FD   L    ++S NNLGD F
Sbjct  280  ADEREYAKRKAAVVQTFDAYRDFLAERTAYHFGYPYNLAFDNEHLHSFMNYSCNNLGDCF  339

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            + SNY VH+R+FE+GVLD+FA LW I +++YWGY+T+CGTEGNLHG+L+ RE  P GILY
Sbjct  340  VASNYEVHTRKFEIGVLDFFADLWKIPREDYWGYVTSCGTEGNLHGLLLARECLPTGILY  399

Query  779  ASRESHYSVFKAARMY  826
            ASRESHYSVFKAAR Y
Sbjct  400  ASRESHYSVFKAARYY  415



>gb|EJK75470.1| hypothetical protein THAOC_02802 [Thalassiosira oceanica]
Length=474

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  458  ASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  637
            + +L+ Y K L  ++  H GYPYNL +++ +L +   +SINNLGDPFI SNYGVHSRQFE
Sbjct  185  SEILSSYDKLLRRKSSVHFGYPYNLMYNHEELYEFMKYSINNLGDPFITSNYGVHSRQFE  244

Query  638  VGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAA  817
              V+D+FARLW +E+D YWGY+T CGTEGNLHGIL+ RE  PDG+LY+SRE+HYS+FKAA
Sbjct  245  CSVIDFFARLWKMEEDSYWGYVTTCGTEGNLHGILLARECHPDGVLYSSRETHYSIFKAA  304

Query  818  RMY  826
            R Y
Sbjct  305  RYY  307



>ref|XP_009602156.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=446

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 108/144 (75%), Gaps = 3/144 (2%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  574
            L V EPD  +  T  +E  +  +L +Y +TL  RT+YH+GYP N+ +++   L+ L  F 
Sbjct  30   LSVVEPDGKDIKTSSQE--LDRILIQYIETLSHRTEYHIGYPVNICYEHHAALAPLLQFH  87

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GTEGNLHG+L+GRE
Sbjct  88   LNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLLIGRE  147

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P GI+YAS++SHYS+FKAARMY
Sbjct  148  LHPTGIIYASKDSHYSIFKAARMY  171



>gb|AES62380.2| serine decarboxylase [Medicago truncatula]
Length=432

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 110/161 (68%), Gaps = 6/161 (4%)
 Frame = +2

Query  344  GKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            G+ DK   +   N    CL +T  +      G+  A +  ++  Y  TL ++  + LGYP
Sbjct  13   GEEDKERDIQENNNGHMCLAITNCN------GETHAKLDEIITHYEGTLNQKISHFLGYP  66

Query  524  YNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYI  703
             N +FDY  L+ L HF INN GDPF+ S+YGV+S  FE+ VLDWFA+LW+I+K EYWGY+
Sbjct  67   TNQNFDYDALAPLLHFHINNAGDPFMGSSYGVNSTDFEISVLDWFAKLWEIKKGEYWGYV  126

Query  704  TNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            T  GTEGNLHGIL+GRE FPDGILY S++SHYS+FK AR+Y
Sbjct  127  TTGGTEGNLHGILIGREKFPDGILYTSQDSHYSIFKIARIY  167



>ref|XP_009779195.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  574
            L V EPD  +     +E  +  +L +Y +TL  RT+YH+GYP N+ +++   L+ L  F 
Sbjct  30   LSVVEPDEKDNKMSSQE--LDRILTQYIETLSHRTEYHIGYPVNICYEHHAALAPLLQFH  87

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GTEGNLHG+L+GRE
Sbjct  88   LNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLLIGRE  147

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P GI+YAS++SHYS+FKAARMY
Sbjct  148  LHPTGIIYASKDSHYSIFKAARMY  171



>ref|XP_009774334.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 106/142 (75%), Gaps = 3/142 (2%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGD-LSQLQHFSIN  580
            V EPD  N     +E  +  +L +Y +TL  RT+YH+GYP N+ +++ D L+ L  F +N
Sbjct  32   VVEPDEKNIKMSSQE--LDKILTQYIETLSHRTEYHIGYPVNICYEHHDALAPLLQFHLN  89

Query  581  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVF  760
            N GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GTEGNLHG+L+GRE+ 
Sbjct  90   NCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLLIGRELH  149

Query  761  PDGILYASRESHYSVFKAARMY  826
            P  I+YAS++SHYS+FKAARMY
Sbjct  150  PTAIIYASKDSHYSIFKAARMY  171



>ref|XP_004245281.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=455

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 104/144 (72%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            LEV EP   N+        + + L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  46   LEVMEPGLKNDGPS-----LDTTLVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFH  100

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VL+WFA+LW+IEKD+ WGY+TN GTEGNLHGIL+GRE
Sbjct  101  LNNCGDPFLQNTVDFHSKDFEVAVLNWFAQLWEIEKDQCWGYVTNGGTEGNLHGILLGRE  160

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P+GILYAS++SHYSVFKAARMY
Sbjct  161  LLPEGILYASKDSHYSVFKAARMY  184



>ref|XP_004496485.1| PREDICTED: histidine decarboxylase-like [Cicer arietinum]
Length=446

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 117/175 (67%), Gaps = 6/175 (3%)
 Frame = +2

Query  302  VQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYR  481
            ++ + + S   +N   A + E     N+  T L +      N+  G+ +A + +++  Y 
Sbjct  4    LEGNNMLSMVVSNAKLAREEERQENINITNTNLTI------NQCIGETDANLKAIITHYV  57

Query  482  KTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA  661
             TL   +  +LGYP N DF+Y  L+ L HF +NN GDPF+ S++ ++S +FEVGVLDWFA
Sbjct  58   DTLTYSSLRNLGYPTNQDFNYDALASLFHFHLNNAGDPFVGSSFSLNSTKFEVGVLDWFA  117

Query  662  RLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
             LW+IEK +YWGY+T  GTEGNLHGILVGRE FPDGILY S++SHYS+FK ARMY
Sbjct  118  ELWEIEKSDYWGYVTTGGTEGNLHGILVGREQFPDGILYTSQDSHYSIFKIARMY  172



>ref|XP_009600675.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=456

 Score =   176 bits (446),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 103/144 (72%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            L VTEP       G     + S+L  Y  TL +R  +H+GYP N+ +  Y  L+ L  F 
Sbjct  42   LAVTEP-----GFGSDGPSLDSILVNYLDTLTQRVNFHIGYPVNICYHHYATLAPLLQFH  96

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPFI++    HS+ FE+ VLDWFA LW+IEKD+YWGY+TN GTEGNLHGIL+GRE
Sbjct  97   LNNCGDPFIDNTVDFHSKDFEMAVLDWFANLWEIEKDQYWGYVTNGGTEGNLHGILLGRE  156

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + PDGILYAS++SHYSVFKAARMY
Sbjct  157  LLPDGILYASKDSHYSVFKAARMY  180



>ref|XP_009601848.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  574
            L V EPD  +      +  +  ++ +Y +TL  R KYHLGYP N+ +++   L+ L  F 
Sbjct  32   LSVVEPDEKDIKISSHK--LDRIVTQYLETLSHRKKYHLGYPINVCYEHHAALAPLLQFY  89

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF E+    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GTEGNLHG+L+GRE
Sbjct  90   LNNCGDPFTENTIDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLLIGRE  149

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P GI+YAS++SHYSVFKAARMY
Sbjct  150  LHPTGIIYASKDSHYSVFKAARMY  173



>ref|XP_003592126.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES62377.1| serine decarboxylase [Medicago truncatula]
Length=453

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = +2

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  598
            A    TG+ +  +A V+  Y  TL +   + LGYP N  FDY  L+ L HF INN+GDPF
Sbjct  46   AITNCTGESQGKLAEVINHYAGTLNQEISHLLGYPTNQSFDYSALAPLLHFHINNVGDPF  105

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            + S+YGV+S  FEV VLDWFA+LW+I+K+EYWGYIT+ GTEGN HGIL+GRE F DGI+Y
Sbjct  106  MGSSYGVNSANFEVSVLDWFAKLWEIKKEEYWGYITSGGTEGNFHGILLGREKFSDGIIY  165

Query  779  ASRESHYSVFKAARMY  826
             S++SHYS+FK ARMY
Sbjct  166  TSQDSHYSIFKIARMY  181



>ref|XP_003535572.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=462

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSI  577
            +++ E  A  + +G+ +A +ASV+  Y +TL + +  +LGYP N +F+Y  L+ L HF +
Sbjct  43   IDIKENLAITKCSGETQANLASVITHYVETLNQYSLRNLGYPTNQNFNYDTLASLLHFHL  102

Query  578  NNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREV  757
            NN GDPF+ S++ ++S +FEV VLDWFA LW+IEK++YWGY+T  GTEGNLHGILVGRE 
Sbjct  103  NNAGDPFLGSSFSLNSTRFEVCVLDWFANLWEIEKNKYWGYVTTGGTEGNLHGILVGREQ  162

Query  758  FPDGILYASRESHYSVFKAARMY  826
             PDGILY S++SHYS+FK ARMY
Sbjct  163  LPDGILYTSQDSHYSIFKIARMY  185



>ref|XP_011082256.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=437

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSIN  580
            V EP+ + E   ++   ++  +  +++ L ER  Y+LGYP N + + Y  LS L  F+IN
Sbjct  40   VEEPN-NEECAVERVDRLSKTVTEFQEHLRERVSYYLGYPANHNCEHYLALSTLLQFNIN  98

Query  581  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVF  760
            N+GDPF ES++G+HS++FEVGVLDWFA+LW I+KDEYWGY+TN GTEGNLHGIL+GRE+ 
Sbjct  99   NVGDPFKESDHGLHSKKFEVGVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGILMGRELL  158

Query  761  PDGILYASRESHYSVFKAARMY  826
            P+GILY S+ESHYS+FK ARMY
Sbjct  159  PNGILYTSQESHYSMFKIARMY  180



>ref|XP_003535578.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=423

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 107/151 (71%), Gaps = 10/151 (7%)
 Frame = +2

Query  374  GRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDL  553
            G   H+ C         N +  D+ + +ASV+ +Y +TL +     LGYP N DFDY  L
Sbjct  10   GNGFHSCC---------NGAVADR-SNLASVITQYVETLNQHNLRFLGYPTNQDFDYDAL  59

Query  554  SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLH  733
            + L HF +NN+GDPF ES++ ++S +FEV VLDWFA LW+I+K EYWGY+T  GTEGNLH
Sbjct  60   APLLHFHLNNVGDPFTESSFSLNSSKFEVCVLDWFANLWEIDKGEYWGYVTTGGTEGNLH  119

Query  734  GILVGREVFPDGILYASRESHYSVFKAARMY  826
            GIL GRE FPDGILY S++SHYS+FKAARMY
Sbjct  120  GILTGREQFPDGILYTSQDSHYSIFKAARMY  150



>ref|XP_004245146.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=444

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 107/145 (74%), Gaps = 4/145 (3%)
 Frame = +2

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  571
            CL + EP   N+++ ++   +  +L +Y  TL +R KYH+GYP NL +++   L+ L  F
Sbjct  30   CLSLIEPHIKNKTSSEE---LNMILTQYVDTLSQRMKYHIGYPINLSYEHHATLAPLLQF  86

Query  572  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGR  751
             +NN GDPF +     HS+ FEV VLDWFA+LW+IEKDEYWGYIT+ GTEGNLHG+LVGR
Sbjct  87   HLNNCGDPFTQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGLLVGR  146

Query  752  EVFPDGILYASRESHYSVFKAARMY  826
            E+ P GILYAS++SHYS+ KAAR+Y
Sbjct  147  ELHPSGILYASKDSHYSISKAARLY  171



>gb|KEH43660.1| serine decarboxylase [Medicago truncatula]
Length=543

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = +2

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  604
            NE  G+K+A + +++ARY +T+ +    +LGYP N DF+Y  L+ L HF +NN GDPF+ 
Sbjct  44   NECMGEKDANLDAIIARYAETINKYNLRNLGYPTNQDFNYDKLAPLFHFHLNNAGDPFVG  103

Query  605  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS  784
            S++ ++S  FEV VLDWFA LW+I+  EYWGY+T  G+EGNLHGILVGRE FPDGILY S
Sbjct  104  SSFSLNSSPFEVSVLDWFANLWNIDNSEYWGYVTTGGSEGNLHGILVGREQFPDGILYTS  163

Query  785  RESHYSVFKAARMY  826
            +ESHYS+FK ARMY
Sbjct  164  QESHYSIFKIARMY  177



>gb|AHG12639.1| histidine decarboxylase [Nicotiana tabacum]
Length=446

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  574
            L V EPD  +     +E  +  +L +Y +TL  RT+YH+GYP N+ +++   L+ L  F 
Sbjct  30   LSVVEPDEKDNKMSSQE--LDRILTQYIETLSHRTEYHIGYPVNICYEHHAALAPLLQFH  87

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GTEGNLHG+L+GRE
Sbjct  88   LNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLLIGRE  147

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            +   GI+YAS++SHYS+FKAARMY
Sbjct  148  LHLTGIIYASKDSHYSIFKAARMY  171



>ref|XP_011081981.1| PREDICTED: histidine decarboxylase-like isoform X1 [Sesamum indicum]
Length=465

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  407  TEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINN  583
             EP  +     ++  ++  ++ +++  L ER   HLGYP N +   Y  LS L  F+INN
Sbjct  50   VEPKDEESCAAERLHHLTKIVTQFQDHLRERASNHLGYPGNHNCSHYLALSTLLQFNINN  109

Query  584  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFP  763
             GDPF ES++G+HS++FEVGVLDWFA+LW I+KDEYWGY+TN GTEGNLHGIL+GRE+ P
Sbjct  110  AGDPFKESDHGLHSKKFEVGVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGILMGRELLP  169

Query  764  DGILYASRESHYSVFKAARMY  826
            +GILY S+ESHYS+FK ARMY
Sbjct  170  NGILYTSQESHYSMFKIARMY  190



>ref|XP_011081982.1| PREDICTED: histidine decarboxylase-like isoform X2 [Sesamum indicum]
Length=463

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  407  TEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINN  583
             EP  +     ++  ++  ++ +++  L ER   HLGYP N +   Y  LS L  F+INN
Sbjct  50   VEPKDEESCAAERLHHLTKIVTQFQDHLRERASNHLGYPGNHNCSHYLALSTLLQFNINN  109

Query  584  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFP  763
             GDPF ES++G+HS++FEVGVLDWFA+LW I+KDEYWGY+TN GTEGNLHGIL+GRE+ P
Sbjct  110  AGDPFKESDHGLHSKKFEVGVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGILMGRELLP  169

Query  764  DGILYASRESHYSVFKAARMY  826
            +GILY S+ESHYS+FK ARMY
Sbjct  170  NGILYTSQESHYSMFKIARMY  190



>gb|EYU30500.1| hypothetical protein MIMGU_mgv1a023109mg, partial [Erythranthe 
guttata]
Length=418

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMAS-VLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  571
            L + EP  D E   +++  M + ++  +++ L ER+ + LGYP NL+ ++  DLS L  F
Sbjct  1    LALVEPH-DEECVAERQRCMVTNIMFEFQEYLNERSNHLLGYPTNLNCNHLMDLSPLLCF  59

Query  572  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGR  751
             +NN+GDPF ESN+G+HS++FEV VLDWFA+LW+IEK EYWGY+TN GTEGNLHG+L+GR
Sbjct  60   LMNNVGDPFKESNFGLHSKKFEVAVLDWFAQLWEIEKGEYWGYVTNGGTEGNLHGMLIGR  119

Query  752  EVFPDGILYASRESHYSVFKAARMY  826
             + PDGILY S+ESHYS+FK +R+Y
Sbjct  120  NLLPDGILYTSKESHYSIFKGSRIY  144



>ref|XP_006357083.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 104/144 (72%), Gaps = 7/144 (5%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            L VTEP  ++  + D        L  Y  TL +R  YH+GYP N+ ++ Y +L+ L  F 
Sbjct  52   LSVTEPGKNDGPSLD------CTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFH  105

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VL+WFA LW+IE+D+YWGY+TN GTEGNLHGILVGRE
Sbjct  106  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGILVGRE  165

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            +FPDGILYAS++SHYSV KAA MY
Sbjct  166  LFPDGILYASKDSHYSVAKAAMMY  189



>ref|XP_006366216.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=418

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  512  LGYPYNLDFD-YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDE  688
            LGYP+N+  D Y  L+ L  + +NN GDPF E+NYG+HSR FEVGVLDWF++LW+IEKD+
Sbjct  39   LGYPHNIYCDEYVALAPLLRYHLNNFGDPFTENNYGMHSRHFEVGVLDWFSKLWEIEKDQ  98

Query  689  YWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            YWGY+T+CGTEGNLHGIL+GRE FPDGILYAS ESHYSV KAARMY
Sbjct  99   YWGYVTHCGTEGNLHGILLGREQFPDGILYASGESHYSVLKAARMY  144



>ref|NP_001233859.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
 gb|ABE77151.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
Length=465

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 104/144 (72%), Gaps = 7/144 (5%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            L VTEP  ++  + D        L  Y  TL +R  YH+GYP N+ ++ Y +L+ L  F 
Sbjct  52   LSVTEPGKNDGPSLD------CTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFH  105

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VL+WFA LW+IE+D+YWGY+TN GTEGNLHGILVGRE
Sbjct  106  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGILVGRE  165

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            +FPDGILYAS++SHYSV KAA MY
Sbjct  166  LFPDGILYASKDSHYSVAKAAMMY  189



>ref|XP_003607343.1| Aromatic amino acid decarboxylase 1B [Medicago truncatula]
Length=297

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +2

Query  380  NVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ  559
            N+H   +      A  +  G+ +A + +V+A Y +T+ +    +LGYP N DF+Y  L+ 
Sbjct  45   NIHEEDINRLTNIAITQCIGETDANLDAVIAHYVETINKYNLCNLGYPGNQDFNYEALAP  104

Query  560  LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGI  739
            L  F +NN GDPF+ S + ++S  FEV VLDWFA+LW+IEKD+YWGY+T  GTEGNLH I
Sbjct  105  LLQFLLNNAGDPFLGSGFSLNSMTFEVSVLDWFAKLWEIEKDQYWGYVTTGGTEGNLHAI  164

Query  740  LVGREVFPDGILYASRESHYSVFKAARMY  826
            LV RE FPDGILY S++SHYS+FK ARMY
Sbjct  165  LVAREQFPDGILYTSQDSHYSIFKIARMY  193



>ref|XP_006367691.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=457

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = +2

Query  464  VLARYRKTLVERTKYHLGYPYNLDFDYG-DLSQLQHFSINNLGDPFIESNYGVHSRQFEV  640
            +L  Y KTL +R KYHLG+P N+ +D+   L+ L  F +NN GDPF E+    HS+ FEV
Sbjct  60   ILDNYLKTLTQRVKYHLGFPENICYDHHVALAPLLQFHLNNCGDPFTENPVDFHSKDFEV  119

Query  641  GVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
             VLDWFA+LW+IEKDEYWGY+T+ GTEGNLHGI +GRE+ P+GILYAS++SHYSVFKAAR
Sbjct  120  AVLDWFAKLWEIEKDEYWGYVTHGGTEGNLHGIWIGRELLPNGILYASKDSHYSVFKAAR  179

Query  821  MY  826
            +Y
Sbjct  180  LY  181



>ref|XP_002679079.1| predicted protein [Naegleria gruberi]
 gb|EFC46335.1| predicted protein [Naegleria gruberi]
Length=441

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 100/133 (75%), Gaps = 12/133 (9%)
 Frame = +2

Query  464  VLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVG  643
            +L +Y+K + ERT +H GYPYNL +++ +LS    +S+NNLGDPF+ESNYGVHSR FE  
Sbjct  36   ILDQYKKHIEERTYHHFGYPYNLSYNHEELSPFLRYSVNNLGDPFVESNYGVHSRAFEQS  95

Query  644  VLDWFARLWDI------------EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  787
            VL++FA+LW I              DEYWGY+TNCGTEGNL+GIL+GRE FPD +L +SR
Sbjct  96   VLEFFAKLWKIGPCEDKDNTKNWSHDEYWGYVTNCGTEGNLYGILLGREQFPDAVLVSSR  155

Query  788  ESHYSVFKAARMY  826
            ESHYSV KAA++Y
Sbjct  156  ESHYSVSKAAKLY  168



>ref|XP_004244519.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=465

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 103/144 (72%), Gaps = 7/144 (5%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            L VTEP  ++  T D        L  Y  TL +R  YH+GYP N+ ++ Y +L+ L  F 
Sbjct  52   LSVTEPGKNDGPTLD------CTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFH  105

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VL+WFA LW+IE+D+YWGY+TN GTEGNLHGILVGRE
Sbjct  106  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGILVGRE  165

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            +FP GILYAS++SHYSV KAA MY
Sbjct  166  LFPTGILYASKDSHYSVAKAAMMY  189



>gb|AES89540.2| serine decarboxylase [Medicago truncatula]
Length=301

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +2

Query  380  NVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ  559
            N+H   +      A  +  G+ +A + +V+A Y +T+ +    +LGYP N DF+Y  L+ 
Sbjct  45   NIHEEDINRLTNIAITQCIGETDANLDAVIAHYVETINKYNLCNLGYPGNQDFNYEALAP  104

Query  560  LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGI  739
            L  F +NN GDPF+ S + ++S  FEV VLDWFA+LW+IEKD+YWGY+T  GTEGNLH I
Sbjct  105  LLQFLLNNAGDPFLGSGFSLNSMTFEVSVLDWFAKLWEIEKDQYWGYVTTGGTEGNLHAI  164

Query  740  LVGREVFPDGILYASRESHYSVFKAARMY  826
            LV RE FPDGILY S++SHYS+FK ARMY
Sbjct  165  LVAREQFPDGILYTSQDSHYSIFKIARMY  193



>ref|XP_006357084.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 103/144 (72%), Gaps = 7/144 (5%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            L VTEP  ++  + D        L  Y  TL +R  YH+GYP N+ ++ Y +L+ L  F 
Sbjct  52   LSVTEPGKNDGPSLD------CTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFH  105

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VL+WFA LW+IE+D+YWGY+TN GTEGNLHGILVGRE
Sbjct  106  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGILVGRE  165

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            +FP GILYAS++SHYSV KAA MY
Sbjct  166  IFPTGILYASKDSHYSVAKAAMMY  189



>ref|XP_006346847.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=498

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = +2

Query  464  VLARYRKTLVERTKYHLGYPYNLDFDYG-DLSQLQHFSINNLGDPFIESNYGVHSRQFEV  640
            +L  Y KTL +R KYHLG+P N+ +D+   L+ L  F +NN GDPF E+    HS+ FEV
Sbjct  60   ILDNYLKTLTQRVKYHLGFPENICYDHHVALAPLLQFHLNNCGDPFTENPVDFHSKDFEV  119

Query  641  GVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
             VLDWFA+LW+IEKDEYWGY+T+ GTEGNLHGI +GRE+ P+GILY+S++SHYSVFKAAR
Sbjct  120  AVLDWFAKLWEIEKDEYWGYVTHGGTEGNLHGIWIGRELLPNGILYSSKDSHYSVFKAAR  179

Query  821  MY  826
            +Y
Sbjct  180  LY  181



>ref|NP_001234136.2| histidine decarboxylase [Solanum lycopersicum]
Length=446

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 106/146 (73%), Gaps = 5/146 (3%)
 Frame = +2

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  571
            CL V E D  NE++  +   +  +L +Y +TL ER KYH+GYP N+ +++   L+ L  F
Sbjct  29   CLSVMESDIKNETSFQE---LDMILTQYLETLSERKKYHIGYPINMCYEHHATLAPLLQF  85

Query  572  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVG-  748
             +NN GDPF +     HS+ FEV VLDWFA+LW+IEKDEYWGYIT+ GTEGNLHG  +G 
Sbjct  86   HLNNCGDPFTQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGFWLGR  145

Query  749  REVFPDGILYASRESHYSVFKAARMY  826
            RE+ P+G LYAS++SHYS+FKAARMY
Sbjct  146  RELLPNGYLYASKDSHYSIFKAARMY  171



>ref|XP_003592132.1| FAR1-related protein [Medicago truncatula]
Length=1272

 Score =   175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = +2

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  604
            NE  G+K+A + +++ARY +T+ +    +LGYP N DF+Y  L+ L HF +NN GDPF+ 
Sbjct  44   NECMGEKDANLDAIIARYAETINKYNLRNLGYPTNQDFNYDKLAPLFHFHLNNAGDPFVG  103

Query  605  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYAS  784
            S++ ++S  FEV VLDWFA LW+I+  EYWGY+T  G+EGNLHGILVGRE FPDGILY S
Sbjct  104  SSFSLNSSPFEVSVLDWFANLWNIDNSEYWGYVTTGGSEGNLHGILVGREQFPDGILYTS  163

Query  785  RESHYSVFKAARMY  826
            +ESHYS+FK ARMY
Sbjct  164  QESHYSIFKIARMY  177



>ref|XP_009789723.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=465

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 120/196 (61%), Gaps = 23/196 (12%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLG------RNVHTTCLEVTEPDA  421
            F P+A+    + PP            NG   + + + +       +N++ T   VTEP +
Sbjct  10   FEPSAVTPRGLAPP--------GLIGNGDFGEMKRLKVATPTAPRKNLNIT---VTEPGS  58

Query  422  DNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINNLGDPF  598
             N+        +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F +NN GDPF
Sbjct  59   RNDGQS-----LDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFHLNNCGDPF  113

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            +++    HS+ FEV VL+WFA LW+IEKD+YWGY+TN GTEGNLHGILVGRE+ P GILY
Sbjct  114  LQNTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRELLPTGILY  173

Query  779  ASRESHYSVFKAARMY  826
            AS++SHYSV KAA MY
Sbjct  174  ASKDSHYSVAKAAMMY  189



>ref|XP_003607341.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES89538.1| serine decarboxylase [Medicago truncatula]
Length=452

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = +2

Query  380  NVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ  559
            N+H   +      A  +  G+ +A + +V+  Y +T+ +    +LGYP N DF+Y  L+ 
Sbjct  27   NIHEEDINRLTNIAITQCIGETDANLDAVITHYVETINKYNLRNLGYPTNQDFNYEALAP  86

Query  560  LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGI  739
            L  F +NN GDPF+ S++ ++S  FEV VLDWFA+LW+IEKD+YWGYIT  GTEGNLHGI
Sbjct  87   LLQFHLNNAGDPFLGSSFSLNSMTFEVSVLDWFAKLWEIEKDQYWGYITTGGTEGNLHGI  146

Query  740  LVGREVFPDGILYASRESHYSVFKAARMY  826
            LV RE FPDGILY S++SHYS+FK ARMY
Sbjct  147  LVAREQFPDGILYTSQDSHYSIFKIARMY  175



>sp|Q7X8D4.2|SDC3_ORYSJ RecName: Full=Serine decarboxylase 3 [Oryza sativa Japonica Group]
 emb|CAE05435.2| OSJNBa0059H15.18 [Oryza sativa Japonica Group]
 emb|CAE04954.2| OSJNBa0070D17.5 [Oryza sativa Japonica Group]
Length=446

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  497  RTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDI  676
            RT+ + GYP N +FD+G + +  +  +NN GDPF+E NYG+HS++FE+ VLDWFARLW++
Sbjct  63   RTRRNAGYPINFEFDFGPVIEFLNMRLNNAGDPFMECNYGIHSKKFEIAVLDWFARLWEL  122

Query  677  EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
             KD+YWGY+T+ GTEGN+HG+LVGRE+FP+GI+Y S +SHYS+FKAA+MY
Sbjct  123  PKDQYWGYVTSGGTEGNMHGLLVGRELFPEGIIYTSCDSHYSIFKAAKMY  172



>gb|EYU19378.1| hypothetical protein MIMGU_mgv1a006611mg [Erythranthe guttata]
Length=437

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            L++ EP  D E   D++  +  +L+ +++ L ER+ + LGY  N D     DLS    F 
Sbjct  15   LDLVEP-FDEECHVDRQRRLTKILSEFQEHLAERSNHFLGYHLNQDCSCLTDLSPFLRFH  73

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            INN+GDPF ESN G+HS++FEV VLDWFA LW+IE DEYWGY+TN GTE NL  +L+GR+
Sbjct  74   INNVGDPFKESNLGLHSKKFEVAVLDWFAELWEIENDEYWGYVTNGGTEANLQALLLGRD  133

Query  755  VFPDGILYASRESHYSVFKAARM  823
            + PDGILYAS+ESHYS+FKAAR+
Sbjct  134  LLPDGILYASKESHYSIFKAARI  156



>ref|XP_009620691.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 102/144 (71%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            + VTEP + N+        +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F 
Sbjct  46   VAVTEPGSRNDGPS-----LDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFH  100

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VL+WFA LW+IEKD+YWGY+TN GTEGNLHGILVGRE
Sbjct  101  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRE  160

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P GILYAS++SHYSV KAA MY
Sbjct  161  LLPTGILYASKDSHYSVAKAAMMY  184



>ref|XP_011082255.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=461

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSIN  580
            V EP  D E   ++  ++  ++  ++  L ER    LG+P N +   Y  LS L  ++IN
Sbjct  46   VVEP-KDEECAVERLHHLTKIVTEFQDHLRERASNQLGHPGNHNCSHYLALSTLLQYNIN  104

Query  581  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVF  760
            N+GDPF ESNYG+H+++FEV VLDWFA+LW I+KDEYWGY+TN GTEGNLHGIL+GRE+ 
Sbjct  105  NVGDPFKESNYGLHTKKFEVSVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGILMGRELL  164

Query  761  PDGILYASRESHYSVFKAARMY  826
            P+GILY S+ESHYS+ K ARMY
Sbjct  165  PNGILYTSQESHYSMLKIARMY  186



>ref|XP_009769413.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769414.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=465

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 119/196 (61%), Gaps = 23/196 (12%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLG------RNVHTTCLEVTEPDA  421
            F P+A+    + PP           ANG   + + + +       +N++     VTEP +
Sbjct  10   FEPSAVTPRGLAPP--------GLIANGDFGEMKRLKVATPTAPRKNLNVA---VTEPGS  58

Query  422  DNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINNLGDPF  598
             N         +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F +NN GDPF
Sbjct  59   RNNGPS-----LDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFHLNNCGDPF  113

Query  599  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILY  778
            +++    HS+ FEV VL+WFA LW+IEKD+YWGY+TN GTEGNLHGILVGRE+ P GILY
Sbjct  114  LQNTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRELLPTGILY  173

Query  779  ASRESHYSVFKAARMY  826
            AS++SHYSV KAA MY
Sbjct  174  ASKDSHYSVAKAAMMY  189



>ref|XP_009599698.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 102/144 (71%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            + VTEP + N+        +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F 
Sbjct  46   VAVTEPGSRNDGPS-----LDCILMNYIDTLSQRINYHIGYPVNIFYEHYASLAPLLQFH  100

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS+ FEV VL+WFA LW+IEKD+YWGY+TN GTEGNLHGILVGRE
Sbjct  101  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRE  160

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P GILYAS++SHYSV KAA MY
Sbjct  161  LLPTGILYASKDSHYSVAKAAMMY  184



>gb|AIE54278.1| aromatic amino acid decarboxylase 2 [Nicotiana tabacum]
Length=457

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 101/144 (70%), Gaps = 6/144 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  574
            + VTEP + N+        +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F 
Sbjct  46   VAVTEPGSRNDGPS-----LDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFH  100

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+++    HS  FEV VL+WFA LW+IEKD+YWGY+TN GTEGNLHGILVGRE
Sbjct  101  LNNCGDPFLQNTVDFHSEDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRE  160

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            + P GILYAS++SHYSV KAA MY
Sbjct  161  LLPTGILYASKDSHYSVAKAAMMY  184



>ref|XP_004244809.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=457

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +2

Query  464  VLARYRKTLVERTKYHLGYPYNLDFDYG-DLSQLQHFSINNLGDPFIESNYGVHSRQFEV  640
            +L  Y KTL +R KYHLG+P N+ +D+   L+ L  F +NN GDPF E+    HS+ FEV
Sbjct  60   ILDNYLKTLAQRVKYHLGFPENIFYDHHLALAPLLQFHLNNCGDPFTENPVDFHSKDFEV  119

Query  641  GVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
             VLDWFA+LW+I+KDEYWGY+T+ GTEGNLHGI +GRE+ P+GILY S++SHYSVFKAAR
Sbjct  120  AVLDWFAKLWEIDKDEYWGYVTHGGTEGNLHGIWIGRELLPNGILYTSKDSHYSVFKAAR  179

Query  821  MY  826
            +Y
Sbjct  180  LY  181



>ref|XP_003592128.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES62379.1| serine decarboxylase [Medicago truncatula]
Length=451

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  607
            +S G+ +A + +++A Y +T+ +    +LGYP N DF+Y  L+ L  F +NN GDPF+ S
Sbjct  42   KSIGETDANLDAIIAHYAQTITKYNMRNLGYPTNQDFNYEALAPLLQFHLNNAGDPFLGS  101

Query  608  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  787
            ++ ++S  FEV VLDWFA+LW+IEK+EYWGY+T  GTEGNLHGIL GRE  PDGILY S+
Sbjct  102  SFSLNSMAFEVSVLDWFAKLWEIEKNEYWGYVTTGGTEGNLHGILAGREQLPDGILYTSQ  161

Query  788  ESHYSVFKAARMY  826
            +SHYS+ K A+MY
Sbjct  162  DSHYSIAKIAKMY  174



>ref|XP_003592129.1| Serine decarboxylase [Medicago truncatula]
Length=456

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 110/185 (59%), Gaps = 30/185 (16%)
 Frame = +2

Query  344  GKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLG--  517
            G+ DK   +   N    CL +T  +      G+  A +  ++  Y  TL ++  + LG  
Sbjct  13   GEEDKERDIQENNNGHMCLAITNCN------GETHAKLDEIITHYEGTLNQKISHFLGKK  66

Query  518  ----------------------YPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQ  631
                                  YP N +FDY  L+ L HF INN GDPF+ S+YGV+S  
Sbjct  67   GWTFILMYVIARSTLMVFVKAGYPTNQNFDYDALAPLLHFHINNAGDPFMGSSYGVNSTD  126

Query  632  FEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
            FE+ VLDWFA+LW+I+K EYWGY+T  GTEGNLHGIL+GRE FPDGILY S++SHYS+FK
Sbjct  127  FEISVLDWFAKLWEIKKGEYWGYVTTGGTEGNLHGILIGREKFPDGILYTSQDSHYSIFK  186

Query  812  AARMY  826
             AR+Y
Sbjct  187  IARIY  191



>sp|P54772.1|DCHS_SOLLC RecName: Full=Histidine decarboxylase; Short=HDC; AltName: Full=TOM92 
[Solanum lycopersicum]
 emb|CAA50719.1| histidine decarboxylase [Solanum lycopersicum]
Length=413

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 5/141 (4%)
 Frame = +2

Query  410  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFSINNL  586
            E D  NE++  +   +  +L +Y +TL ER KYH+GYP N+ +++   L+ L  F +NN 
Sbjct  2    ESDIKNETSFQE---LDMILTQYLETLSERKKYHIGYPINMCYEHHATLAPLLQFHLNNC  58

Query  587  GDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVG-REVFP  763
            GDPF +     HS+ FEV VLDWFA+LW+IEKDEYWGYIT+ GTEGNLHG  +G RE+ P
Sbjct  59   GDPFTQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGFWLGRRELLP  118

Query  764  DGILYASRESHYSVFKAARMY  826
            +G LYAS++SHYS+FKAARMY
Sbjct  119  NGYLYASKDSHYSIFKAARMY  139



>gb|KHN17002.1| Histidine decarboxylase [Glycine soja]
Length=500

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  634
            M S+L   +    +R    LGYP N +F+Y  L+ L HF +NN GDPF+ S++ ++S +F
Sbjct  1    MKSLLLTMQDCTNDRLSCTLGYPTNQNFNYDTLASLLHFHLNNAGDPFLGSSFSLNSTRF  60

Query  635  EVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKA  814
            EV VLDWFA LW+IEK++YWGY+T  GTEGNLHGILVGRE  PDGILY S++SHYS+FK 
Sbjct  61   EVCVLDWFANLWEIEKNKYWGYVTTGGTEGNLHGILVGREQLPDGILYTSQDSHYSIFKI  120

Query  815  ARMY  826
            ARMY
Sbjct  121  ARMY  124


 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 2/80 (3%)
 Frame = +2

Query  593  PFIE--SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPD  766
            PF+E  S++ ++S  FEV VL+WF  LW+I+K+EYWGY+T  GTEGNLHGILVGRE  PD
Sbjct  204  PFVEQGSSFSLNSTTFEVCVLNWFTNLWEIKKNEYWGYVTTGGTEGNLHGILVGREQLPD  263

Query  767  GILYASRESHYSVFKAARMY  826
            GILY S++SHYS+FK ARMY
Sbjct  264  GILYTSQDSHYSIFKIARMY  283



>gb|EYU29207.1| hypothetical protein MIMGU_mgv1a026642mg, partial [Erythranthe 
guttata]
Length=377

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +2

Query  518  YPYNLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYW  694
            YP NL+  +  DLS L  F +NN+GDPF ESN+G+HS++FEV VLDWFA LW+IE DEYW
Sbjct  1    YPGNLNCKHLVDLSPLLSFLLNNVGDPFKESNFGLHSKKFEVAVLDWFAELWEIENDEYW  60

Query  695  GYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            GY+TN GTEGNLHG+L+GR++ PDGILY S+ESHYS+FK AR+Y
Sbjct  61   GYVTNGGTEGNLHGMLLGRDLLPDGILYTSKESHYSIFKGARIY  104



>ref|XP_009601849.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=408

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +2

Query  494  ERTKYHLGYPYNLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  670
            E   ++LGYP N+ +++   L+ L  F +NN GDPF E+    HS+ FEV VLDWFA+LW
Sbjct  22   ETLNHNLGYPINVCYEHHAALAPLLQFYLNNCGDPFTENTIDFHSKDFEVAVLDWFAQLW  81

Query  671  DIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            +IEKDEYWGYITN GTEGNLHG+L+GRE+ P GI+YAS++SHYSVFKAARMY
Sbjct  82   EIEKDEYWGYITNGGTEGNLHGLLIGRELHPTGIIYASKDSHYSVFKAARMY  133



>ref|WP_026730962.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=363

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            +  + K L +R ++  GYPYNL +DY  L  L +F++NNLGDP++ESNY + SR++E  V
Sbjct  1    MLSFLKELEKRREFATGYPYNLSYDYTPLLNLFNFTLNNLGDPYVESNYAIDSRKYEQEV  60

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            LD+FA L+ +  D+ WGYIT+CGTEGNL+GI +GREV+PDGILY+S +SHYSV KAAR++
Sbjct  61   LDFFANLYKLPDDDSWGYITSCGTEGNLYGIWLGREVYPDGILYSSEDSHYSVAKAARLF  120



>ref|XP_003619923.1| L-tyrosine decarboxylase [Medicago truncatula]
Length=384

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            EL  D  F+ +AI+ +PVPP V  + +D   A   G  +KREIVLGRN+HTTCLEVTEP+
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVADNGIDKEEAKINGGKEKREIVLGRNIHTTCLEVTEPE  77

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLS  556
            AD+E TGD++A+MASVLARYRK+L ERTKYHLGYPYNLDFDYG LS
Sbjct  78   ADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFDYGILS  123



>gb|EEE60437.1| hypothetical protein OsJ_13648 [Oryza sativa Japonica Group]
Length=334

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  575  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGRE  754
            +NN GDPF+E NYG+HS++FE+ VLDWFARLW++ KD+YWGY+T+ GTEGN+HG+LVGRE
Sbjct  3    LNNAGDPFMECNYGIHSKKFEIAVLDWFARLWELPKDQYWGYVTSGGTEGNMHGLLVGRE  62

Query  755  VFPDGILYASRESHYSVFKAARMY  826
            +FP+GI+Y S +SHYS+FKAA+MY
Sbjct  63   LFPEGIIYTSCDSHYSIFKAAKMY  86



>ref|WP_045055559.1| histidine decarboxylase [Chroococcales cyanobacterium CENA595]
 gb|KJH70970.1| histidine decarboxylase [Chroococcales cyanobacterium CENA595]
Length=373

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  634
            +A  L+ + + L +RT  H GYPYNL  DY  L++  +F +NN GDPF+E ++G+HSRQF
Sbjct  6    IADELSIFLQQLEQRTALHAGYPYNLSCDYSTLTKFFNFLLNNAGDPFVEPDFGLHSRQF  65

Query  635  EVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKA  814
            E  VL +FA ++ IE + +WGY+T+ GTEGN +GI +GREV+P+G+LY+S++SHYS+ KA
Sbjct  66   EQQVLAFFADIYRIEPENFWGYVTSGGTEGNFYGIFLGREVYPNGVLYSSQDSHYSIAKA  125

Query  815  ARMY  826
            AR+Y
Sbjct  126  ARLY  129



>ref|WP_015112001.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
 gb|AFY41767.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
Length=383

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            LA + + + +R+++H GYPYNL  D+  +++   F +NN GDP+IE N+G+HSR+FE  V
Sbjct  9    LAIFWQQIEQRSQFHAGYPYNLSCDFTCINKFFSFLLNNAGDPYIEPNFGLHSRKFEQEV  68

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            L +FA+L+ I ++E+WGY+T  GTEGNL+GIL+ RE++PDGILY+S++SHYS+ KAAR++
Sbjct  69   LSFFAQLYKIPENEFWGYVTAGGTEGNLYGILLAREIYPDGILYSSQDSHYSIAKAARLF  128



>ref|WP_016870188.1| histidine decarboxylase [Fischerella muscicola]
Length=380

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L R ++ + E  K+ +GYP NLDFDY  L     +++NN GDPF+E N+ +HS++FE   
Sbjct  14   LKRLQQHIAECAKHSIGYPANLDFDYTLLLPFFQYNLNNAGDPFVEGNFALHSKEFERQS  73

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            L+WFA+L+++E  EYWGY+T+ GTEGN++G+ +GRE++PD ILY+SR++HYSV KAAR+
Sbjct  74   LNWFAQLYELE--EYWGYLTSGGTEGNIYGMFLGRELYPDAILYSSRDTHYSVAKAARL  130



>ref|WP_044451446.1| histidine decarboxylase, partial [Mastigocladus laminosus]
 gb|KIY10883.1| histidine decarboxylase, partial [Mastigocladus laminosus UU774]
Length=227

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = +2

Query  464  VLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVG  643
            +L R ++ L + TK  +GYP NLDFDY  L     + +NN+GDPF+E N+ +HS++ E  
Sbjct  13   ILKRLQQHLAKSTKLSIGYPANLDFDYALLLPFFQYYLNNVGDPFVEGNFALHSKELERQ  72

Query  644  VLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
             + WFA+L+++E  EYWGY+T+ GTEGNL+GI +GRE+ PD ILY+S ++HYSV KAAR+
Sbjct  73   CISWFAQLYELE--EYWGYLTSGGTEGNLYGIFLGRELNPDAILYSSSDTHYSVAKAARL  130



>ref|WP_017312078.1| histidine decarboxylase [Fischerella sp. PCC 9339]
Length=391

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = +2

Query  464  VLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVG  643
            +L R ++ L + TK  +GYP NLDFDY  L     + +NN+GDPF+E N+ +HS++FE  
Sbjct  13   ILKRLQQHLAKSTKLSIGYPANLDFDYALLLPFFQYYLNNVGDPFVEGNFALHSKEFERQ  72

Query  644  VLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
             + WFA+L+++E  EYWGY+T+ GTEGNL+GI +GRE+ PD ILY+S ++HYSV KAAR+
Sbjct  73   CISWFAQLYELE--EYWGYLTSGGTEGNLYGIFLGRELNPDAILYSSSDTHYSVAKAARL  130



>ref|WP_009455225.1| histidine decarboxylase [Fischerella sp. JSC-11]
 gb|EHC17883.1| Histidine decarboxylase [Fischerella sp. JSC-11]
Length=380

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 91/119 (76%), Gaps = 2/119 (2%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L   ++ + E  K  +GYP NLDFDY  L     +++NN+GDPF+E N+ +HS++FE   
Sbjct  14   LKLLQQHIAECAKLSIGYPVNLDFDYTLLLPFLQYNLNNVGDPFVEGNFALHSKEFERQS  73

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            L+WFA+L+++E  EYWGY+T+ GTEGNL+G+ +GRE++PD +LY+SR++HYSV KAAR+
Sbjct  74   LNWFAQLYELE--EYWGYLTSGGTEGNLYGMFLGRELYPDAVLYSSRDTHYSVAKAARL  130



>ref|WP_026721610.1| histidine decarboxylase [Fischerella sp. PCC 9431]
Length=391

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 91/119 (76%), Gaps = 2/119 (2%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L + ++ + + TK  +GYP NLDFDY  L     + +NN+GDPF+E N+ +HS++FE   
Sbjct  14   LKKLQEHIAKCTKQSIGYPANLDFDYTVLLPFFQYYLNNVGDPFVEGNFALHSKEFERQC  73

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            ++WFA+L+++E  EYWGY+T+ GTEGNL+GI +GRE++PD ILY+S ++HYSV KAAR+
Sbjct  74   INWFAQLYELE--EYWGYLTSGGTEGNLYGIFLGRELYPDAILYSSSDTHYSVAKAARL  130



>gb|EYU24758.1| hypothetical protein MIMGU_mgv1a026373mg, partial [Erythranthe 
guttata]
Length=282

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMAS-VLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  571
            L + EP  D E   D+   + + +++ +++ L ER+ + LGYP NL+ ++  DLS L  F
Sbjct  17   LALIEPH-DEECVVDRHRCLVTKIMSEFQEYLNERSNHLLGYPSNLNCNHLMDLSPLLGF  75

Query  572  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGR  751
             +NN+GDPF ESN+G+HS++ EV  LDWFA+LW IEKDEYWGY+TN GTE NLHG+L+GR
Sbjct  76   LMNNVGDPFQESNFGLHSKKIEVAGLDWFAQLWKIEKDEYWGYVTNGGTECNLHGMLIGR  135

Query  752  EVFPDGILYASRESHYSV  805
             + PDG  Y + +++++ 
Sbjct  136  NLLPDG--YCTHQTNHTT  151



>ref|WP_012408195.1| histidine decarboxylase [Nostoc punctiforme]
 gb|ACC80176.1| Pyridoxal-dependent decarboxylase [Nostoc punctiforme PCC 73102]
Length=384

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  634
            +A  LA +   + +R+++H GYPYNL  DY  + +  +  +NN GDP+IE ++G+HSR+F
Sbjct  5    VAKELADFLLQIEQRSQFHAGYPYNLSCDYSAIGKFFNHLLNNAGDPYIEPDFGLHSRKF  64

Query  635  EVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKA  814
            E  VL +FA L+ I ++++WGY+T  GTEGNL+GI + RE++P+GILY+S++SHYS+ KA
Sbjct  65   EQEVLSFFAHLYKIPENQFWGYVTAGGTEGNLYGIFLAREIYPNGILYSSQDSHYSIPKA  124

Query  815  ARMY  826
            A+++
Sbjct  125  AKLF  128



>dbj|BAH97114.1| amino acid decarboxylase [Naegleria fowleri]
Length=307

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 74/99 (75%), Gaps = 12/99 (12%)
 Frame = +2

Query  566  HFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDI------------EKDEYWGYITN  709
             + I+NLGDPF+ESNYGVHSR FE  VL +FA+LW I              DEYWGY+TN
Sbjct  1    RYGIDNLGDPFVESNYGVHSRAFEQSVLQFFAKLWKIGPCPDEANAQNWSHDEYWGYVTN  60

Query  710  CGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            CGTEGNL+GIL+GRE FPD +L +SRESHYSV KAA++Y
Sbjct  61   CGTEGNLYGILLGREQFPDAVLVSSRESHYSVSKAAKLY  99



>ref|WP_016859640.1| histidine decarboxylase [Fischerella muscicola]
Length=391

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = +2

Query  464  VLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVG  643
            +L R ++ + + TK  +GYP NL+FDY  L     + +NN GDPFI+ N+ ++S++FE  
Sbjct  13   ILKRLQQHIAKCTKLSIGYPANLNFDYTLLLPFFQYYLNNAGDPFIDGNFALNSKEFERQ  72

Query  644  VLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
             ++WFA+L+++E  EYWGY+TN GTEGNL+ I +GRE+ PD ILY+SR++HYS+ KAAR+
Sbjct  73   CINWFAQLYELE--EYWGYLTNGGTEGNLYSIFLGRELNPDAILYSSRDTHYSIAKAARL  130



>ref|XP_002454879.1| hypothetical protein SORBIDRAFT_03g000687 [Sorghum bicolor]
 gb|EER99998.1| hypothetical protein SORBIDRAFT_03g000687, partial [Sorghum bicolor]
Length=156

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ-LQHFSIN  580
            V EP AD E+  +++A +A +LA +R+ L +R+ +HLGYPYNLDFD+  L+  LQ   IN
Sbjct  60   VQEPPADEEALAERQAEVARLLAGFRRHLEDRSAHHLGYPYNLDFDFASLAPFLQGLCIN  119

Query  581  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  691
            NLGDPF+ESNYGVHSR  EV VLDWFARLWD+   +Y
Sbjct  120  NLGDPFVESNYGVHSRPLEVAVLDWFARLWDLVPGDY  156



>gb|KEH26770.1| histidine decarboxylase-like protein [Medicago truncatula]
Length=122

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  418
            EL  D  F+ +AI+ +PVPP V  + +D   A   G  +KREIVLGRN+HTTCLEVTEP+
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVADNGIDKEEAKINGGKEKREIVLGRNIHTTCLEVTEPE  77

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLG  517
            AD+E TGD++A+MASVLARYRK+L ERTKYHLG
Sbjct  78   ADDEITGDRDAHMASVLARYRKSLTERTKYHLG  110



>ref|XP_002444261.1| hypothetical protein SORBIDRAFT_07g019126 [Sorghum bicolor]
 gb|EES13756.1| hypothetical protein SORBIDRAFT_07g019126, partial [Sorghum bicolor]
Length=156

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ-LQHFSIN  580
            V EP A+ E+  +++A +A +LA +R+ L +R+ +HLGYPYNLDFD+  L+  LQ   IN
Sbjct  60   VQEPPANEEALAERQAEVARLLAGFRRHLEDRSAHHLGYPYNLDFDFASLAPFLQGLCIN  119

Query  581  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  691
            NLGDPF+ESNYGVHSR  EV VLDWFARLWD+   +Y
Sbjct  120  NLGDPFVESNYGVHSRPLEVAVLDWFARLWDLVPGDY  156



>ref|WP_041885112.1| histidine decarboxylase [Pedobacter sp. NL19]
 gb|KIO75424.1| histidine decarboxylase [Pedobacter sp. NL19]
Length=380

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L+ Y K   ER+KY +GYP   DFDY +L  L    +NN+GDP++ES Y ++SR  E+ V
Sbjct  13   LSTYMKMAEERSKYFIGYPIAQDFDYSELYPLLRLPLNNVGDPWVESTYDLNSRSLELEV  72

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            L++FA L++     +WGY+TN G+EGNL+G+ V RE++P+GI+Y S  +HYSV K  ++
Sbjct  73   LEFFAELFNAPAKNWWGYVTNGGSEGNLYGLYVARELYPNGIVYYSEATHYSVQKNIQL  131



>gb|ELU52247.1| PLP-dependent enzyme, glutamate decarboxylase [Vibrio campbellii 
CAIM 519 = NBRC 15631]
Length=230

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L R+ + + +++   +GYP + DFDY  L++L ++ +NNLGDPF +S + V SR+FE  V
Sbjct  11   LDRFIQDINDKSTSFMGYPISTDFDYQQLTELINYPLNNLGDPFAKSTWQVDSREFECEV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
            +++FA+L+   +D++WGY+TN  TE NL+ + + RE++P GI Y S+E+HYSV K
Sbjct  71   IEFFAKLFRAPEDDWWGYVTNGSTEANLYALYLARELYPKGICYFSKETHYSVAK  125



>ref|WP_036288070.1| histidine decarboxylase, partial [Methylocystis sp. ATCC 49242]
Length=376

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L R    L  R    +GYP N  FDY +L +   FS+NN+GDPF ++ YG+++ +FE  V
Sbjct  21   LDRLHDELQARAATMIGYPTNFCFDYPELERFHAFSLNNVGDPFDDNLYGLNTHEFEREV  80

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
            +++FA+L+ I+K  YWGY+TN GTEGN++G+ + RE+ P+G++Y S ++HYSV K
Sbjct  81   IEFFAQLYHIQKPNYWGYVTNGGTEGNMYGLYLAREICPNGVVYFSEDTHYSVMK  135



>ref|WP_013663956.1| histidine decarboxylase [Sphingobacterium sp. 21]
 gb|ADZ77228.1| Histidine decarboxylase [Sphingobacterium sp. 21]
Length=380

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L  Y +   ER  Y LGYP   DFDY DL  L    +NN+GDP +ES Y ++SR  E  V
Sbjct  11   LTNYMQRAEERAAYFLGYPIARDFDYSDLYPLLKLPLNNIGDPLVESTYDLNSRSLEQEV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            L +FA L+    D +WGY+TN G+EGNL+G+ V RE++P+GI+Y S  +HYSV K  ++
Sbjct  71   LAFFADLFRAPADNWWGYVTNGGSEGNLYGLYVARELYPNGIVYYSEATHYSVQKNIQL  129



>ref|WP_038863593.1| histidine decarboxylase [Vibrio campbellii]
Length=386

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L R+ + + +++   +GYP + DFDY  L++L ++ +NNLGDPF +S + V SR+FE  V
Sbjct  11   LDRFIQDINDKSTSFMGYPISTDFDYQQLTELINYPLNNLGDPFAKSTWQVDSREFECEV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
            +++FA+L+   +D++WGY+TN  TE NL+ + + RE++P GI Y S+E+HYSV K
Sbjct  71   IEFFAKLFRAPEDDWWGYVTNGSTEANLYALYLARELYPKGICYFSKETHYSVAK  125



>ref|WP_037437993.1| histidine decarboxylase [Sphingobacterium antarcticum]
 gb|KEQ31557.1| histidine decarboxylase [Sphingobacterium antarcticus 4BY]
Length=379

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            LA  +K L    +  LGYP + DF+Y +L++   F INNLGDPFIES Y V +R  EV V
Sbjct  14   LAELKKKLTADAELMLGYPVSKDFNYDELAEFLKFPINNLGDPFIESTYQVGTRGLEVEV  73

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
            L++FA L+    + +WGY+TN G+EGNL+G+ + RE+ P G++Y S+ +HYSV K
Sbjct  74   LEFFAALFRAPVNNWWGYVTNGGSEGNLYGLYLAREIHPKGMVYFSQATHYSVQK  128



>ref|XP_005840580.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
 gb|EKX53600.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
Length=338

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +2

Query  536  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  715
            ++Y D+ +   F +NN+GDP+  SNY ++S + E  VLD+FA+ W +E +EYWGYIT+ G
Sbjct  3    YNYSDMHETMKFHLNNVGDPYRGSNYRINSMEIEKDVLDFFAKHWHVE-EEYWGYITSSG  61

Query  716  TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMY  826
            TEGN+ G+ +GRE FP+GILY S++SHYS+FK AR++
Sbjct  62   TEGNMEGLYIGRERFPEGILYLSKDSHYSIFKIARLF  98



>ref|WP_033002296.1| histidine decarboxylase, partial [Vibrio campbellii]
Length=376

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L R+ + + +++   +GYP + DFDY  L++L ++ +NNLGDPF +S + V SR+FE  V
Sbjct  1    LDRFIQDINDKSTSFMGYPISTDFDYQQLTELINYPLNNLGDPFAKSTWQVDSREFECEV  60

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
            +++FA+L+   +D++WGY+TN  TE NL+ + + RE++P GI Y S+E+HYSV K
Sbjct  61   IEFFAKLFRAPEDDWWGYVTNGSTEANLYALYLARELYPKGICYFSKETHYSVAK  115



>gb|ERB65930.1| hypothetical protein N779_07565 [Vibrio coralliilyticus OCN008]
Length=150

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L  + K  ++     LGYP   D+DY DLS    FSINN+GD    SNY +++ QFE  V
Sbjct  11   LREFYKVCLDSQHQMLGYPVATDYDYQDLSSFFQFSINNVGDWAETSNYPMNTFQFEQDV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
            +++F +L+    ++ WGY+TN GTEGN++G  + RE FPDG++Y S+++HYSV K  R
Sbjct  71   VEYFCQLFHTSTEKAWGYVTNGGTEGNMYGCYLARERFPDGVVYFSKDTHYSVMKIVR  128



>gb|KFF73912.1| histidine decarboxylase [Chryseobacterium sp. P1-3]
Length=383

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 84/125 (67%), Gaps = 7/125 (6%)
 Frame = +2

Query  470  ARYRKTLV-------ERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  628
            AR +K L+       E++ + +GYP+  DFDY +L  L  + I N+GDPFIESNY V+S 
Sbjct  3    AREQKKLINFINVIKEKSTFSIGYPFARDFDYTELYDLFQYPIANVGDPFIESNYAVNSF  62

Query  629  QFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF  808
            + E  V+ +FA L+   KD Y GY+T+ G+EGNL+G+ + RE++P+ I+Y S E+HYS+ 
Sbjct  63   EIEREVIQFFAGLFRAPKDNYSGYVTSGGSEGNLYGLYIAREIYPEAIVYHSSEAHYSIT  122

Query  809  KAARM  823
            K  R+
Sbjct  123  KNIRL  127



>ref|WP_014680343.1| histidine decarboxylase [Solitalea canadensis]
 gb|AFD07116.1| PLP-dependent enzyme, glutamate decarboxylase [Solitalea canadensis 
DSM 3403]
Length=388

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L  Y +   ER K+ +GYP   DFDY +L  L    +NN+GDP ++S Y ++SR  E  V
Sbjct  13   LHDYMQKAEERAKHFIGYPIARDFDYSELYPLLSLPLNNVGDPLVDSTYDLNSRSLEQEV  72

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            L +FA L++  ++ +WGY+TN G+EGNL+G+ V RE+FP+GI+Y S  +HYSV K  ++
Sbjct  73   LAFFAELFNAPENNWWGYVTNGGSEGNLYGLYVARELFPNGIVYYSEATHYSVQKNIQL  131



>ref|WP_041881750.1| histidine decarboxylase [Pedobacter sp. NL19]
 gb|KIO77140.1| histidine decarboxylase [Pedobacter sp. NL19]
Length=379

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = +2

Query  458  ASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  637
            A+ L    + L+  +   LGYP + DFDY +L+   +F INNLGDPF+ S Y + +R+ E
Sbjct  11   AAKLKDLMERLIADSALMLGYPVSKDFDYAELAGFLNFPINNLGDPFVASTYNIGTREME  70

Query  638  VGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
              VL++FA L+   ++ +WGY+TN G+EGNL+G+ + RE+ P G++Y S+ +HYSV K
Sbjct  71   REVLEFFAELFRAPQNNWWGYVTNGGSEGNLYGLYLAREIHPKGMVYFSQATHYSVQK  128



>ref|WP_014680621.1| histidine decarboxylase [Solitalea canadensis]
 gb|AFD07394.1| PLP-dependent enzyme, glutamate decarboxylase [Solitalea canadensis 
DSM 3403]
Length=376

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L   R+ + E ++  LGYP + DFDY +L +L  + +NN+GDPF +  Y V SR+ E  V
Sbjct  12   LEALRQKIKENSQNSLGYPVSKDFDYSELFELLKYPVNNIGDPFADCTYSVDSREMEREV  71

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
            L++FA ++  +K+++WGY+TN G+EGN++G+ + RE+ P G++Y S  +HYSV K
Sbjct  72   LEFFAEVFRAQKNDWWGYVTNGGSEGNMYGLYMARELHPKGMVYYSAATHYSVHK  126



>ref|WP_026731780.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=364

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY-GVHSRQ  631
            M ++L  + + + ++ +++ GY  NL FDY  L     ++INN GDPFI   +   H+++
Sbjct  1    MDTLLNDFLEQMTQQVEFNAGYSENLAFDYSRLWHFLRYNINNAGDPFIYDKFVKSHAKE  60

Query  632  FEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
            FE   L WFA+L++++   +WGY+T  G+EGN++G+ +GRE +PD + YAS++SHYS+ K
Sbjct  61   FEQKSLQWFAQLYELQN--HWGYVTTGGSEGNIYGLFLGRERYPDSVFYASKDSHYSIVK  118

Query  812  AARM  823
            AAR+
Sbjct  119  AARL  122



>ref|WP_019275400.1| histidine decarboxylase [Vibrio coralliilyticus]
Length=384

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L  + K  ++     LGYP   D+DY DLS    FSINN+GD    SNY +++ QFE  V
Sbjct  11   LREFYKVCLDSQHQMLGYPVATDYDYQDLSSFFQFSINNIGDWAETSNYPMNTFQFEQDV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
            +++F +L+    ++ WGY+TN GTEGN++G  + RE FPDG++Y S+++HYSV K  R
Sbjct  71   VEYFCQLFHTSTEKAWGYVTNGGTEGNMYGCYLARERFPDGVVYFSKDTHYSVMKIVR  128



>ref|WP_006960325.1| MULTISPECIES: histidine decarboxylase [Vibrio]
 gb|EEX32996.1| histidine decarboxylase [Vibrio coralliilyticus ATCC BAA-450]
 gb|KFI13386.1| histidine decarboxylase [Vibrio sp. B183]
Length=384

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L  + K  ++     LGYP   D+DY DLS    FSINN+GD    SNY +++ QFE  V
Sbjct  11   LREFYKVCLDSQHQMLGYPVATDYDYQDLSSFFQFSINNVGDWAETSNYPMNTFQFEQDV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
            +++F +L+    ++ WGY+TN GTEGN++G  + RE FPDG++Y S+++HYSV K  R
Sbjct  71   VEYFCQLFHTSTEKAWGYVTNGGTEGNMYGCYLARERFPDGVVYFSKDTHYSVMKIVR  128



>ref|WP_045985226.1| histidine decarboxylase [Vibrio coralliilyticus]
 gb|KJY67966.1| histidine decarboxylase [Vibrio coralliilyticus]
 gb|KJY76774.1| histidine decarboxylase [Vibrio coralliilyticus]
Length=384

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L  + K  ++     LGYP   D+DY DLS    FSINN+GD    SNY +++ QFE  V
Sbjct  11   LREFYKVCLDSQHQMLGYPVATDYDYQDLSSFFQFSINNVGDWAETSNYPMNTFQFEQDV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
            +++F +L+    ++ WGY+TN GTEGN++G  + RE FPDG++Y S+++HYSV K  R
Sbjct  71   VEYFCQLFHTSTEKAWGYVTNGGTEGNMYGCYLARERFPDGVVYFSKDTHYSVMKIVR  128



>ref|WP_043010788.1| histidine decarboxylase [Vibrio coralliilyticus]
 gb|AIW21915.1| histidine decarboxylase [Vibrio coralliilyticus]
Length=384

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L  + K  ++     LGYP   D+DY DLS    FSINN+GD    SNY +++ QFE  V
Sbjct  11   LREFYKVCLDSQHQMLGYPVATDYDYQDLSSFFQFSINNVGDWAETSNYPMNTFQFEQDV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
            +++F +L+    ++ WGY+TN GTEGN++G  + RE FPDG++Y S+++HYSV K  R
Sbjct  71   VEYFCQLFHTSTEKAWGYVTNGGTEGNMYGCYLARERFPDGVVYFSKDTHYSVMKIVR  128



>ref|WP_018151708.1| hypothetical protein [Leeia oryzae]
Length=370

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +2

Query  482  KTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA  661
            + L E +++ LGYP   D DY +L +   F INN+GDPF +S Y + +R+ E  V+ +FA
Sbjct  15   QNLSENSQHFLGYPCANDLDYENLFRFLQFPINNVGDPFQDSTYRLATREIEQEVVHFFA  74

Query  662  RLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
             L+   +D+YWGY+TN GTEGNL+G+ + RE++P+G++Y S E+HYSV K
Sbjct  75   DLFRAPQDDYWGYVTNGGTEGNLYGLYLARELYPNGVVYFSEETHYSVAK  124



>ref|WP_042556656.1| histidine decarboxylase [Pseudomonas fulva]
Length=392

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = +2

Query  461  SVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  640
            S L R+ +  V    +++GYP + DFDY  + +   FSINN GD    SNY ++S  FE 
Sbjct  9    SRLERFWQHCVTNQYFNIGYPESADFDYSQIHRFLQFSINNCGDWNEYSNYLLNSFDFEK  68

Query  641  GVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
             V+ +FA L+DI ++  WGY+TN GTEGN+ G  + RE+FPDG LY S+++HYSV K  +
Sbjct  69   DVMTYFAELFDIARENSWGYVTNGGTEGNMFGCYLARELFPDGTLYYSKDTHYSVAKIVK  128

Query  821  M  823
            +
Sbjct  129  L  129



>ref|WP_004737502.1| histidine decarboxylase [Vibrio splendidus]
 gb|EGU45031.1| Histidine decarboxylase [Vibrio splendidus ATCC 33789]
Length=373

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = +2

Query  449  AYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  628
            A+    L  + K + ++    +GYP + DF+Y  L +L +F +NNLGDPF +S + V SR
Sbjct  5    AHQQEKLKIFIKDIHKKATSFMGYPISTDFNYQQLKELINFPLNNLGDPFAKSTWQVDSR  64

Query  629  QFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF  808
            +FE  V+++FA+L    + ++WGY+TN  TE NL+ + + RE++P+GI Y S+E+HYSV 
Sbjct  65   EFECEVIEFFAKLLRAPEKDWWGYVTNGSTEANLYALYLARELYPNGICYFSKETHYSVA  124

Query  809  K  811
            K
Sbjct  125  K  125



>ref|WP_040121251.1| histidine decarboxylase [Vibrio coralliilyticus]
 gb|AIS56626.1| histidine decarboxylase [Vibrio coralliilyticus]
Length=384

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L  + K  ++     LGYP   D+DY DLS    FSINN+GD    SNY +++ QFE  V
Sbjct  11   LREFFKVCLDSQHQMLGYPVATDYDYQDLSSFFQFSINNVGDWAETSNYPMNTFQFEQDV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAAR  820
            +++F +L+    ++ WGY+TN GTEGN++G  + RE FPDG++Y S+++HYSV K  R
Sbjct  71   VEYFCQLFHTSTEKAWGYVTNGGTEGNMYGCYLARERFPDGVVYFSKDTHYSVMKIVR  128



>ref|WP_029274788.1| histidine decarboxylase [Pedobacter borealis]
Length=377

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +2

Query  494  ERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWD  673
            ++T   LGYP + DFDY  LS    + +NNLGDPF+ S YGV SR+ E  V+ +FA L+ 
Sbjct  23   KQTDLFLGYPVSKDFDYQSLSDFLKYPMNNLGDPFVTSTYGVGSRELEKEVVQFFAELFR  82

Query  674  IEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
               D +WGY+TN G+EGNL+G+ + RE+ P G++Y S  +HYSV K
Sbjct  83   APADNWWGYVTNGGSEGNLYGLYLARELHPKGMVYYSEATHYSVQK  128



>ref|WP_026362388.1| histidine decarboxylase [Geopsychrobacter electrodiphilus]
Length=360

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +2

Query  488  LVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARL  667
            L ERT   LGYP   DFDY  L Q     +NN+GDPF  S Y V +R+FE  VL++ ARL
Sbjct  8    LSERTDQFLGYPVAKDFDYQHLVQFLDLPLNNIGDPFAPSTYQVDTREFEREVLEFSARL  67

Query  668  WDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
               E++ +WGY+TN G+EGNL+G+ + RE+FP  ++Y S  +HYSV K
Sbjct  68   LRAEENSWWGYVTNGGSEGNLYGLYLARELFPKAMVYFSETTHYSVSK  115



>gb|KJG12110.1| histidine decarboxylase, partial [Raoultella planticola]
Length=153

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  467  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  646
            L  +    V+   +++GYP + DFDY  L +   FSINN GD     NY ++S  FE  V
Sbjct  11   LDSFWSYCVKNQYFNIGYPESADFDYTILERFMRFSINNCGDWGEYCNYLLNSFDFEKEV  70

Query  647  LDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            +++FA+L+ I  +E WGY+TN GTEGN+ G  +GRE+FP+G LY S+++HYSV K  ++
Sbjct  71   MEYFAQLFKIPFEESWGYVTNGGTEGNMFGCYLGREIFPNGTLYYSKDTHYSVAKIVKL  129



>ref|WP_039472909.1| histidine decarboxylase [Pedobacter kyungheensis]
 gb|KIA95404.1| histidine decarboxylase [Pedobacter kyungheensis]
Length=377

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 81/127 (64%), Gaps = 0/127 (0%)
 Frame = +2

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  610
            ++G+  A     L+   + +  +T   LGYP   DFDY +L+    + +NNLGDPF+ S 
Sbjct  2    TSGNLSATDQHTLSDLLEKVKNQTDLFLGYPVAKDFDYQELTDFLKYPMNNLGDPFVTST  61

Query  611  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRE  790
            YGV SR+ E  V+ +FA L+   +D +WGY+TN G+EGNL+G+ + RE+ P G++Y S  
Sbjct  62   YGVGSRELEKEVVAFFANLFRAPEDNWWGYVTNGGSEGNLYGLYLARELHPKGMVYYSEA  121

Query  791  SHYSVFK  811
            +HYSV K
Sbjct  122  THYSVQK  128



>ref|WP_009963501.1| histidine decarboxylase [Verrucomicrobium spinosum]
Length=395

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = +2

Query  509  HLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDE  688
            ++GYP N DFDY DL     +SINN+GDPF  SNY ++++ FE  V+  FAR+     + 
Sbjct  38   NIGYPCNQDFDYEDLFPFLSYSINNVGDPFGSSNYRLNTQDFEREVVTEFARMTHAPANG  97

Query  689  YWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            +WGY+T  GTEGN++G+ V RE+FPDGI Y S ++HYSV K  R+
Sbjct  98   WWGYVTAGGTEGNMYGLYVARELFPDGICYFSEDTHYSVAKILRL  142



>ref|WP_038170807.1| histidine decarboxylase [Verrucomicrobium sp. BvORR106]
Length=395

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = +2

Query  509  HLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDE  688
            ++GYP N +FD+ DL     +SINN+GDPF  +NY ++++ FE  VL  FARL     D 
Sbjct  38   NIGYPCNQNFDFEDLFPFLSYSINNVGDPFGSTNYRLNTQDFERDVLAEFARLTHAPVDG  97

Query  689  YWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            +WGY+T  GTEGN++G+ V RE+FPDGI Y S ++HYSV K  R+
Sbjct  98   WWGYVTAGGTEGNMYGLYVARELFPDGICYFSEDTHYSVAKILRL  142



>ref|WP_025146293.1| histidine decarboxylase [Sphingobacterium sp. H1ai]
Length=377

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +2

Query  497  RTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDI  676
            +T+  LGYP + DFDY  L+    + +NNLGDPF+ S YGV SR+ E  V+ +FA L+  
Sbjct  24   QTELFLGYPVSKDFDYQALADFLKYPMNNLGDPFVTSTYGVGSRELEKEVVQFFAELFRA  83

Query  677  EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFK  811
              D +WGY+TN G+EGNL+G+ + RE+ P G++Y S  +HYSV K
Sbjct  84   PADNWWGYVTNGGSEGNLYGLYLARELHPKGMVYYSEATHYSVQK  128



>ref|XP_008620940.1| histidine decarboxylase [Saprolegnia diclina VS20]
 gb|EQC25649.1| histidine decarboxylase [Saprolegnia diclina VS20]
Length=430

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 87/138 (63%), Gaps = 4/138 (3%)
 Frame = +2

Query  410  EPDADNEST-GDKEAYMASVLARYR---KTLVERTKYHLGYPYNLDFDYGDLSQLQHFSI  577
            + D D  ST GD     A+  AR +   +T+ ER+++ +G+P   D+DY  L     F +
Sbjct  48   DSDTDASSTDGDALCLPAADAARLQALYETVSERSEHLVGFPSCKDWDYSALYPFLSFPM  107

Query  578  NNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGILVGREV  757
            NN+GDP+IES   V +R  E  VL +FA L     D+ WGY+TN GTEGNL+G+ + RE+
Sbjct  108  NNVGDPYIESISKVSTRDCERDVLSFFASLLRAPVDDVWGYVTNGGTEGNLYGMYLAREL  167

Query  758  FPDGILYASRESHYSVFK  811
            +P+GI+Y S+ +HYSV K
Sbjct  168  YPNGIVYYSQSTHYSVVK  185



>ref|WP_045958062.1| histidine decarboxylase [Xenorhabdus poinarii]
 emb|CDG20727.1| Histidine decarboxylase [Xenorhabdus poinarii G6]
Length=384

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +2

Query  488  LVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARL  667
             V+   +++GYP + DFDY  L +   FSINN GD   E NY ++S +FE  V+ +FA L
Sbjct  18   CVKNQYFNIGYPESSDFDYSYLQRFMQFSINNCGDWGAECNYLLNSFEFEKEVMQYFAEL  77

Query  668  WDIEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  823
            + I  ++ WGY+TN GTEGN+ G  +GRE+FPDG LY S+++HYSV K  ++
Sbjct  78   FKIPFEDSWGYVTNGGTEGNMFGCYLGRELFPDGTLYYSKDTHYSVAKIVKL  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1779792308916