BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2211

Length=802
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614536.1|  PREDICTED: uncharacterized protein LOC104107438    359   8e-120   Nicotiana tomentosiformis
ref|XP_006339420.1|  PREDICTED: uncharacterized protein LOC102603324    365   2e-119   Solanum tuberosum [potatoes]
ref|XP_006600321.1|  PREDICTED: uncharacterized protein LOC100807...    364   1e-118   Glycine max [soybeans]
gb|KHN03032.1|  Hypothetical protein glysoja_009898                     363   1e-118   Glycine soja [wild soybean]
ref|XP_006600322.1|  PREDICTED: uncharacterized protein LOC100807...    364   1e-118   Glycine max [soybeans]
gb|KHN03427.1|  Hypothetical protein glysoja_004453                     364   1e-118   Glycine soja [wild soybean]
ref|XP_003529600.1|  PREDICTED: uncharacterized protein LOC100798...    364   2e-118   
ref|XP_006584056.1|  PREDICTED: uncharacterized protein LOC100798...    363   2e-118   Glycine max [soybeans]
ref|XP_006584055.1|  PREDICTED: uncharacterized protein LOC100798...    363   2e-118   
ref|XP_009775161.1|  PREDICTED: uncharacterized protein LOC104225093    362   4e-118   Nicotiana sylvestris
ref|XP_007222369.1|  hypothetical protein PRUPE_ppa003420mg             361   8e-118   
ref|XP_007154170.1|  hypothetical protein PHAVU_003G096200g             362   2e-117   Phaseolus vulgaris [French bean]
ref|XP_007154171.1|  hypothetical protein PHAVU_003G096200g             362   2e-117   Phaseolus vulgaris [French bean]
ref|XP_004229458.1|  PREDICTED: uncharacterized protein LOC101262...    360   2e-117   Solanum lycopersicum
ref|XP_010322788.1|  PREDICTED: uncharacterized protein LOC101262...    360   3e-117   Solanum lycopersicum
ref|XP_010649852.1|  PREDICTED: uncharacterized protein LOC100257995    360   4e-117   Vitis vinifera
emb|CBI26166.3|  unnamed protein product                                360   4e-117   Vitis vinifera
ref|XP_012069499.1|  PREDICTED: uncharacterized protein LOC105631...    359   4e-117   Jatropha curcas
ref|XP_012069496.1|  PREDICTED: uncharacterized protein LOC105631...    360   5e-117   Jatropha curcas
ref|XP_004508352.1|  PREDICTED: uncharacterized protein LOC101492...    360   5e-117   Cicer arietinum [garbanzo]
ref|XP_012069495.1|  PREDICTED: uncharacterized protein LOC105631...    360   5e-117   
ref|XP_012069498.1|  PREDICTED: uncharacterized protein LOC105631...    359   5e-117   Jatropha curcas
ref|XP_012069497.1|  PREDICTED: uncharacterized protein LOC105631...    359   6e-117   
ref|XP_012069492.1|  PREDICTED: uncharacterized protein LOC105631...    359   6e-117   
ref|XP_007034567.1|  Alpha/beta-Hydrolases superfamily protein          359   6e-117   
ref|XP_010512570.1|  PREDICTED: uncharacterized protein LOC104788495    358   7e-117   Camelina sativa [gold-of-pleasure]
ref|XP_004508353.1|  PREDICTED: uncharacterized protein LOC101492...    359   1e-116   Cicer arietinum [garbanzo]
ref|XP_010466700.1|  PREDICTED: uncharacterized protein LOC104746856    358   1e-116   Camelina sativa [gold-of-pleasure]
ref|XP_002516800.1|  catalytic, putative                                363   2e-116   
ref|XP_011071522.1|  PREDICTED: uncharacterized protein LOC105156947    358   2e-116   
ref|XP_006299834.1|  hypothetical protein CARUB_v10016036mg             357   2e-116   Capsella rubella
ref|XP_008340898.1|  PREDICTED: uncharacterized protein LOC103403829    358   3e-116   
ref|XP_010488424.1|  PREDICTED: uncharacterized protein LOC104766...    357   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_009365782.1|  PREDICTED: uncharacterized protein LOC103955607    357   5e-116   Pyrus x bretschneideri [bai li]
ref|XP_011090819.1|  PREDICTED: uncharacterized protein LOC105171...    357   6e-116   Sesamum indicum [beniseed]
ref|XP_011090820.1|  PREDICTED: uncharacterized protein LOC105171...    357   7e-116   Sesamum indicum [beniseed]
ref|XP_011090818.1|  PREDICTED: uncharacterized protein LOC105171...    357   7e-116   Sesamum indicum [beniseed]
ref|XP_011090817.1|  PREDICTED: uncharacterized protein LOC105171...    357   7e-116   Sesamum indicum [beniseed]
ref|XP_011090816.1|  PREDICTED: uncharacterized protein LOC105171...    357   7e-116   Sesamum indicum [beniseed]
gb|KDO74880.1|  hypothetical protein CISIN_1g007812mg                   356   8e-116   Citrus sinensis [apfelsine]
ref|XP_010532691.1|  PREDICTED: uncharacterized protein LOC104808...    355   9e-116   Tarenaya hassleriana [spider flower]
ref|XP_008390806.1|  PREDICTED: uncharacterized protein LOC103453051    356   9e-116   
gb|KDO74878.1|  hypothetical protein CISIN_1g007812mg                   356   9e-116   Citrus sinensis [apfelsine]
ref|XP_006489238.1|  PREDICTED: uncharacterized protein LOC102610023    356   1e-115   Citrus sinensis [apfelsine]
ref|XP_009102606.1|  PREDICTED: uncharacterized protein LOC103828728    355   1e-115   Brassica rapa
ref|XP_010532690.1|  PREDICTED: uncharacterized protein LOC104808...    354   1e-115   Tarenaya hassleriana [spider flower]
gb|KJB72268.1|  hypothetical protein B456_011G168000                    353   1e-115   Gossypium raimondii
emb|CDX77500.1|  BnaA07g06380D                                          355   1e-115   
gb|KJB72266.1|  hypothetical protein B456_011G168000                    356   1e-115   Gossypium raimondii
emb|CDX85110.1|  BnaC07g07960D                                          355   1e-115   
gb|KDO74879.1|  hypothetical protein CISIN_1g007812mg                   355   2e-115   Citrus sinensis [apfelsine]
ref|XP_004296971.1|  PREDICTED: uncharacterized protein LOC101299950    354   8e-115   Fragaria vesca subsp. vesca
ref|XP_010105703.1|  hypothetical protein L484_011315                   353   9e-115   
ref|XP_007147795.1|  hypothetical protein PHAVU_006G155700g             353   1e-114   Phaseolus vulgaris [French bean]
ref|XP_007147794.1|  hypothetical protein PHAVU_006G155700g             353   1e-114   Phaseolus vulgaris [French bean]
ref|NP_188996.2|  alpha/beta-Hydrolases superfamily protein             353   1e-114   Arabidopsis thaliana [mouse-ear cress]
gb|KHN37552.1|  Hypothetical protein glysoja_007255                     353   2e-114   Glycine soja [wild soybean]
ref|XP_006419777.1|  hypothetical protein CICLE_v10004606mg             353   2e-114   Citrus clementina [clementine]
ref|XP_002883434.1|  hypothetical protein ARALYDRAFT_898866             352   3e-114   Arabidopsis lyrata subsp. lyrata
ref|XP_006283451.1|  hypothetical protein CARUB_v10004497mg             352   3e-114   Capsella rubella
ref|XP_006283452.1|  hypothetical protein CARUB_v10004497mg             351   3e-114   Capsella rubella
ref|XP_006406019.1|  hypothetical protein EUTSA_v10020399mg             352   4e-114   Eutrema salsugineum [saltwater cress]
ref|XP_011656643.1|  PREDICTED: uncharacterized protein LOC101215...    352   4e-114   Cucumis sativus [cucumbers]
ref|XP_008458538.1|  PREDICTED: uncharacterized protein LOC103497...    352   4e-114   
ref|XP_010450069.1|  PREDICTED: uncharacterized protein LOC104732228    351   5e-114   Camelina sativa [gold-of-pleasure]
gb|KEH32227.1|  alpha/beta-hydrolase superfamily protein                352   6e-114   Medicago truncatula
ref|XP_009107962.1|  PREDICTED: uncharacterized protein LOC103833638    350   6e-114   Brassica rapa
ref|XP_006597567.1|  PREDICTED: uncharacterized protein LOC100781...    351   6e-114   Glycine max [soybeans]
ref|XP_006597568.1|  PREDICTED: uncharacterized protein LOC100781...    351   7e-114   Glycine max [soybeans]
ref|XP_008458537.1|  PREDICTED: uncharacterized protein LOC103497...    352   7e-114   Cucumis melo [Oriental melon]
ref|XP_006414745.1|  hypothetical protein EUTSA_v10024836mg             350   8e-114   Eutrema salsugineum [saltwater cress]
ref|XP_011656642.1|  PREDICTED: uncharacterized protein LOC101215...    352   9e-114   Cucumis sativus [cucumbers]
emb|CDY09027.1|  BnaC01g30640D                                          349   1e-113   Brassica napus [oilseed rape]
ref|XP_011014506.1|  PREDICTED: uncharacterized protein LOC105118291    351   1e-113   Populus euphratica
gb|ACJ85572.1|  unknown                                                 347   2e-113   Medicago truncatula
ref|XP_009339931.1|  PREDICTED: uncharacterized protein LOC103932104    350   3e-113   Pyrus x bretschneideri [bai li]
ref|XP_010440497.1|  PREDICTED: uncharacterized protein LOC104723788    348   5e-113   Camelina sativa [gold-of-pleasure]
ref|NP_193165.7|  alpha/beta-hydrolase family protein                   347   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669834.1|  PREDICTED: uncharacterized protein LOC104886965    347   2e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010435158.1|  PREDICTED: uncharacterized protein LOC104719...    347   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010435157.1|  PREDICTED: uncharacterized protein LOC104719...    347   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002868296.1|  predicted protein                                  345   8e-112   Arabidopsis lyrata subsp. lyrata
gb|AES64344.2|  alpha/beta hydrolase family protein                     344   1e-111   Medicago truncatula
gb|EPS65169.1|  hypothetical protein M569_09610                         340   2e-111   Genlisea aurea
emb|CDY49406.1|  BnaCnng17160D                                          342   3e-111   Brassica napus [oilseed rape]
ref|XP_009139528.1|  PREDICTED: uncharacterized protein LOC103863...    343   3e-111   Brassica rapa
ref|XP_009139529.1|  PREDICTED: uncharacterized protein LOC103863...    343   4e-111   Brassica rapa
ref|XP_009139530.1|  PREDICTED: uncharacterized protein LOC103863...    343   6e-111   Brassica rapa
emb|CDY12752.1|  BnaC04g28890D                                          341   8e-111   Brassica napus [oilseed rape]
ref|XP_010035879.1|  PREDICTED: uncharacterized protein LOC104425...    341   6e-110   Eucalyptus grandis [rose gum]
ref|XP_010035885.1|  PREDICTED: uncharacterized protein LOC104425...    341   6e-110   Eucalyptus grandis [rose gum]
ref|XP_009109570.1|  PREDICTED: uncharacterized protein LOC103835198    338   2e-109   Brassica rapa
ref|XP_004486108.1|  PREDICTED: HBS1-like protein-like                  348   4e-109   
ref|XP_008223032.1|  PREDICTED: uncharacterized protein LOC103322864    338   1e-108   Prunus mume [ume]
emb|CDY12069.1|  BnaC03g59850D                                          336   2e-108   Brassica napus [oilseed rape]
ref|XP_010942429.1|  PREDICTED: uncharacterized protein LOC105060...    335   5e-108   
ref|XP_011009032.1|  PREDICTED: uncharacterized protein LOC105114...    336   5e-108   Populus euphratica
ref|XP_011009029.1|  PREDICTED: uncharacterized protein LOC105114...    336   5e-108   Populus euphratica
ref|XP_002315536.2|  hypothetical protein POPTR_0010s03020g             334   2e-107   
ref|XP_010942428.1|  PREDICTED: uncharacterized protein LOC105060...    335   4e-107   Elaeis guineensis
ref|XP_009393893.1|  PREDICTED: uncharacterized protein LOC103979459    333   4e-107   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ88870.1|  predicted protein                                      328   6e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS48134.1|  hypothetical protein TRIUR3_10822                       326   6e-107   Triticum urartu
gb|EMT30875.1|  hypothetical protein F775_08510                         327   7e-107   
ref|XP_004984312.1|  PREDICTED: uncharacterized protein LOC101769...    332   1e-106   Setaria italica
gb|ABF96061.1|  expressed protein                                       332   1e-106   Oryza sativa Japonica Group [Japonica rice]
gb|EAY90076.1|  hypothetical protein OsI_11646                          332   1e-106   Oryza sativa Indica Group [Indian rice]
emb|CDO98976.1|  unnamed protein product                                332   1e-106   Coffea canephora [robusta coffee]
emb|CDX90263.1|  BnaA08g17210D                                          331   1e-106   
ref|XP_008668219.1|  PREDICTED: hypothetical protein isoform X1         332   2e-106   Zea mays [maize]
ref|NP_001141958.1|  hypothetical protein                               332   2e-106   Zea mays [maize]
ref|XP_003557834.1|  PREDICTED: uncharacterized protein LOC100838212    332   2e-106   Brachypodium distachyon [annual false brome]
ref|XP_008797057.1|  PREDICTED: uncharacterized protein LOC103712341    332   4e-106   Phoenix dactylifera
ref|XP_006650100.1|  PREDICTED: uncharacterized protein LOC102716943    331   4e-106   Oryza brachyantha
ref|XP_006850814.1|  PREDICTED: uncharacterized protein LOC18440613     330   6e-106   Amborella trichopoda
dbj|BAB02772.1|  unnamed protein product                                331   7e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006595393.1|  PREDICTED: uncharacterized protein LOC100815597    330   2e-105   
gb|ACF83402.1|  unknown                                                 328   3e-105   Zea mays [maize]
ref|XP_010278880.1|  PREDICTED: uncharacterized protein LOC104612...    328   6e-105   Nelumbo nucifera [Indian lotus]
ref|XP_010255853.1|  PREDICTED: uncharacterized protein LOC104596404    327   1e-104   Nelumbo nucifera [Indian lotus]
emb|CAB10208.1|  hypothetical protein                                   317   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311822.2|  hypothetical protein POPTR_0008s20480g             310   7e-98    
ref|XP_011090821.1|  PREDICTED: uncharacterized protein LOC105171...    303   4e-95    
ref|XP_002968666.1|  hypothetical protein SELMODRAFT_170125             284   9e-91    
ref|XP_006584122.1|  PREDICTED: alpha/beta hydrolase domain-conta...    285   1e-90    
ref|XP_003535011.1|  PREDICTED: uncharacterized protein LOC100787...    288   2e-90    Glycine max [soybeans]
gb|KDO78612.1|  hypothetical protein CISIN_1g011425mg                   281   3e-90    Citrus sinensis [apfelsine]
ref|XP_004486396.1|  PREDICTED: uncharacterized protein LOC101505...    286   5e-90    Cicer arietinum [garbanzo]
ref|XP_001769780.1|  predicted protein                                  282   9e-90    
ref|XP_003594373.1|  Abhydrolase domain-containing protein              286   1e-89    
ref|XP_003550951.1|  PREDICTED: uncharacterized protein LOC100784...    286   1e-89    
gb|KDO78613.1|  hypothetical protein CISIN_1g011425mg                   282   2e-89    Citrus sinensis [apfelsine]
ref|XP_006449959.1|  hypothetical protein CICLE_v10015057mg             282   2e-89    
gb|KDO78610.1|  hypothetical protein CISIN_1g011425mg                   282   2e-89    Citrus sinensis [apfelsine]
ref|XP_004984313.1|  PREDICTED: uncharacterized protein LOC101769...    287   2e-89    Setaria italica
gb|AES64624.2|  alpha/beta superfamily hydrolase                        286   2e-89    Medicago truncatula
ref|XP_006597639.1|  PREDICTED: uncharacterized protein LOC100778...    280   3e-89    
ref|XP_010252925.1|  PREDICTED: uncharacterized protein LOC104594...    285   4e-89    Nelumbo nucifera [Indian lotus]
gb|KEH32722.1|  esterase/lipase domain protein                          282   4e-89    Medicago truncatula
gb|KJB57898.1|  hypothetical protein B456_009G185500                    281   6e-89    Gossypium raimondii
gb|KJB57899.1|  hypothetical protein B456_009G185500                    281   1e-88    Gossypium raimondii
gb|KDO78611.1|  hypothetical protein CISIN_1g011425mg                   282   2e-88    Citrus sinensis [apfelsine]
ref|XP_007147555.1|  hypothetical protein PHAVU_006G134600g             283   2e-88    Phaseolus vulgaris [French bean]
gb|KEH32721.1|  esterase/lipase domain protein                          281   2e-88    Medicago truncatula
ref|XP_009411958.1|  PREDICTED: uncharacterized protein LOC103993...    284   2e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006467246.1|  PREDICTED: uncharacterized protein LOC102629...    283   2e-88    Citrus sinensis [apfelsine]
ref|XP_006449960.1|  hypothetical protein CICLE_v10015057mg             283   2e-88    Citrus clementina [clementine]
ref|XP_011658092.1|  PREDICTED: uncharacterized protein LOC101211...    281   4e-88    Cucumis sativus [cucumbers]
ref|XP_008440941.1|  PREDICTED: uncharacterized protein LOC103485...    281   5e-88    Cucumis melo [Oriental melon]
gb|KEH32720.1|  esterase/lipase domain protein                          282   6e-88    Medicago truncatula
ref|XP_004134817.1|  PREDICTED: uncharacterized protein LOC101211...    281   6e-88    Cucumis sativus [cucumbers]
ref|XP_008440940.1|  PREDICTED: uncharacterized protein LOC103485...    281   6e-88    Cucumis melo [Oriental melon]
gb|KJB57903.1|  hypothetical protein B456_009G185500                    280   7e-88    Gossypium raimondii
ref|XP_007154081.1|  hypothetical protein PHAVU_003G089300g             280   8e-88    Phaseolus vulgaris [French bean]
ref|XP_007026441.1|  Alpha/beta-Hydrolases superfamily protein is...    278   8e-88    
ref|XP_006597638.1|  PREDICTED: uncharacterized protein LOC100778...    280   9e-88    Glycine max [soybeans]
gb|KJB57901.1|  hypothetical protein B456_009G185500                    280   1e-87    Gossypium raimondii
ref|XP_010647089.1|  PREDICTED: uncharacterized protein LOC100242843    280   1e-87    
gb|KJB57895.1|  hypothetical protein B456_009G185500                    280   1e-87    Gossypium raimondii
ref|XP_004499344.1|  PREDICTED: uncharacterized protein LOC101489...    281   1e-87    Cicer arietinum [garbanzo]
ref|XP_007154082.1|  hypothetical protein PHAVU_003G089300g             281   1e-87    Phaseolus vulgaris [French bean]
gb|KJB57896.1|  hypothetical protein B456_009G185500                    281   2e-87    Gossypium raimondii
ref|XP_008794704.1|  PREDICTED: uncharacterized protein LOC103710654    281   2e-87    Phoenix dactylifera
gb|ACN85333.1|  unknown                                                 280   2e-87    Oryza meyeriana var. granulata
ref|XP_010252924.1|  PREDICTED: uncharacterized protein LOC104594...    280   2e-87    Nelumbo nucifera [Indian lotus]
ref|XP_006380855.1|  hypothetical protein POPTR_0006s00280g             275   2e-87    
ref|XP_003563634.1|  PREDICTED: uncharacterized protein LOC100831715    280   3e-87    Brachypodium distachyon [annual false brome]
gb|KHN40755.1|  Hypothetical protein glysoja_015122                     280   4e-87    Glycine soja [wild soybean]
gb|KJB57897.1|  hypothetical protein B456_009G185500                    280   4e-87    Gossypium raimondii
ref|XP_003547304.1|  PREDICTED: uncharacterized protein LOC100778...    279   5e-87    
ref|XP_004965908.1|  PREDICTED: uncharacterized protein LOC101783766    279   6e-87    Setaria italica
gb|EYU45603.1|  hypothetical protein MIMGU_mgv1a0037051mg               280   8e-87    Erythranthe guttata [common monkey flower]
ref|XP_006656239.1|  PREDICTED: uncharacterized protein LOC102719683    279   8e-87    Oryza brachyantha
ref|NP_001118998.1|  alpha/beta-Hydrolases superfamily protein          275   9e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006857594.1|  PREDICTED: uncharacterized protein LOC18447435     279   1e-86    Amborella trichopoda
ref|XP_006380856.1|  hypothetical protein POPTR_0006s00280g             275   3e-86    
gb|ACN85247.1|  unknown                                                 278   3e-86    Oryza officinalis
gb|ACN85219.1|  unknown                                                 278   3e-86    Oryza punctata
gb|ACN85260.1|  unknown                                                 278   3e-86    Oryza alta
ref|XP_007026439.1|  Alpha/beta-Hydrolases superfamily protein is...    277   3e-86    
ref|XP_001780178.1|  predicted protein                                  272   4e-86    
ref|XP_004951562.1|  PREDICTED: uncharacterized protein LOC101776234    277   4e-86    Setaria italica
ref|XP_006350228.1|  PREDICTED: uncharacterized protein LOC102589...    277   5e-86    Solanum tuberosum [potatoes]
ref|XP_006350227.1|  PREDICTED: uncharacterized protein LOC102589...    276   5e-86    
gb|ACN85273.1|  unknown                                                 277   6e-86    Oryza alta
ref|XP_010434714.1|  PREDICTED: uncharacterized protein LOC104718...    277   6e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010434713.1|  PREDICTED: uncharacterized protein LOC104718...    277   6e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006373549.1|  hypothetical protein POPTR_0016s00300g             276   7e-86    
ref|XP_012082208.1|  PREDICTED: uncharacterized protein LOC105642...    276   7e-86    Jatropha curcas
ref|XP_009802385.1|  PREDICTED: uncharacterized protein LOC104247...    276   7e-86    Nicotiana sylvestris
ref|XP_004514786.1|  PREDICTED: uncharacterized protein LOC101501...    276   7e-86    Cicer arietinum [garbanzo]
gb|KDP29023.1|  hypothetical protein JCGZ_16412                         276   7e-86    Jatropha curcas
ref|XP_008782969.1|  PREDICTED: uncharacterized protein LOC103702...    276   8e-86    Phoenix dactylifera
ref|XP_010942494.1|  PREDICTED: uncharacterized protein LOC105060476    276   8e-86    
ref|XP_012082205.1|  PREDICTED: uncharacterized protein LOC105642...    276   9e-86    Jatropha curcas
ref|XP_002525239.1|  catalytic, putative                                276   9e-86    Ricinus communis
ref|XP_009620526.1|  PREDICTED: uncharacterized protein LOC104112345    276   1e-85    Nicotiana tomentosiformis
ref|NP_193448.2|  alpha/beta-Hydrolases superfamily protein             276   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001058047.1|  Os06g0609700                                       276   1e-85    
ref|XP_010530100.1|  PREDICTED: uncharacterized protein LOC104806...    271   2e-85    
gb|AFW70735.1|  hypothetical protein ZEAMMB73_068292                    273   2e-85    
ref|XP_008782966.1|  PREDICTED: uncharacterized protein LOC103702...    276   3e-85    
ref|XP_010440051.1|  PREDICTED: uncharacterized protein LOC104723...    274   3e-85    
ref|XP_010440050.1|  PREDICTED: uncharacterized protein LOC104723...    275   3e-85    
ref|XP_010233983.1|  PREDICTED: uncharacterized protein LOC100830...    275   3e-85    Brachypodium distachyon [annual false brome]
ref|XP_010440048.1|  PREDICTED: uncharacterized protein LOC104723...    275   3e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010686591.1|  PREDICTED: uncharacterized protein LOC104900...    272   3e-85    
ref|XP_003571271.1|  PREDICTED: uncharacterized protein LOC100830...    275   3e-85    Brachypodium distachyon [annual false brome]
ref|XP_008644127.1|  PREDICTED: hypothetical protein isoform X2         274   3e-85    Zea mays [maize]
ref|XP_010440049.1|  PREDICTED: uncharacterized protein LOC104723...    275   4e-85    
ref|XP_002870121.1|  hypothetical protein ARALYDRAFT_915007             275   5e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_010449663.1|  PREDICTED: uncharacterized protein LOC104731...    274   5e-85    Camelina sativa [gold-of-pleasure]
ref|XP_011040087.1|  PREDICTED: uncharacterized protein LOC105136...    273   6e-85    Populus euphratica
ref|XP_011040085.1|  PREDICTED: uncharacterized protein LOC105136...    274   7e-85    Populus euphratica
ref|XP_011040086.1|  PREDICTED: uncharacterized protein LOC105136...    274   7e-85    Populus euphratica
ref|XP_010319209.1|  PREDICTED: uncharacterized protein LOC101251464    273   8e-85    Solanum lycopersicum
ref|NP_001170041.1|  hypothetical protein                               274   1e-84    Zea mays [maize]
ref|XP_008649080.1|  PREDICTED: uncharacterized protein LOC103629745    273   1e-84    Zea mays [maize]
ref|XP_008644126.1|  PREDICTED: hypothetical protein isoform X1         273   1e-84    Zea mays [maize]
ref|XP_010530099.1|  PREDICTED: uncharacterized protein LOC104806...    271   1e-84    Tarenaya hassleriana [spider flower]
ref|XP_010686590.1|  PREDICTED: uncharacterized protein LOC104900...    271   2e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010530097.1|  PREDICTED: uncharacterized protein LOC104806...    272   3e-84    Tarenaya hassleriana [spider flower]
ref|XP_010530091.1|  PREDICTED: uncharacterized protein LOC104806...    272   3e-84    Tarenaya hassleriana [spider flower]
ref|XP_006414266.1|  hypothetical protein EUTSA_v10027147mg             273   3e-84    Eutrema salsugineum [saltwater cress]
ref|XP_010686588.1|  PREDICTED: uncharacterized protein LOC104900...    271   3e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010058007.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    272   4e-84    Eucalyptus grandis [rose gum]
gb|KFK32200.1|  hypothetical protein AALP_AA6G210300                    271   6e-84    Arabis alpina [alpine rockcress]
ref|XP_009108297.1|  PREDICTED: uncharacterized protein LOC103833...    271   8e-84    Brassica rapa
ref|XP_007213932.1|  hypothetical protein PRUPE_ppa004766mg             269   4e-83    Prunus persica
ref|XP_007213931.1|  hypothetical protein PRUPE_ppa004766mg             269   4e-83    Prunus persica
ref|XP_011460088.1|  PREDICTED: uncharacterized protein LOC101309...    268   1e-82    Fragaria vesca subsp. vesca
ref|XP_004293431.1|  PREDICTED: uncharacterized protein LOC101309...    268   1e-82    Fragaria vesca subsp. vesca
ref|XP_008224685.1|  PREDICTED: uncharacterized protein LOC103324410    268   1e-82    
gb|KHN14394.1|  Hypothetical protein glysoja_012432                     265   1e-81    Glycine soja [wild soybean]
ref|XP_008384339.1|  PREDICTED: uncharacterized protein LOC103446...    263   4e-81    
ref|XP_008384332.1|  PREDICTED: uncharacterized protein LOC103446...    263   6e-81    
ref|XP_008384338.1|  PREDICTED: uncharacterized protein LOC103446...    263   6e-81    
gb|EYU27617.1|  hypothetical protein MIMGU_mgv1a005188mg                261   4e-80    Erythranthe guttata [common monkey flower]
ref|XP_010911200.1|  PREDICTED: uncharacterized protein LOC105037208    249   2e-79    
ref|XP_009374809.1|  PREDICTED: uncharacterized protein LOC103963697    256   5e-78    Pyrus x bretschneideri [bai li]
ref|XP_004499346.1|  PREDICTED: uncharacterized protein LOC101489...    254   2e-77    Cicer arietinum [garbanzo]
ref|XP_009802386.1|  PREDICTED: uncharacterized protein LOC104247...    254   3e-77    Nicotiana sylvestris
gb|EEC72683.1|  hypothetical protein OsI_06247                          254   5e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_010530096.1|  PREDICTED: uncharacterized protein LOC104806...    253   7e-77    Tarenaya hassleriana [spider flower]
ref|XP_004514787.1|  PREDICTED: uncharacterized protein LOC101501...    249   8e-76    Cicer arietinum [garbanzo]
ref|XP_011090822.1|  PREDICTED: uncharacterized protein LOC105171...    251   1e-75    Sesamum indicum [beniseed]
ref|XP_002438665.1|  hypothetical protein SORBIDRAFT_10g023905          249   2e-75    
emb|CDP04561.1|  unnamed protein product                                245   4e-74    Coffea canephora [robusta coffee]
dbj|BAK06433.1|  predicted protein                                      239   7e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006586806.1|  PREDICTED: uncharacterized protein LOC100787...    237   9e-71    
ref|XP_011095854.1|  PREDICTED: uncharacterized protein LOC105175196    232   4e-69    Sesamum indicum [beniseed]
ref|XP_006283654.1|  hypothetical protein CARUB_v10004712mg             231   1e-68    Capsella rubella
gb|KHN40219.1|  Hypothetical protein glysoja_038414                     231   1e-68    Glycine soja [wild soybean]
ref|XP_011009031.1|  PREDICTED: uncharacterized protein LOC105114...    233   1e-68    Populus euphratica
emb|CAN66506.1|  hypothetical protein VITISV_035499                     233   2e-68    Vitis vinifera
ref|XP_009802387.1|  PREDICTED: uncharacterized protein LOC104247...    228   2e-68    Nicotiana sylvestris
gb|KHG17313.1|  putative yqkD                                           232   3e-68    Gossypium arboreum [tree cotton]
ref|XP_010434715.1|  PREDICTED: uncharacterized protein LOC104718...    230   3e-68    Camelina sativa [gold-of-pleasure]
ref|XP_010096514.1|  hypothetical protein L484_017966                   234   6e-68    
ref|XP_002465239.1|  hypothetical protein SORBIDRAFT_01g034850          231   7e-68    
ref|XP_009802384.1|  PREDICTED: uncharacterized protein LOC104247...    229   2e-67    Nicotiana sylvestris
ref|XP_009108298.1|  PREDICTED: uncharacterized protein LOC103833...    228   2e-67    Brassica rapa
ref|XP_010449665.1|  PREDICTED: uncharacterized protein LOC104731...    228   2e-67    Camelina sativa [gold-of-pleasure]
ref|XP_002451724.1|  hypothetical protein SORBIDRAFT_04g006660          228   3e-67    
ref|XP_006597635.1|  PREDICTED: uncharacterized protein LOC100778...    227   4e-67    Glycine max [soybeans]
gb|EAZ22104.1|  hypothetical protein OsJ_05763                          223   2e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648424.1|  PREDICTED: uncharacterized protein LOC102719462    222   4e-65    
ref|XP_010686589.1|  PREDICTED: uncharacterized protein LOC104900...    220   1e-64    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY50125.1|  BnaCnng18740D                                          211   1e-60    Brassica napus [oilseed rape]
ref|XP_006467249.1|  PREDICTED: uncharacterized protein LOC102629...    209   1e-60    Citrus sinensis [apfelsine]
ref|XP_006449958.1|  hypothetical protein CICLE_v10015057mg             209   1e-60    
emb|CDY58164.1|  BnaA08g30210D                                          210   3e-60    Brassica napus [oilseed rape]
ref|XP_005834328.1|  hypothetical protein GUITHDRAFT_106795             207   5e-60    Guillardia theta CCMP2712
gb|KHG30285.1|  putative yqkD                                           208   2e-59    Gossypium arboreum [tree cotton]
ref|XP_010530098.1|  PREDICTED: uncharacterized protein LOC104806...    204   1e-58    Tarenaya hassleriana [spider flower]
dbj|GAM26335.1|  hypothetical protein SAMD00019534_095100               203   1e-58    Acytostelium subglobosum LB1
ref|XP_002683321.1|  predicted protein                                  199   3e-58    Naegleria gruberi strain NEG-M
ref|XP_002500526.1|  predicted protein                                  196   3e-57    Micromonas commoda
gb|EFA83276.1|  alpha/beta hydrolase fold-1 domain-containing pro...    201   4e-57    Heterostelium album PN500
ref|XP_004039103.1|  hypothetical protein IMG5_033680                   192   1e-55    
ref|XP_005849267.1|  hypothetical protein CHLNCDRAFT_143536             198   9e-55    
ref|NP_001172844.1|  Os02g0197900                                       182   2e-53    
emb|CDJ70048.1|  hypothetical protein, conserved                        182   6e-53    
ref|XP_003285027.1|  hypothetical protein DICPUDRAFT_148856             192   8e-53    
ref|XP_003056359.1|  predicted protein                                  185   1e-52    
ref|XP_645007.1|  alpha/beta hydrolase fold-1 domain-containing p...    190   2e-52    
ref|XP_002885117.1|  hypothetical protein ARALYDRAFT_897893             177   1e-51    
emb|CDI77547.1|  hypothetical protein EAH_00025150                      188   3e-51    
ref|XP_001690455.1|  hypothetical protein CHLREDRAFT_188508             187   4e-51    
gb|KFG99519.1|  putative protein c14orf29                               189   4e-51    
gb|KFG61733.1|  putative protein c14orf29                               189   5e-51    
gb|KFG51948.1|  putative protein c14orf29                               189   5e-51    
gb|EPT28520.1|  protein c14orf29, putative                              189   5e-51    
gb|EPR64695.1|  putative protein c14orf29                               189   5e-51    
gb|ESS36204.1|  putative protein c14orf29                               189   6e-51    
gb|KFH16547.1|  putative protein c14orf29                               189   6e-51    
gb|EJY87631.1|  hypothetical protein OXYTRI_01425                       186   6e-51    
ref|XP_008882514.1|  protein c14orf29, putative                         189   8e-51    
ref|XP_002365812.1|  hypothetical protein TGME49_071460                 186   1e-50    
gb|EJY74722.1|  hypothetical protein OXYTRI_04018                       182   3e-50    
ref|XP_011395460.1|  Uncharacterized protein YqkD                       181   3e-50    
ref|XP_002780525.1|  Protein C14orf29, putative                         180   5e-50    
ref|XP_003883797.1|  Alpha/beta hydrolase, related                      186   7e-50    
ref|XP_001019221.1|  hypothetical protein TTHERM_00849190               181   1e-49    
emb|CDW72798.1|  UNKNOWN                                                179   1e-49    
ref|XP_002787187.1|  Protein C14orf29, putative                         175   5e-49    
gb|EJY71252.1|  Protein C14orf29, putative                              175   2e-48    
ref|XP_002781185.1|  Protein C14orf29, putative                         172   3e-48    
emb|CBJ29857.1|  conserved unknown protein                              179   7e-48    
emb|CDJ41283.1|  hypothetical protein, conserved                        182   8e-48    
emb|CDW85425.1|  UNKNOWN                                                176   8e-48    
emb|CDW72273.1|  UNKNOWN                                                181   1e-47    
ref|XP_004359060.1|  alpha/beta hydrolase fold-1 domain-containin...    173   4e-47    
emb|CDJ56015.1|  hypothetical protein, conserved                        174   8e-47    
ref|WP_028832089.1|  hypothetical protein                               171   4e-46    
ref|XP_001447435.1|  hypothetical protein                               169   9e-46    
gb|KDO23939.1|  hypothetical protein SPRG_10085                         169   2e-45    
gb|EMS51371.1|  hypothetical protein TRIUR3_15935                       170   2e-45    
ref|XP_001428850.1|  hypothetical protein                               172   2e-44    
ref|XP_005822973.1|  hypothetical protein GUITHDRAFT_146136             167   2e-44    
gb|KHN03563.1|  hypothetical protein glysoja_004589                     166   2e-44    
gb|EWM25459.1|  serine protease family                                  168   2e-44    
gb|KHN19820.1|  Serine hydroxymethyltransferase 1                       162   3e-44    
ref|XP_009035971.1|  hypothetical protein AURANDRAFT_2040               162   5e-44    
ref|XP_009040667.1|  hypothetical protein AURANDRAFT_32346              161   8e-44    
ref|XP_011131447.1|  alpha/beta hydrolase family protein                164   1e-43    
ref|XP_002291190.1|  hypothetical protein THAPSDRAFT_269163             166   1e-43    
emb|CCW67946.1|  unnamed protein product                                162   1e-43    
ref|XP_008614637.1|  hypothetical protein SDRG_10426                    165   1e-43    
gb|KIY96673.1|  hypothetical protein MNEG_11288                         163   2e-43    
gb|EFA84193.1|  hypothetical protein PPL_03268                          162   2e-43    
gb|EPY23000.1|  hypothetical protein STCU_07959                         158   1e-42    
ref|XP_008914557.1|  hypothetical protein PPTG_18194                    163   1e-42    
ref|XP_008871632.1|  hypothetical protein, variant                      161   1e-42    
gb|ETI32165.1|  hypothetical protein F443_20953                         163   2e-42    
gb|ETP30186.1|  hypothetical protein F442_20753                         163   2e-42    
gb|ETO60903.1|  hypothetical protein F444_20964                         163   2e-42    
gb|ETK72540.1|  hypothetical protein L915_20365                         163   2e-42    
ref|XP_004336643.1|  hypothetical protein ACA1_066610                   164   2e-42    
ref|XP_002998858.1|  serine protease family S09X, putative              162   4e-42    
ref|XP_009835314.1|  hypothetical protein H257_10454                    161   5e-42    
ref|XP_008871631.1|  hypothetical protein H310_07893                    160   6e-42    
gb|EJK64219.1|  hypothetical protein THAOC_15066                        161   6e-42    
ref|XP_009314015.1|  hypothetical protein DQ04_08901020                 158   1e-41    
ref|XP_005648115.1|  alpha/beta-hydrolase                               160   2e-41    
ref|XP_009108299.1|  PREDICTED: uncharacterized protein LOC103833...    157   2e-41    
ref|XP_002773985.1|  Abhydrolase domain-containing protein, putative    155   2e-41    
ref|XP_005829247.1|  hypothetical protein GUITHDRAFT_111828             154   3e-41    
ref|XP_005783561.1|  hypothetical protein EMIHUDRAFT_434409             159   3e-41    
ref|XP_005840487.1|  hypothetical protein GUITHDRAFT_161065             152   3e-41    
emb|CCA19146.1|  serine protease family S09X putative                   159   5e-41    
emb|CCI43474.1|  unnamed protein product                                158   5e-41    
gb|EKG05821.1|  hypothetical protein TCSYLVIO_003099                    155   2e-40    
gb|EKF37985.1|  hypothetical protein MOQ_001810                         155   2e-40    
ref|XP_004035837.1|  hypothetical protein IMG5_086710                   154   3e-40    
ref|XP_004367489.1|  abnormal long morphology protein                   152   4e-40    
ref|XP_008901240.1|  hypothetical protein PPTG_08082                    155   7e-40    
gb|ETP50752.1|  hypothetical protein F442_04020                         155   8e-40    
emb|CCA24963.1|  serine protease family S09X putative                   153   8e-40    
gb|ETL46239.1|  hypothetical protein L916_03863                         155   9e-40    
emb|CCC90908.1|  unnamed protein product                                153   1e-39    
ref|XP_813897.1|  hypothetical protein                                  151   4e-39    
emb|CCI46060.1|  unnamed protein product                                150   6e-39    
ref|XP_002765178.1|  conserved hypothetical protein                     150   6e-39    
ref|XP_845302.1|  hypothetical protein                                  151   7e-39    
ref|XP_011773958.1|  hypothetical protein, conserved                    151   7e-39    
ref|XP_002142078.1|  hypothetical protein                               152   7e-39    
ref|XP_009041890.1|  hypothetical protein AURANDRAFT_72733              153   1e-38    
ref|XP_009529301.1|  hypothetical protein PHYSODRAFT_546309             152   1e-38    
ref|XP_004035138.1|  hypothetical protein IMG5_105010                   149   1e-38    
ref|XP_009538086.1|  hypothetical protein PHYSODRAFT_307213             152   2e-38    
ref|XP_002909261.1|  serine protease family S09X, putative              150   2e-38    
ref|XP_004984314.1|  PREDICTED: uncharacterized protein LOC101769...    150   3e-38    
ref|XP_001459749.1|  hypothetical protein                               147   4e-38    
ref|XP_668367.1|  random slug cDNA-11 (Fragment)                        149   1e-37    
ref|XP_628229.1|  protein with a conserved N-terminal region            149   2e-37    
dbj|BAP69022.1|  RxLR effector candidate protein                        147   5e-37    
gb|EAS02968.2|  alpha/beta fold hydrolase                               146   6e-37    
gb|EAR98281.2|  alpha/beta hydrolase family protein                     146   1e-36    
ref|XP_008351157.1|  PREDICTED: uncharacterized protein LOC103414...    144   2e-36    
ref|XP_001447920.1|  hypothetical protein                               142   2e-36    
emb|CCW67952.1|  unnamed protein product                                140   5e-36    
ref|XP_001443817.1|  hypothetical protein                               141   9e-36    
gb|KDO35722.1|  hypothetical protein SPRG_18871                         142   1e-35    
ref|XP_004039812.1|  hypothetical protein IMG5_009170                   144   1e-35    
gb|EPY28011.1|  hypothetical protein AGDE_10595                         140   1e-35    
ref|XP_005714234.1|  unnamed protein product                            145   2e-35    
ref|XP_002181623.1|  predicted protein                                  138   3e-35    
ref|XP_010701076.1|  hypothetical protein LPMP_300410                   140   6e-35    
ref|XP_009040576.1|  hypothetical protein AURANDRAFT_72453              142   6e-35    
ref|XP_001431900.1|  hypothetical protein                               138   8e-35    
ref|XP_003877186.1|  conserved hypothetical protein                     140   8e-35    
ref|XP_001566680.1|  conserved hypothetical protein                     139   1e-34    
ref|XP_001684629.1|  conserved hypothetical protein                     139   1e-34    
ref|XP_008607180.1|  hypothetical protein SDRG_03327                    139   1e-34    
emb|CBN74744.1|  conserved unknown protein                              143   1e-34    
ref|XP_001430009.1|  hypothetical protein                               138   1e-34    
ref|XP_001012870.1|  hypothetical protein TTHERM_00094160               144   2e-34    
emb|CDW81374.1|  abhydrolase domain-containing                          135   4e-34    
emb|CAB10496.1|  hypothetical protein                                   137   7e-34    
ref|XP_001018256.1|  hypothetical protein TTHERM_00284010               140   1e-33    
ref|XP_001466886.1|  conserved hypothetical protein                     137   2e-33    
ref|XP_003862754.1|  hypothetical protein, conserved                    137   2e-33    
gb|EJY73890.1|  hypothetical protein OXYTRI_04857                       134   3e-33    
ref|XP_001436216.1|  hypothetical protein                               134   7e-33    
gb|KDD74697.1|  hypothetical protein H632_c1127p1                       128   9e-33    
ref|XP_001449217.1|  hypothetical protein                               133   3e-32    
emb|CCA24173.1|  serine protease family S09X putative                   132   4e-32    
emb|CCC48334.1|  conserved hypothetical protein                         131   5e-32    
ref|XP_005781400.1|  hypothetical protein EMIHUDRAFT_456875             129   8e-32    
ref|XP_010278885.1|  PREDICTED: uncharacterized protein LOC104612...    132   1e-31    
gb|EMS61217.1|  hypothetical protein TRIUR3_16734                       132   2e-31    
ref|XP_001303939.1|  Clan SC, family S9, unassigned serine peptidase    129   2e-31    
ref|XP_001009290.1|  hypothetical protein TTHERM_00846990               133   3e-31    
ref|XP_004031116.1|  hypothetical protein IMG5_146530                   130   3e-31    
gb|EAR89045.2|  X-pro dipeptidyl-peptidase, S15 family protein          133   3e-31    
ref|XP_009411976.1|  PREDICTED: uncharacterized protein LOC103993...    130   3e-31    
ref|XP_009411966.1|  PREDICTED: uncharacterized protein LOC103993...    130   4e-31    
emb|CCI45202.1|  unnamed protein product                                134   4e-31    
gb|EAS05128.2|  alpha/beta hydrolase family protein                     132   9e-31    
ref|XP_008782973.1|  PREDICTED: uncharacterized protein LOC103702...    129   1e-30    
gb|EAR83757.2|  alpha/beta fold hydrolase                               130   1e-30    
ref|XP_008782970.1|  PREDICTED: uncharacterized protein LOC103702...    129   1e-30    
ref|XP_009835153.1|  hypothetical protein, variant 3                    127   3e-30    
ref|XP_009835150.1|  hypothetical protein H257_10339                    127   3e-30    
ref|XP_009835152.1|  hypothetical protein, variant 2                    127   3e-30    
ref|XP_001018526.1|  hypothetical protein TTHERM_00346800               128   3e-30    
ref|XP_009835151.1|  hypothetical protein, variant 1                    127   3e-30    
gb|ESS65374.1|  hypothetical protein TCDM_06305                         125   1e-29    
dbj|BAF02033.1|  hypothetical protein                                   117   1e-29    
ref|XP_008864598.1|  hypothetical protein H310_02754                    125   2e-29    
ref|XP_002771424.1|  conserved hypothetical protein                     122   2e-29    
ref|XP_001016054.2|  hypothetical protein TTHERM_00877040               128   3e-29    
emb|CDO64002.1|  alpha/beta-hydrolase, putative                         124   4e-29    
ref|XP_001025373.1|  hypothetical protein TTHERM_00765130               127   7e-29    
ref|XP_006597636.1|  PREDICTED: uncharacterized protein LOC100778...    124   7e-29    
ref|XP_006597637.1|  PREDICTED: uncharacterized protein LOC100778...    123   7e-29    
ref|XP_001432920.1|  hypothetical protein                               122   1e-28    
ref|XP_001471058.1|  Abnormal long morphology protein, putative         126   2e-28    
ref|XP_005832880.1|  hypothetical protein GUITHDRAFT_138727             121   3e-28    
ref|XP_008351152.1|  PREDICTED: uncharacterized protein LOC103414...    121   3e-28    
ref|XP_004026841.1|  serine protease family, putative                   121   4e-28    
ref|XP_004035399.1|  hypothetical protein IMG5_099930                   120   1e-27    
ref|XP_001314988.1|  hypothetical protein                               119   1e-27    
ref|XP_001315649.1|  Clan SC, family S9, unassigned serine peptidase    118   2e-27    
ref|XP_004024168.1|  hypothetical protein IMG5_198760                   115   2e-27    
emb|CDJ45709.1|  hypothetical protein EBH_0061260                       115   2e-27    
gb|KJP89566.1|  hypothetical protein AK88_00777                         119   3e-27    
ref|WP_028830769.1|  hypothetical protein                               119   3e-27    
gb|EUT87307.1|  hypothetical protein PFAG_02129                         118   4e-27    
gb|ETW18969.1|  hypothetical protein PFFVO_02176                        118   4e-27    
ref|XP_004035282.1|  hypothetical protein IMG5_102050                   120   4e-27    
gb|ETW49834.1|  hypothetical protein PFMALIP_02192                      118   4e-27    
ref|XP_004221107.1|  hypothetical protein PCYB_051780                   117   5e-27    
ref|XP_008816465.1|  hypothetical protein C922_02644                    118   9e-27    
ref|XP_009041300.1|  hypothetical protein AURANDRAFT_72626              120   1e-26    
ref|XP_002808873.1|  conserved Plasmodium protein, unknown function     117   1e-26    
ref|XP_744629.1|  hypothetical protein                                  116   1e-26    
ref|XP_009032986.1|  hypothetical protein AURANDRAFT_61105              119   2e-26    
ref|XP_002258089.1|  hypothetical protein in Apicomplexan species       117   3e-26    
emb|CDR12095.1|  alpha/beta hydrolase, putative                         115   5e-26    
ref|XP_009036766.1|  hypothetical protein AURANDRAFT_71549              118   6e-26    
ref|XP_008626199.1|  hypothetical protein YYE_04336                     115   6e-26    
ref|NP_001050149.1|  Os03g0359000                                       115   8e-26    
ref|XP_001614928.1|  hypothetical protein                               115   1e-25    
ref|XP_001315076.1|  hypothetical protein                               112   2e-25    
gb|EUD70658.1|  hypothetical protein YYG_04216                          114   2e-25    
gb|EPS70866.1|  hypothetical protein M569_03894                         106   3e-25    
ref|XP_001440468.1|  hypothetical protein                               113   3e-25    
ref|XP_005835898.1|  hypothetical protein GUITHDRAFT_136548             112   6e-25    
gb|EWM27930.1|  serine protease family                                  114   7e-25    
gb|EAS06230.2|  alpha/beta fold hydrolase                               114   7e-25    
ref|XP_678874.1|  hypothetical protein                                  110   3e-24    
emb|CDS45687.1|  alpha/beta hydrolase, putative                         109   1e-23    
gb|ETB58663.1|  hypothetical protein YYC_03816                          108   1e-23    
ref|XP_001453596.1|  hypothetical protein                               107   2e-23    
ref|XP_009032989.1|  hypothetical protein AURANDRAFT_70671              110   3e-23    
ref|XP_730594.1|  hypothetical protein                                  107   4e-23    
ref|XP_004037083.1|  hypothetical protein IMG5_061800                   106   5e-23    
ref|XP_001312212.1|  hypothetical protein                               105   6e-23    
ref|XP_001031420.1|  hypothetical protein TTHERM_00825520               109   8e-23    
ref|XP_009521324.1|  hypothetical protein PHYSODRAFT_482632             106   9e-23    
ref|XP_002291626.1|  predicted protein                                  101   2e-22    
ref|XP_001026475.1|  hypothetical protein TTHERM_00327120               106   4e-22    
gb|EAR95469.2|  alpha/beta fold hydrolase                               106   4e-22    
ref|XP_001423101.1|  hypothetical protein                               103   6e-22    
ref|XP_001347180.1|  hypothetical protein                               103   7e-22    
ref|XP_001458019.1|  hypothetical protein                               102   9e-22    
ref|XP_001330359.1|  hypothetical protein                               102   1e-21    
ref|XP_001015714.1|  hypothetical protein TTHERM_00077730               104   2e-21    
ref|XP_008914946.1|  hypothetical protein PPTG_18473                  99.8    2e-21    
ref|XP_001445385.1|  hypothetical protein                               100   3e-21    
gb|EMT20062.1|  hypothetical protein F775_19526                         101   3e-21    
ref|XP_002905156.1|  conserved hypothetical protein                     100   6e-21    
gb|ETK72174.1|  hypothetical protein L915_20690                       99.4    1e-20    
emb|CCI48112.1|  unnamed protein product                              99.0    2e-20    
ref|XP_001455919.1|  hypothetical protein                             99.0    2e-20    
ref|XP_001434611.1|  hypothetical protein                             97.4    4e-20    
ref|XP_001316821.1|  hypothetical protein                             97.4    7e-20    
ref|XP_001301608.1|  Clan SC, family S9, unassigned serine peptidase  96.3    8e-20    



>ref|XP_009614536.1| PREDICTED: uncharacterized protein LOC104107438 [Nicotiana tomentosiformis]
Length=358

 Score =   359 bits (921),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR DALKC+HY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDALKCTHYMPLIRP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLP NITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPLNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006339420.1| PREDICTED: uncharacterized protein LOC102603324 [Solanum tuberosum]
Length=568

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR D LKCSHY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDVLKCSHYMPLIRP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLM ELVD
Sbjct  121  LRAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMTELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006600321.1| PREDICTED: uncharacterized protein LOC100807823 isoform X1 [Glycine 
max]
Length=608

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRDDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|KHN03032.1| Hypothetical protein glysoja_009898 [Glycine soja]
Length=584

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRDDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006600322.1| PREDICTED: uncharacterized protein LOC100807823 isoform X2 [Glycine 
max]
Length=606

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRDDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|KHN03427.1| Hypothetical protein glysoja_004453 [Glycine soja]
Length=612

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRDDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_003529600.1| PREDICTED: uncharacterized protein LOC100798920 isoform X1 [Glycine 
max]
Length=607

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRDDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006584056.1| PREDICTED: uncharacterized protein LOC100798920 isoform X3 [Glycine 
max]
Length=608

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRDDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006584055.1| PREDICTED: uncharacterized protein LOC100798920 isoform X2 [Glycine 
max]
Length=609

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRDDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_009775161.1| PREDICTED: uncharacterized protein LOC104225093 [Nicotiana sylvestris]
Length=569

 Score =   362 bits (928),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQR+DLEVKNSR D LKC+HY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRRDLEVKNSRDDVLKCTHYMPLIRP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLP NITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPLNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVVEYLR DGNVSLIGLWGRSMGAVTSLMYGA+ PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAKDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_007222369.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
 gb|EMJ23568.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
Length=576

 Score =   361 bits (927),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKNSRGD LKCSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNSRGDVLKCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV+YLR DGNVSLIGLWGRSMGAVTSL+YGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRTVVDYLRADGNVSLIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_007154170.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26164.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=610

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLL+ EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLEPEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRDDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_007154171.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26165.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=611

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLL+ EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLEPEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRDDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_004229458.1| PREDICTED: uncharacterized protein LOC101262250 isoform X1 [Solanum 
lycopersicum]
Length=568

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR D LKCSHY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDFLKCSHYMPLIRP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKLLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLM ELVD
Sbjct  121  LRAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMTELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010322788.1| PREDICTED: uncharacterized protein LOC101262250 isoform X2 [Solanum 
lycopersicum]
Length=566

 Score =   360 bits (923),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR D LKCSHY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDFLKCSHYMPLIRP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKLLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLM ELVD
Sbjct  121  LRAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMTELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010649852.1| PREDICTED: uncharacterized protein LOC100257995 [Vitis vinifera]
Length=599

 Score =   360 bits (924),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLD+EFMLKGKW+QRKDLEV NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDQEFMLKGKWFQRKDLEVVNSRGDVLQCSHYVPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGW+EKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWHEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV++LR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDHLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>emb|CBI26166.3| unnamed protein product [Vitis vinifera]
Length=601

 Score =   360 bits (924),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLD+EFMLKGKW+QRKDLEV NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDQEFMLKGKWFQRKDLEVVNSRGDVLQCSHYVPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGW+EKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWHEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV++LR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDHLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_012069499.1| PREDICTED: uncharacterized protein LOC105631893 isoform X6 [Jatropha 
curcas]
Length=573

 Score =   359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDFEIKNSRGDVLQCSHYVPIVTP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV+YLRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMEL D
Sbjct  121  LRAVVDYLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELGD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_012069496.1| PREDICTED: uncharacterized protein LOC105631893 isoform X3 [Jatropha 
curcas]
Length=584

 Score =   360 bits (923),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDFEIKNSRGDVLQCSHYVPIVTP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV+YLRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMEL D
Sbjct  121  LRAVVDYLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELGD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_004508352.1| PREDICTED: uncharacterized protein LOC101492469 isoform X1 [Cicer 
arietinum]
Length=603

 Score =   360 bits (924),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD+EFML+GKWYQRKD+E+KNSRGDAL+CSHYIPI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLRGKWYQRKDVEIKNSRGDALQCSHYIPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L AVV YLR DGNVSLIGLWGRSMGAVT LMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LTAVVNYLRNDGNVSLIGLWGRSMGAVTCLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_012069495.1| PREDICTED: uncharacterized protein LOC105631893 isoform X2 [Jatropha 
curcas]
Length=586

 Score =   360 bits (923),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDFEIKNSRGDVLQCSHYVPIVTP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV+YLRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMEL D
Sbjct  121  LRAVVDYLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELGD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_012069498.1| PREDICTED: uncharacterized protein LOC105631893 isoform X5 [Jatropha 
curcas]
 gb|KDP40084.1| hypothetical protein JCGZ_02082 [Jatropha curcas]
Length=575

 Score =   359 bits (921),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDFEIKNSRGDVLQCSHYVPIVTP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV+YLRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMEL D
Sbjct  121  LRAVVDYLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELGD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_012069497.1| PREDICTED: uncharacterized protein LOC105631893 isoform X4 [Jatropha 
curcas]
Length=581

 Score =   359 bits (921),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDFEIKNSRGDVLQCSHYVPIVTP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV+YLRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMEL D
Sbjct  121  LRAVVDYLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELGD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_012069492.1| PREDICTED: uncharacterized protein LOC105631893 isoform X1 [Jatropha 
curcas]
 ref|XP_012069493.1| PREDICTED: uncharacterized protein LOC105631893 isoform X1 [Jatropha 
curcas]
 ref|XP_012069494.1| PREDICTED: uncharacterized protein LOC105631893 isoform X1 [Jatropha 
curcas]
Length=592

 Score =   359 bits (922),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDFEIKNSRGDVLQCSHYVPIVTP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV+YLRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMEL D
Sbjct  121  LRAVVDYLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELGD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_007034567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY05493.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=587

 Score =   359 bits (922),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P NDLLD+EFMLKGKWYQRKD+EVKNSRGD L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRAEYNPDNDLLDQEFMLKGKWYQRKDIEVKNSRGDVLRCSHYVPLVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLASNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010512570.1| PREDICTED: uncharacterized protein LOC104788495 [Camelina sativa]
Length=561

 Score =   358 bits (919),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQDGN+SLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_004508353.1| PREDICTED: uncharacterized protein LOC101492469 isoform X2 [Cicer 
arietinum]
Length=601

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD+EFML+GKWYQRKD+E+KNSRGDAL+CSHYIPI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLRGKWYQRKDVEIKNSRGDALQCSHYIPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L AVV YLR DGNVSLIGLWGRSMGAVT LMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LTAVVNYLRNDGNVSLIGLWGRSMGAVTCLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010466700.1| PREDICTED: uncharacterized protein LOC104746856 [Camelina sativa]
Length=561

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQDGN+SLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_002516800.1| catalytic, putative [Ricinus communis]
 gb|EEF45414.1| catalytic, putative [Ricinus communis]
Length=760

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY PK+DLLD+EFMLKGKWYQRKDLE+KN+RGD L+CSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPKHDLLDQEFMLKGKWYQRKDLEIKNNRGDVLQCSHYAPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAG+VLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGVVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_011071522.1| PREDICTED: uncharacterized protein LOC105156947 [Sesamum indicum]
Length=605

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEY+PKNDLLD+EFMLKGKWYQRKDLEV NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYNPKNDLLDQEFMLKGKWYQRKDLEVVNSRGDVLQCSHYMPIVRP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG PLPCVIYCHGNSGCR DASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGNPLPCVIYCHGNSGCRTDASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006299834.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
 gb|EOA32732.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
Length=564

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_008340898.1| PREDICTED: uncharacterized protein LOC103403829 [Malus domestica]
Length=589

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKN RGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNGRGDVLKCSHYXPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV+YLR DGNVSLIGLWGRSMGAVTSL+YGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKTVVDYLRADGNVSLIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010488424.1| PREDICTED: uncharacterized protein LOC104766269 isoform X1 [Camelina 
sativa]
 ref|XP_010488425.1| PREDICTED: uncharacterized protein LOC104766269 isoform X2 [Camelina 
sativa]
Length=561

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPQHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKP PCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPFPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQDGN+SLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_009365782.1| PREDICTED: uncharacterized protein LOC103955607 [Pyrus x bretschneideri]
Length=588

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLD+EF+LKGKWYQRKD+EVKNSRGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDQEFILKGKWYQRKDVEVKNSRGDVLKCSHYTPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV+YLR DGNVSLIGLWGRSMGAVTSL+YGAE PSI GMVLDSPFSDLVDLMMELVD
Sbjct  121  LKTVVDYLRADGNVSLIGLWGRSMGAVTSLLYGAEDPSIPGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_011090819.1| PREDICTED: uncharacterized protein LOC105171411 isoform X4 [Sesamum 
indicum]
Length=600

 Score =   357 bits (916),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTS+MYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSLIGLWGRSMGAVTSMMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            +Y
Sbjct  181  SY  182



>ref|XP_011090820.1| PREDICTED: uncharacterized protein LOC105171411 isoform X5 [Sesamum 
indicum]
Length=599

 Score =   357 bits (916),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTS+MYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSLIGLWGRSMGAVTSMMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            +Y
Sbjct  181  SY  182



>ref|XP_011090818.1| PREDICTED: uncharacterized protein LOC105171411 isoform X3 [Sesamum 
indicum]
Length=614

 Score =   357 bits (917),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTS+MYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSLIGLWGRSMGAVTSMMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            +Y
Sbjct  181  SY  182



>ref|XP_011090817.1| PREDICTED: uncharacterized protein LOC105171411 isoform X2 [Sesamum 
indicum]
Length=614

 Score =   357 bits (917),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTS+MYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSLIGLWGRSMGAVTSMMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            +Y
Sbjct  181  SY  182



>ref|XP_011090816.1| PREDICTED: uncharacterized protein LOC105171411 isoform X1 [Sesamum 
indicum]
Length=615

 Score =   357 bits (917),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTS+MYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSLIGLWGRSMGAVTSMMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            +Y
Sbjct  181  SY  182



>gb|KDO74880.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score =   356 bits (914),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVS+IGLWGRSMGAVTSL+YGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSMIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010532691.1| PREDICTED: uncharacterized protein LOC104808656 isoform X2 [Tarenaya 
hassleriana]
Length=537

 Score =   355 bits (910),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD L+CSHY+PI  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLQCSHYMPIERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_008390806.1| PREDICTED: uncharacterized protein LOC103453051 [Malus domestica]
Length=588

 Score =   356 bits (914),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP+NDLLD+EF+LKGKWYQRKD+E+KNSRGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPQNDLLDQEFILKGKWYQRKDVELKNSRGDVLKCSHYTPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV+YLR DGNVSLIGLWGRSMGAVTSL+YGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKTVVDYLRADGNVSLIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|KDO74878.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=588

 Score =   356 bits (914),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVS+IGLWGRSMGAVTSL+YGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSMIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006489238.1| PREDICTED: uncharacterized protein LOC102610023 [Citrus sinensis]
Length=588

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVS+IGLWGRSMGAVTSL+YGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSMIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_009102606.1| PREDICTED: uncharacterized protein LOC103828728 [Brassica rapa]
Length=566

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLE+KNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEIKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQDGN+SLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010532690.1| PREDICTED: uncharacterized protein LOC104808656 isoform X1 [Tarenaya 
hassleriana]
Length=539

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD L+CSHY+PI  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLQCSHYMPIERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|KJB72268.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=499

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLLDEEFMLKGKWYQRKD+EVKN RGD L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRAEYNPESDLLDEEFMLKGKWYQRKDIEVKNGRGDVLQCSHYVPLVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAG+VLDSPFSDLV+LM+ELVD
Sbjct  121  LKAVVDYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGIVLDSPFSDLVELMLELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>emb|CDX77500.1| BnaA07g06380D [Brassica napus]
Length=566

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLE+KNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEIKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQDGN+SLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|KJB72266.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72267.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72269.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=584

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLLDEEFMLKGKWYQRKD+EVKN RGD L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRAEYNPESDLLDEEFMLKGKWYQRKDIEVKNGRGDVLQCSHYVPLVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAG+VLDSPFSDLV+LM+ELVD
Sbjct  121  LKAVVDYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGIVLDSPFSDLVELMLELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>emb|CDX85110.1| BnaC07g07960D [Brassica napus]
Length=566

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLE+KNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEIKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQDGN+SLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|KDO74879.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVS+IGLWGRSMGAVTSL+YGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSMIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_004296971.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462782.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462783.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
Length=591

 Score =   354 bits (908),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ME LVNFIIRPPRAEYDPKNDLLD+EF+LKGKWYQRKDL+VKNSRGD LKCSHY+PI+ P
Sbjct  1    MEPLVNFIIRPPRAEYDPKNDLLDDEFILKGKWYQRKDLDVKNSRGDVLKCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSN+TVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNVTVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV+YLR DGNVSLIGLWGRSMGAVTSL+Y AE PSIAG+VLDSPFSDLVDLMMELVD
Sbjct  121  LRTVVDYLRADGNVSLIGLWGRSMGAVTSLLYAAEDPSIAGVVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010105703.1| hypothetical protein L484_011315 [Morus notabilis]
 gb|EXC05734.1| hypothetical protein L484_011315 [Morus notabilis]
Length=569

 Score =   353 bits (906),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLL+EEFML+GKWY+R D+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKHDLLEEEFMLRGKWYKRNDVEIKNSRGDVLQCSHYVPIVAP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGQHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+A+VEYLR DGNVSLIGLWGRSMGAVTSLMYGAE  SIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAIVEYLRADGNVSLIGLWGRSMGAVTSLMYGAEDLSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_007147795.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19789.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=590

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KN  GD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDSEFMLKGKWFQRKDVEIKNRHGDILQCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVNYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_007147794.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19788.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=591

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KN  GD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDSEFMLKGKWFQRKDVEIKNRHGDILQCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVNYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|NP_188996.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAT06481.1| At3g23540 [Arabidopsis thaliana]
 gb|AEE76774.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=566

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MDQLVNFIIRPPRAEYDPEHDLLEKKFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQDGN+SLIGLWGRSMGAVTSLMYG E PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGVEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|KHN37552.1| Hypothetical protein glysoja_007255 [Glycine soja]
Length=597

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ME LVNFIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEPLVNFIIRPPRAEYDPKSDLLDHEFMLKGKWFQRKDVEIKNSRGDVLQCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVNYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006419777.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
 gb|ESR33017.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
Length=588

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCRADASEAAIILL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLASNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR DGNVS+IGLWGRSMGAVTSL+YGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRADGNVSMIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_002883434.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59693.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYD ++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDAEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQDGN+SLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006283451.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16349.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=556

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLLD+EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLDQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006283452.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16350.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=558

 Score =   351 bits (901),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLLD+EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLDQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006406019.1| hypothetical protein EUTSA_v10020399mg [Eutrema salsugineum]
 gb|ESQ47472.1| hypothetical protein EUTSA_v10020399mg [Eutrema salsugineum]
Length=566

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLEV NSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEVTNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVE+LRQD N+SLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEFLRQDANISLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_011656643.1| PREDICTED: uncharacterized protein LOC101215845 isoform X2 [Cucumis 
sativus]
 gb|KGN46163.1| hypothetical protein Csa_6G061740 [Cucumis sativus]
Length=595

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLV+LMMELV+
Sbjct  121  LKAVVEYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVELMMELVE  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_008458538.1| PREDICTED: uncharacterized protein LOC103497914 isoform X2 [Cucumis 
melo]
Length=595

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLV+LMMELV+
Sbjct  121  LKAVVEYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVELMMELVE  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010450069.1| PREDICTED: uncharacterized protein LOC104732228 [Camelina sativa]
Length=556

 Score =   351 bits (900),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|KEH32227.1| alpha/beta-hydrolase superfamily protein [Medicago truncatula]
Length=594

 Score =   352 bits (903),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDP +DLLD+EF+L+GKWYQRKD+E+KNSRGDAL+CSHYIPI   
Sbjct  1    MEQLVNFIIRPPRAEYDPNSDLLDKEFLLRGKWYQRKDVELKNSRGDALQCSHYIPIGSA  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L AVV YLR DGNVSLIGLWGRSMGAVT LMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LTAVVNYLRNDGNVSLIGLWGRSMGAVTCLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_009107962.1| PREDICTED: uncharacterized protein LOC103833638 [Brassica rapa]
 emb|CDY18119.1| BnaA01g23800D [Brassica napus]
Length=524

 Score =   350 bits (897),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQ VNFIIRPPRAEYDP++DLL+++FM+KG+WY RKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQFVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYHRKDLEVKNSRGDVLQCSHYMPVELP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAA++LL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAVVLLLSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006597567.1| PREDICTED: uncharacterized protein LOC100781610 isoform X1 [Glycine 
max]
Length=582

 Score =   351 bits (901),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRA+YDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAKYDPKSDLLDHEFMLKGKWFQRKDMEIKNSRGDVLQCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVNYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
             Y
Sbjct  181  KY  182



>ref|XP_006597568.1| PREDICTED: uncharacterized protein LOC100781610 isoform X2 [Glycine 
max]
Length=580

 Score =   351 bits (901),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRA+YDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAKYDPKSDLLDHEFMLKGKWFQRKDMEIKNSRGDVLQCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVNYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
             Y
Sbjct  181  KY  182



>ref|XP_008458537.1| PREDICTED: uncharacterized protein LOC103497914 isoform X1 [Cucumis 
melo]
Length=597

 Score =   352 bits (902),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLV+LMMELV+
Sbjct  121  LKAVVEYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVELMMELVE  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006414745.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
 gb|ESQ56198.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
Length=550

 Score =   350 bits (898),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_011656642.1| PREDICTED: uncharacterized protein LOC101215845 isoform X1 [Cucumis 
sativus]
Length=597

 Score =   352 bits (902),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLV+LMMELV+
Sbjct  121  LKAVVEYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVELMMELVE  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>emb|CDY09027.1| BnaC01g30640D [Brassica napus]
Length=532

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQ VNFIIRPPRAEYDP++DLL+++FM+KG+WY RKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQFVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYHRKDLEVKNSRGDVLQCSHYMPVELP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRAD SEAA++LL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAVVLLLSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLRQDGN+SLIGLWGRSMGAVTSLMYGAE PSIAGM+LDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRQDGNISLIGLWGRSMGAVTSLMYGAEDPSIAGMILDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_011014506.1| PREDICTED: uncharacterized protein LOC105118291 [Populus euphratica]
Length=583

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD+EV+N RGDAL+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDVEVQNGRGDALQCSHYMPIVNP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            + KPLPCVIYCHGNSGCR DASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAIILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L AVV +LRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELV+
Sbjct  121  LMAVVNHLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVE  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|ACJ85572.1| unknown [Medicago truncatula]
Length=464

 Score =   347 bits (889),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P +DLLD+EF+L+GKWYQRKD+E+KNSRGDAL+CSHYIPI   
Sbjct  1    MEQLVNFIIRPPRAEYGPNSDLLDKEFLLRGKWYQRKDVELKNSRGDALQCSHYIPIGSA  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L AVV YLR DGNVSLIGLWGRSMGAVT LMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LTAVVNYLRNDGNVSLIGLWGRSMGAVTCLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_009339931.1| PREDICTED: uncharacterized protein LOC103932104 [Pyrus x bretschneideri]
Length=589

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKN RGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNGRGDVLKCSHYTPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
              KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   GEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV+YLR DGNVSLIGLWGRSMGAVTSL+YGAE PSIAGM  DSPFSDLVDLMMELVD
Sbjct  121  LKTVVDYLRADGNVSLIGLWGRSMGAVTSLLYGAEDPSIAGMGFDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010440497.1| PREDICTED: uncharacterized protein LOC104723788 [Camelina sativa]
Length=559

 Score =   348 bits (893),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG +VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGAYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|NP_193165.7| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
 gb|AEE83410.1| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
Length=558

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNF+IRPPRAEY+P++DLL++EF+LKG+WYQRKDLEVKN RGD L+CSHY+P+  P
Sbjct  1    MEQLVNFVIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010669834.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010669835.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
Length=556

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+E+KNSRGDAL+CSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEIKNSRGDALQCSHYSPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GK LPCVIYCHGNSGCRADASEAAIILLP NITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKLLPCVIYCHGNSGCRADASEAAIILLPLNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV+YLR +GNVS+IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVDYLRLEGNVSMIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010435158.1| PREDICTED: uncharacterized protein LOC104719022 isoform X2 [Camelina 
sativa]
Length=557

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEA I+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEK+D
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAVIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010435157.1| PREDICTED: uncharacterized protein LOC104719022 isoform X1 [Camelina 
sativa]
Length=559

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEA I+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEK+D
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAVIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_002868296.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44555.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score =   345 bits (885),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL++EF+LKG+WYQRKDLEVKN RGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|AES64344.2| alpha/beta hydrolase family protein [Medicago truncatula]
Length=535

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLV FIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KN RGD L+CSHY+PI+ P
Sbjct  1    MEQLVKFIIRPPRAEYDPKSDLLDNEFMLKGKWFQRKDVEIKNDRGDVLQCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCR DASEAA++LLPSNITVF LDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAAMVLLPSNITVFALDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV YLR D NVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVNYLRTDENVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|EPS65169.1| hypothetical protein M569_09610, partial [Genlisea aurea]
Length=431

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEYDPK+DLL+ EFMLKG+WY+RKDLEV NSR D L+CSHY+P+I P
Sbjct  1    MEQLINFIIRPPRAEYDPKHDLLESEFMLKGRWYRRKDLEVVNSRSDVLQCSHYMPLILP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E K LPCVIYCHGNSGCR DASEAA+ILLPSN++VFTLDFSGSGLSGGEHVTLGWNE+DD
Sbjct  61   EDKTLPCVIYCHGNSGCRTDASEAAVILLPSNVSVFTLDFSGSGLSGGEHVTLGWNERDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV+YLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVDYLRADGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>emb|CDY49406.1| BnaCnng17160D [Brassica napus]
Length=505

 Score =   342 bits (877),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLELP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            + +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   QDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_009139528.1| PREDICTED: uncharacterized protein LOC103863543 isoform X1 [Brassica 
rapa]
Length=550

 Score =   343 bits (881),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_009139529.1| PREDICTED: uncharacterized protein LOC103863543 isoform X2 [Brassica 
rapa]
Length=548

 Score =   343 bits (880),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_009139530.1| PREDICTED: uncharacterized protein LOC103863543 isoform X3 [Brassica 
rapa]
Length=546

 Score =   343 bits (879),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>emb|CDY12752.1| BnaC04g28890D [Brassica napus]
Length=506

 Score =   341 bits (874),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010035879.1| PREDICTED: uncharacterized protein LOC104425011 isoform X1 [Eucalyptus 
grandis]
 gb|KCW84317.1| hypothetical protein EUGRSUZ_B01162 [Eucalyptus grandis]
Length=590

 Score =   341 bits (875),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL++FIIRPPRAEY PK DLLD+EFMLK K Y+R DLEVKNSRG+ ++C+HY+P++ P
Sbjct  1    MEQLISFIIRPPRAEYSPKYDLLDDEFMLKDKLYRRNDLEVKNSRGEIIQCTHYVPVVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGA+ PSIAGMVLDSPFSDLVDLMMEL D
Sbjct  121  LKAVVEYLRADGNVSLIGLWGRSMGAVTSLMYGADDPSIAGMVLDSPFSDLVDLMMELAD  180

Query  797  TY  802
            T+
Sbjct  181  TH  182



>ref|XP_010035885.1| PREDICTED: uncharacterized protein LOC104425011 isoform X2 [Eucalyptus 
grandis]
Length=588

 Score =   341 bits (875),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL++FIIRPPRAEY PK DLLD+EFMLK K Y+R DLEVKNSRG+ ++C+HY+P++ P
Sbjct  1    MEQLISFIIRPPRAEYSPKYDLLDDEFMLKDKLYRRNDLEVKNSRGEIIQCTHYVPVVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVVEYLR DGNVSLIGLWGRSMGAVTSLMYGA+ PSIAGMVLDSPFSDLVDLMMEL D
Sbjct  121  LKAVVEYLRADGNVSLIGLWGRSMGAVTSLMYGADDPSIAGMVLDSPFSDLVDLMMELAD  180

Query  797  TY  802
            T+
Sbjct  181  TH  182



>ref|XP_009109570.1| PREDICTED: uncharacterized protein LOC103835198 [Brassica rapa]
Length=530

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 173/183 (95%), Gaps = 1/183 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL++EF+LKG+WYQRKDLEVKNSRGD LKCSHY+P+ C 
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNSRGDTLKCSHYMPVECS  60

Query  437  EGK-PLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  613
            E + PLPCV+YCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLG NEKD
Sbjct  61   EDRRPLPCVVYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGSNEKD  120

Query  614  DLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELV  793
            DLKAVVEYLR D NVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELV
Sbjct  121  DLKAVVEYLRTDVNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELV  180

Query  794  DTY  802
            DTY
Sbjct  181  DTY  183



>ref|XP_004486108.1| PREDICTED: HBS1-like protein-like [Cicer arietinum]
Length=929

 Score =   348 bits (892),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLV FIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVKFIIRPPRAEYDPKSDLLDYEFMLKGKWFQRKDVEIKNSRGDVLQCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +GKPLPCVIYCHGNSGCR DASEAA++LLPSNITVF LDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAAMVLLPSNITVFALDFSGSGISGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR D NVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRADENVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_008223032.1| PREDICTED: uncharacterized protein LOC103322864 [Prunus mume]
Length=582

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 167/182 (92%), Gaps = 9/182 (5%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKNSRGD LKCSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNSRGDVLKCSHYMPIVSP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV+YLR DGNVSLIGLWGRSMGAVTSL+YGAE P         PFSDLVDLMMELVD
Sbjct  121  LRTVVDYLRADGNVSLIGLWGRSMGAVTSLLYGAEDP---------PFSDLVDLMMELVD  171

Query  797  TY  802
            TY
Sbjct  172  TY  173



>emb|CDY12069.1| BnaC03g59850D [Brassica napus]
Length=537

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 173/183 (95%), Gaps = 1/183 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPI-IC  433
            MEQLVNFIIRPPRAEY+P+NDLL++EF+LKG+WYQRKDLEVKNSRGD LKCSHY+P+ + 
Sbjct  1    MEQLVNFIIRPPRAEYNPENDLLEQEFLLKGRWYQRKDLEVKNSRGDTLKCSHYMPVELS  60

Query  434  PEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  613
             + +PLPCV+YCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLG NEKD
Sbjct  61   EDRRPLPCVVYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGSNEKD  120

Query  614  DLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELV  793
            DLKAVVEYLR D NVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELV
Sbjct  121  DLKAVVEYLRTDVNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELV  180

Query  794  DTY  802
            DTY
Sbjct  181  DTY  183



>ref|XP_010942429.1| PREDICTED: uncharacterized protein LOC105060435 isoform X2 [Elaeis 
guineensis]
Length=557

 Score =   335 bits (860),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y PKNDLLD EFML+G+WYQRKDLEV N +G  L+CSHY+P++  
Sbjct  1    MDQLVNFIIRPPRADYSPKNDLLDPEFMLRGRWYQRKDLEVINGQGKKLQCSHYVPLVMT  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSKITVFTLDFSGSGLSDGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV YLR DGNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LRAVVNYLRTDGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_011009032.1| PREDICTED: uncharacterized protein LOC105114237 isoform X3 [Populus 
euphratica]
Length=573

 Score =   336 bits (861),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EF+LKGKWYQRKD+EV+NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFLLKGKWYQRKDVEVQNSRGDVLQCSHYMPIVNP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            + KPLPCVIYCHGNSGCR DASEAAI+LLPSNITV TLDFSGSG+SGG++VTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAIVLLPSNITVLTLDFSGSGISGGDYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L AVV+YLRQDGNVSLIGLWGRSMGAV SLMYGA  PSIAGMVLDSPFSDLVDLMMELV 
Sbjct  121  LMAVVDYLRQDGNVSLIGLWGRSMGAVASLMYGAGDPSIAGMVLDSPFSDLVDLMMELVG  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_011009029.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
 ref|XP_011009030.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
Length=588

 Score =   336 bits (862),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EF+LKGKWYQRKD+EV+NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFLLKGKWYQRKDVEVQNSRGDVLQCSHYMPIVNP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            + KPLPCVIYCHGNSGCR DASEAAI+LLPSNITV TLDFSGSG+SGG++VTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAIVLLPSNITVLTLDFSGSGISGGDYVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L AVV+YLRQDGNVSLIGLWGRSMGAV SLMYGA  PSIAGMVLDSPFSDLVDLMMELV 
Sbjct  121  LMAVVDYLRQDGNVSLIGLWGRSMGAVASLMYGAGDPSIAGMVLDSPFSDLVDLMMELVG  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_002315536.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
 gb|EEF01707.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
Length=563

 Score =   334 bits (856),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD+EV+N RGDAL+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDVEVQNGRGDALQCSHYMPIVNP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            + KPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAVILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMME  787
            L AVV YLRQDGNVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLV   ++
Sbjct  121  LMAVVNYLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVKFAIQ  177



>ref|XP_010942428.1| PREDICTED: uncharacterized protein LOC105060435 isoform X1 [Elaeis 
guineensis]
Length=610

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y PKNDLLD EFML+G+WYQRKDLEV N +G  L+CSHY+P++  
Sbjct  1    MDQLVNFIIRPPRADYSPKNDLLDPEFMLRGRWYQRKDLEVINGQGKKLQCSHYVPLVMT  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSKITVFTLDFSGSGLSDGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV YLR DGNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LRAVVNYLRTDGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_009393893.1| PREDICTED: uncharacterized protein LOC103979459 [Musa acuminata 
subsp. malaccensis]
Length=560

 Score =   333 bits (854),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRA+Y P++DLL++EFMLKG+W+QRKDLEV N RG  L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRADYSPQDDLLEQEFMLKGRWFQRKDLEVINGRGKKLQCSHYVPLVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAI+LLPSNITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKVLPCVIYCHGNSGCRADASEAAIVLLPSNITVFTLDFSGSGLSEGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L AVV+YLR DGNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LTAVVDYLRTDGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>dbj|BAJ88870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV NS+G  L+CSHYIP + P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFQRKDLEVVNSQGKKLQCSHYIPAVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG  LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGTALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGN+S IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNYLRTDGNISCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|EMS48134.1| hypothetical protein TRIUR3_10822 [Triticum urartu]
Length=366

 Score =   326 bits (836),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV NS+G  L+CSHYIP + P
Sbjct  1    MDQLVNFIIRPPRADYSPDDDLLEQEFMLKGRWFQRKDLEVVNSQGKKLQCSHYIPAVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG  LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGTALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGN+S I LWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNYLRTDGNISCIALWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|EMT30875.1| hypothetical protein F775_08510 [Aegilops tauschii]
Length=383

 Score =   327 bits (837),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV NS+G  L+CSHYIP + P
Sbjct  1    MDQLVNFIIRPPRADYSPDDDLLEQEFMLKGRWFQRKDLEVVNSQGKKLQCSHYIPAVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG  LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGTALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGN+S I LWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNYLRTDGNISCIALWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_004984312.1| PREDICTED: uncharacterized protein LOC101769070 isoform X1 [Setaria 
italica]
Length=572

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEVKN  G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFQRKDLEVKNDLGKKLQCSHYMPVVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLP+NITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPTNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVS I LWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNYLRTDGNVSCIALWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|ABF96061.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ26989.1| hypothetical protein OsJ_10915 [Oryza sativa Japonica Group]
Length=574

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRAEY P +DLL++EFMLKG+W+QRKDLEV N +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRAEYSPNDDLLEQEFMLKGRWFQRKDLEVVNGQGKKLQCSHYMPVVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV +LR DGN+S IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNHLRTDGNISCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>gb|EAY90076.1| hypothetical protein OsI_11646 [Oryza sativa Indica Group]
Length=575

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRAEY P +DLL++EFMLKG+W+QRKDLEV N +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRAEYSPNDDLLEQEFMLKGRWFQRKDLEVVNGQGKKLQCSHYMPVVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV +LR DGN+S IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNHLRTDGNISCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>emb|CDO98976.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQL+NFIIRPPRAEY+PKNDLLD+EF LK KWYQRKDLEV N RG+ L+CSHY+PI   
Sbjct  1    MEQLINFIIRPPRAEYNPKNDLLDQEFKLKRKWYQRKDLEVSNCRGEILQCSHYMPIGFS  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRAD SEAAIILLP NITVFTLDFSGSGLSGGE+V+LGWNEKDD
Sbjct  61   EGKALPCVIYCHGNSGCRADGSEAAIILLPLNITVFTLDFSGSGLSGGEYVSLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV+YLR DGNVSLIGLWGRSMGAVTSLMYG E PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LRAVVDYLRADGNVSLIGLWGRSMGAVTSLMYGVEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>emb|CDX90263.1| BnaA08g17210D [Brassica napus]
Length=538

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 171/183 (93%), Gaps = 1/183 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+P++DLL+ EF+LKG+WYQRKDLEVKNSRGD LKCSHY+P+   
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEHEFLLKGRWYQRKDLEVKNSRGDTLKCSHYMPVEHS  60

Query  437  EGK-PLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  613
            E + PLPCV+YCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLG NEKD
Sbjct  61   EDRRPLPCVVYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGSNEKD  120

Query  614  DLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELV  793
            DLKAVVEYLR D NVSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELV
Sbjct  121  DLKAVVEYLRTDVNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELV  180

Query  794  DTY  802
            DTY
Sbjct  181  DTY  183



>ref|XP_008668219.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA45458.1| TPA: hypothetical protein ZEAMMB73_531210 [Zea mays]
Length=566

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+ RKDLEVKN +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFLRKDLEVKNGQGKKLQCSHYMPVVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNYLRTDGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|NP_001141958.1| hypothetical protein [Zea mays]
 gb|ACF87375.1| unknown [Zea mays]
 tpg|DAA45457.1| TPA: hypothetical protein ZEAMMB73_531210 [Zea mays]
Length=564

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+ RKDLEVKN +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFLRKDLEVKNGQGKKLQCSHYMPVVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNYLRTDGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_003557834.1| PREDICTED: uncharacterized protein LOC100838212 [Brachypodium 
distachyon]
Length=573

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV N +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPDDDLLEQEFMLKGRWFQRKDLEVINGQGKKLQCSHYMPVVMP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGKPLPCVIYCHGNSGCRADASEAAIILLP+NITVFTLDFSGSG+S GEHVTLGWNE++D
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPTNITVFTLDFSGSGISEGEHVTLGWNERED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGN+S IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNYLRTDGNISCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_008797057.1| PREDICTED: uncharacterized protein LOC103712341 [Phoenix dactylifera]
Length=591

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRA+Y PKNDLLD+EFMLKG+WYQRKDLEV N +G  L+CSHY+P+   
Sbjct  1    MEQLVNFIIRPPRADYSPKNDLLDQEFMLKGRWYQRKDLEVINGQGKKLQCSHYVPLAMT  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLG NEKDD
Sbjct  61   EGKTLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGCNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+AVV +LR DGNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LRAVVNFLRTDGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006650100.1| PREDICTED: uncharacterized protein LOC102716943 [Oryza brachyantha]
Length=573

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRAEY P +DLL++EFMLK +W+QRKDLEV N +G  L+CSHY+P + P
Sbjct  1    MDQLVNFIIRPPRAEYSPNDDLLEQEFMLKRRWFQRKDLEVVNGQGKKLQCSHYMPTVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNYLRTDGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_006850814.1| PREDICTED: uncharacterized protein LOC18440613 [Amborella trichopoda]
 gb|ERN12395.1| hypothetical protein AMTR_s00025p00118390 [Amborella trichopoda]
Length=554

 Score =   330 bits (846),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRAEY+PK DLLDE+F+LKG+W+QRKDLEV NSRG+ LKC+HY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPKTDLLDEKFVLKGQWFQRKDLEVVNSRGNVLKCTHYLPLNIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EG+ LPCVIYCHGNSGCRADASEAAIILLPS ITVF LDF+GSGLS GEHVTLGWNEKDD
Sbjct  61   EGRSLPCVIYCHGNSGCRADASEAAIILLPSYITVFALDFAGSGLSEGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV +LR+DGN+S IGLWGRSMGA+TSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNHLREDGNISCIGLWGRSMGAMTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>dbj|BAB02772.1| unnamed protein product [Arabidopsis thaliana]
Length=599

 Score =   331 bits (849),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 11/190 (6%)
 Frame = +2

Query  257  MEQLVNFIIRPPR--------AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCS  412
            M+QLVNFIIRPPR        AEYDP++DLL+++FM+KG+WYQRKDLEVKNSRGD L+CS
Sbjct  1    MDQLVNFIIRPPRFDLLVCCRAEYDPEHDLLEKKFMMKGRWYQRKDLEVKNSRGDVLQCS  60

Query  413  HYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVT  592
            HY+P+  PEGKPLPCVIYCHGN   RAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVT
Sbjct  61   HYMPVERPEGKPLPCVIYCHGN---RADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVT  117

Query  593  LGWNEKDDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLV  772
            LGWNEKDDLKAVVE+LRQDGN+SLIGLWGRSMGAVTSLMYG E PSIAGM+LDSPFSDLV
Sbjct  118  LGWNEKDDLKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGVEDPSIAGMILDSPFSDLV  177

Query  773  DLMMELVDTY  802
            DLMMELVDTY
Sbjct  178  DLMMELVDTY  187



>ref|XP_006595393.1| PREDICTED: uncharacterized protein LOC100815597 [Glycine max]
Length=592

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  293  RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCH  472
            +AEYDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P+GKPLPCVIYCH
Sbjct  8    KAEYDPKSDLLDHEFMLKGKWFQRKDVEIKNSRGDVLQCSHYMPIVSPDGKPLPCVIYCH  67

Query  473  GNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDG  652
            GNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDDL+AVV YLR DG
Sbjct  68   GNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDDLRAVVNYLRADG  127

Query  653  NVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
            NVSLIGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVDTY
Sbjct  128  NVSLIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVDTY  177



>gb|ACF83402.1| unknown [Zea mays]
Length=564

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+ RKDLEVKN +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFLRKDLEVKNGQGKKLQCSHYMPVVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWN ++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNGRED  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR DGNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFS+LVDLMMELVD
Sbjct  121  LKAVVNYLRTDGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010278880.1| PREDICTED: uncharacterized protein LOC104612914 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRA+Y+PKNDLL++EF L+G+ + RKDL+V NSRG+ L+CSHY+P + P
Sbjct  1    MEQLVNFIIRPPRADYNPKNDLLEQEFTLQGQRFHRKDLQVTNSRGNVLQCSHYVPDVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSCITVFTLDFSGSGLSEGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR +GNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLMMELVD
Sbjct  121  LKAVVNYLRSEGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMMELVD  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>ref|XP_010255853.1| PREDICTED: uncharacterized protein LOC104596404 [Nelumbo nucifera]
Length=580

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            MEQLVNFIIRPPRA+Y+P+NDL+D+EF L+G+ + RKDL+V NSRG+ L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRADYNPQNDLVDQEFTLRGQRFHRKDLQVTNSRGNVLQCSHYMPVVIP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            EGK LPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSYITVFTLDFSGSGLSEGEHVTLGWNEKDD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LKAVV YLR +GNVS IGLWGRSMGAVTSLMYGAE PSIAGMVLDSPFSDLVDLM+ELV+
Sbjct  121  LKAVVNYLRSNGNVSCIGLWGRSMGAVTSLMYGAEDPSIAGMVLDSPFSDLVDLMLELVE  180

Query  797  TY  802
            TY
Sbjct  181  TY  182



>emb|CAB10208.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78471.1| hypothetical protein [Arabidopsis thaliana]
Length=505

 Score =   317 bits (811),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  296  AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHG  475
            AEY+P++DLL++EF+LKG+WYQRKDLEVKN RGD L+CSHY+P+  PE +PLPCVIYCHG
Sbjct  62   AEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERPEDRPLPCVIYCHG  121

Query  476  NSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGN  655
            NSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLR DGN
Sbjct  122  NSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRTDGN  181

Query  656  VSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
            VSLIGLWGRSMGAVTSLMYGAE PSIA MVLDSPFSDLVDLMMELVDTY
Sbjct  182  VSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVDTY  230



>ref|XP_002311822.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
 gb|EEE89189.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
Length=591

 Score =   310 bits (795),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = +2

Query  254  CMEQLVNFIIRP--PRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPI  427
            CM + + F++      AEY+PK+DLLD+EFMLKGKWYQRKD+EV+NSRGD L+CSHY+PI
Sbjct  3    CMPRKLQFLMTGYLSIAEYNPKHDLLDQEFMLKGKWYQRKDVEVQNSRGDVLQCSHYMPI  62

Query  428  ICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNE  607
            + P+ KPLPCVIYCHGNSGCR DASEAAI+LLPSNITV TLDFSGSG+SGG++VTLGWNE
Sbjct  63   VNPQEKPLPCVIYCHGNSGCRVDASEAAIVLLPSNITVLTLDFSGSGISGGDYVTLGWNE  122

Query  608  KDDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMME  787
            KDDL AVV+YLRQDGNVSLIGLWGRSMGAV SLMYGA  PSIAGMVLDSPFSDLVDLMME
Sbjct  123  KDDLMAVVDYLRQDGNVSLIGLWGRSMGAVASLMYGAGDPSIAGMVLDSPFSDLVDLMME  182

Query  788  LVDTY  802
            LV TY
Sbjct  183  LVGTY  187



>ref|XP_011090821.1| PREDICTED: uncharacterized protein LOC105171411 isoform X6 [Sesamum 
indicum]
Length=588

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +2

Query  338  MLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAII  517
            MLKGKWY RKDLEV NSRGD L+CSHY+PIICPEG  LPCVIYCHGNSGCR DASEAA+I
Sbjct  1    MLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICPEGTKLPCVIYCHGNSGCRTDASEAAVI  60

Query  518  LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGLWGRSMGAV  697
            LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVV+YLR DGNVSLIGLWGRSMGAV
Sbjct  61   LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVDYLRADGNVSLIGLWGRSMGAV  120

Query  698  TSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
            TS+MYGAE PSIAGMVLDSPFSDLVDLMMELVD+Y
Sbjct  121  TSMMYGAEDPSIAGMVLDSPFSDLVDLMMELVDSY  155



>ref|XP_002968666.1| hypothetical protein SELMODRAFT_170125 [Selaginella moellendorffii]
 ref|XP_002989915.1| hypothetical protein SELMODRAFT_184921 [Selaginella moellendorffii]
 gb|EFJ08928.1| hypothetical protein SELMODRAFT_184921 [Selaginella moellendorffii]
 gb|EFJ29782.1| hypothetical protein SELMODRAFT_170125 [Selaginella moellendorffii]
Length=330

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 158/186 (85%), Gaps = 4/186 (2%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE----VKNSRGDALKCSHYIP  424
            ++QLVNF+IRPPRA+Y P +DLL+ EF+LKG  Y+RKDLE    + NSRG  L+CSHY P
Sbjct  2    IDQLVNFVIRPPRADYMPSHDLLEREFVLKGHRYERKDLEASLFITNSRGHVLQCSHYRP  61

Query  425  IICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWN  604
               PE   LPCVIYCHGNSGCRADA+EAAIILLPSNITVFTLDFSGSGLS G++V+LGWN
Sbjct  62   RPLPEDVSLPCVIYCHGNSGCRADANEAAIILLPSNITVFTLDFSGSGLSEGKYVSLGWN  121

Query  605  EKDDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMM  784
            E DDLKAVV +LR+D  VSL+GLWGRSMGAVTSL YGA+ PSIAGMVLDSPFS+L +LM+
Sbjct  122  ETDDLKAVVTHLRKDKQVSLVGLWGRSMGAVTSLFYGAQDPSIAGMVLDSPFSNLFELML  181

Query  785  ELVDTY  802
            ELVD Y
Sbjct  182  ELVDVY  187



>ref|XP_006584122.1| PREDICTED: alpha/beta hydrolase domain-containing protein 13-like 
[Glycine max]
Length=397

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRAEY+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLAGRTYQRQDLELKNTRGYTLKCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKMVVSYLRSNKQISCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_003535011.1| PREDICTED: uncharacterized protein LOC100787162 isoform X1 [Glycine 
max]
 ref|XP_006586805.1| PREDICTED: uncharacterized protein LOC100787162 isoform X2 [Glycine 
max]
Length=496

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NFIIRPPRAEYDP   L ++EF L G+ YQR+DLE+KNSRG ALKCSHY+P   P
Sbjct  2    IEQFINFIIRPPRAEYDPDQYLWEKEFSLAGRTYQRQDLELKNSRGYALKCSHYLPSRLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMEL D
Sbjct  122  LKMVVSHLRSNKQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELAD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KDO78612.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=284

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +   S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FSDL DLM+ELVD
Sbjct  122  LKVVVSYLRGNKQTSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSDLFDLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_004486396.1| PREDICTED: uncharacterized protein LOC101505258 isoform X1 [Cicer 
arietinum]
 ref|XP_004486397.1| PREDICTED: uncharacterized protein LOC101505258 isoform X2 [Cicer 
arietinum]
Length=480

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L ++EF L GK +QRKDLE+KN+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEKEFTLAGKNFQRKDLELKNTRGYTLQCSHYLPSPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
               PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   ANIPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR D  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLM+ELVD
Sbjct  122  LKMVVSYLRSDKQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMIELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_001769780.1| predicted protein [Physcomitrella patens]
 gb|EDQ65342.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   282 bits (721),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 155/184 (84%), Gaps = 2/184 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE--VKNSRGDALKCSHYIPII  430
            MEQLVNF+IRPPRA Y P  DLL++EF+LKG+ Y RKDL+  V N+RG  L+CSHY P  
Sbjct  2    MEQLVNFVIRPPRASYSPSLDLLEQEFLLKGRKYSRKDLQAGVLNNRGHVLQCSHYTPQS  61

Query  431  CPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEK  610
             P+ +PLPCVIYCHGNSGCRADA+EAAIILLP NITVFTLDFSGSGLS G +V+LGWNE 
Sbjct  62   PPDDEPLPCVIYCHGNSGCRADANEAAIILLPCNITVFTLDFSGSGLSDGNYVSLGWNET  121

Query  611  DDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMEL  790
            DDLKAVV +LR D  VS IGLWGRSMGAVT LMYGA+ PSIAGMVLDSPF++L +LMMEL
Sbjct  122  DDLKAVVNHLRTDEKVSRIGLWGRSMGAVTCLMYGAQDPSIAGMVLDSPFANLNNLMMEL  181

Query  791  VDTY  802
            VD Y
Sbjct  182  VDVY  185



>ref|XP_003594373.1| Abhydrolase domain-containing protein [Medicago truncatula]
Length=500

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NFIIRPPRAEYDP   L ++EF L G+ YQRKDLE+KN+RG  LKCSHYIP   P
Sbjct  43   IDQFINFIIRPPRAEYDPDQYLCEKEFTLLGRQYQRKDLELKNARGYTLKCSHYIPSHFP  102

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCR DA+EAA++LLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  103  EDISLPCVIYCHGNSGCRVDANEAAVVLLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  162

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  163  LKMVVSYLRSNKQVSRIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLYDLMMELVD  222

Query  797  TY  802
             Y
Sbjct  223  VY  224



>ref|XP_003550951.1| PREDICTED: uncharacterized protein LOC100784510 isoform X1 [Glycine 
max]
 ref|XP_006600274.1| PREDICTED: uncharacterized protein LOC100784510 isoform X2 [Glycine 
max]
Length=481

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRAEY+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLTGRTYQRQDLELKNTRGYTLKCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKMVVSYLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KDO78613.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=381

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +   S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FSDL DLM+ELVD
Sbjct  122  LKVVVSYLRGNKQTSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSDLFDLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_006449959.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
 gb|ESR63199.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
Length=381

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +   S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FSDL DLM+ELVD
Sbjct  122  LKVVVSYLRGNKQTSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSDLFDLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KDO78610.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=391

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +   S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FSDL DLM+ELVD
Sbjct  122  LKVVVSYLRGNKQTSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSDLFDLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_004984313.1| PREDICTED: uncharacterized protein LOC101769070 isoform X2 [Setaria 
italica]
Length=545

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  338  MLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAII  517
            MLKG+W+QRKDLEVKN  G  L+CSHY+P++ PEGK LPCVIYCHGNSGCRADASEAAII
Sbjct  1    MLKGRWFQRKDLEVKNDLGKKLQCSHYMPVVIPEGKALPCVIYCHGNSGCRADASEAAII  60

Query  518  LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGLWGRSMGAV  697
            LLP+NITVFTLDFSGSGLS GEHVTLGWNEK+DLKAVV YLR DGNVS I LWGRSMGAV
Sbjct  61   LLPTNITVFTLDFSGSGLSEGEHVTLGWNEKEDLKAVVNYLRTDGNVSCIALWGRSMGAV  120

Query  698  TSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
            TSLMYGAE PSIAGMVLDSPFS+LVDLMMELVDTY
Sbjct  121  TSLMYGAEDPSIAGMVLDSPFSNLVDLMMELVDTY  155



>gb|AES64624.2| alpha/beta superfamily hydrolase [Medicago truncatula]
Length=516

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NFIIRPPRAEYDP   L ++EF L G+ YQRKDLE+KN+RG  LKCSHYIP   P
Sbjct  57   IDQFINFIIRPPRAEYDPDQYLCEKEFTLLGRQYQRKDLELKNARGYTLKCSHYIPSHFP  116

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCR DA+EAA++LLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  117  EDISLPCVIYCHGNSGCRVDANEAAVVLLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  176

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  177  LKMVVSYLRSNKQVSRIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLYDLMMELVD  236

Query  797  TY  802
             Y
Sbjct  237  VY  238



>ref|XP_006597639.1| PREDICTED: uncharacterized protein LOC100778204 isoform X8 [Glycine 
max]
Length=350

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAQYDPNQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +L+ +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMEL D
Sbjct  122  LKMVVSHLKSNKLVSHIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELAD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010252925.1| PREDICTED: uncharacterized protein LOC104594357 isoform X2 [Nelumbo 
nucifera]
Length=499

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y+R+DLE+ N RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEADFTLAGRKYKRQDLELVNGRGHTLQCSHYVPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGGE+V+LGW+EKDD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGEYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKVVVSYLRSNKQISCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KEH32722.1| esterase/lipase domain protein [Medicago truncatula]
Length=401

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPFPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L +LMMELVD
Sbjct  122  LKIVVSHLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KJB57898.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=375

 Score =   281 bits (718),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLRSERQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KJB57899.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=395

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLRSERQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KDO78611.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=446

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +   S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FSDL DLM+ELVD
Sbjct  122  LKVVVSYLRGNKQTSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSDLFDLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_007147555.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
 ref|XP_007147556.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
 gb|ESW19549.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
 gb|ESW19550.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
Length=496

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NFIIRPPRAEYDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAEYDPDQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNI+VFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVIYCHGNSGCRADANEAAVILLPSNISVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L  LMMEL D
Sbjct  122  LKMVVSYLRSKKQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYGLMMELAD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KEH32721.1| esterase/lipase domain protein [Medicago truncatula]
Length=440

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPFPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L +LMMELVD
Sbjct  122  LKIVVSHLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_009411958.1| PREDICTED: uncharacterized protein LOC103993570 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=528

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N RG  L+CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWESEFTLAGRKYKRLDLELTNGRGHTLQCSHYVPSFVP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   ESTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK  V +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKTAVSFLRSNKQVSCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_006467246.1| PREDICTED: uncharacterized protein LOC102629222 isoform X1 [Citrus 
sinensis]
 ref|XP_006467247.1| PREDICTED: uncharacterized protein LOC102629222 isoform X2 [Citrus 
sinensis]
 ref|XP_006467248.1| PREDICTED: uncharacterized protein LOC102629222 isoform X3 [Citrus 
sinensis]
 gb|KDO78609.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=486

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +   S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FSDL DLM+ELVD
Sbjct  122  LKVVVSYLRGNKQTSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSDLFDLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_006449960.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
 gb|ESR63200.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
Length=486

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +   S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FSDL DLM+ELVD
Sbjct  122  LKVVVSYLRGNKQTSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSDLFDLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_011658092.1| PREDICTED: uncharacterized protein LOC101211724 isoform X2 [Cucumis 
sativus]
Length=470

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKSFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR + +VS IGLWGRSMGAVTSL+YGAE PS+AGMVLDS FS+L +LMMELVD
Sbjct  122  LKVVVTYLRSNKHVSRIGLWGRSMGAVTSLLYGAEDPSVAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008440941.1| PREDICTED: uncharacterized protein LOC103485206 isoform X2 [Cucumis 
melo]
Length=470

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKNFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  VS IGLWGRSMGAVTSL+YGAE PS+AGMVLDS FS+L +LMMELVD
Sbjct  122  LKVVVTYLRSNKQVSRIGLWGRSMGAVTSLLYGAEDPSVAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KEH32720.1| esterase/lipase domain protein [Medicago truncatula]
Length=502

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPFPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L +LMMELVD
Sbjct  122  LKIVVSHLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_004134817.1| PREDICTED: uncharacterized protein LOC101211724 isoform X1 [Cucumis 
sativus]
 gb|KGN49009.1| hypothetical protein Csa_6G510270 [Cucumis sativus]
Length=489

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKSFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR + +VS IGLWGRSMGAVTSL+YGAE PS+AGMVLDS FS+L +LMMELVD
Sbjct  122  LKVVVTYLRSNKHVSRIGLWGRSMGAVTSLLYGAEDPSVAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008440940.1| PREDICTED: uncharacterized protein LOC103485206 isoform X1 [Cucumis 
melo]
Length=489

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKNFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  VS IGLWGRSMGAVTSL+YGAE PS+AGMVLDS FS+L +LMMELVD
Sbjct  122  LKVVVTYLRSNKQVSRIGLWGRSMGAVTSLLYGAEDPSVAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KJB57903.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=432

 Score =   280 bits (715),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLRSERQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_007154081.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
 gb|ESW26075.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
Length=453

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRAEY+P   L ++EF L  + YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLASRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L +LMMELVD
Sbjct  122  LKMVVSYLRSNKQISHIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_007026441.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY29063.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
Length=378

 Score =   278 bits (710),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L + EF L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEREFTLAGRQYKRQDLELTNARGYMLRCSHYMPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   KETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLRSEKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_006597638.1| PREDICTED: uncharacterized protein LOC100778204 isoform X7 [Glycine 
max]
Length=432

 Score =   280 bits (715),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAQYDPNQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +L+ +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMEL D
Sbjct  122  LKMVVSHLKSNKLVSHIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELAD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KJB57901.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=450

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLRSERQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010647089.1| PREDICTED: uncharacterized protein LOC100242843 [Vitis vinifera]
Length=457

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N RG  L CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKDFTLAGRTYKRQDLELTNGRGHTLHCSHYVPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKVVVSHLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KJB57895.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=473

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLRSERQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_004499344.1| PREDICTED: uncharacterized protein LOC101489957 isoform X1 [Cicer 
arietinum]
 ref|XP_004499345.1| PREDICTED: uncharacterized protein LOC101489957 isoform X2 [Cicer 
arietinum]
Length=497

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L +LMMELVD
Sbjct  122  LKIVVSHLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_007154082.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
 gb|ESW26076.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
Length=499

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRAEY+P   L ++EF L  + YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLASRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L +LMMELVD
Sbjct  122  LKMVVSYLRSNKQISHIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KJB57896.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
 gb|KJB57900.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
 gb|KJB57902.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=496

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLRSERQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008794704.1| PREDICTED: uncharacterized protein LOC103710654 [Phoenix dactylifera]
 ref|XP_008794705.1| PREDICTED: uncharacterized protein LOC103710654 [Phoenix dactylifera]
Length=503

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRAEY+P   L + EF    + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWESEFSFASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG+HV+LGW+EKDD
Sbjct  62   ENSTLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDHVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ V+ +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LRVVISFLRSNKQVSCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|ACN85333.1| unknown [Oryza granulata]
Length=502

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R  ALKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYRRIDLELTNGRDQALKCSHYVPAVIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  122  LKCVVSFLRNNKEVSCIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010252924.1| PREDICTED: uncharacterized protein LOC104594357 isoform X1 [Nelumbo 
nucifera]
Length=500

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE-VKNSRGDALKCSHYIPIIC  433
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y+R+DLE + N RG  L+CSHY+P   
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEADFTLAGRKYKRQDLEQLVNGRGHTLQCSHYVPSPF  61

Query  434  PEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  613
            PE  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGGE+V+LGW+EKD
Sbjct  62   PEDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGEYVSLGWHEKD  121

Query  614  DLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELV  793
            DLK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELV
Sbjct  122  DLKVVVSYLRSNKQISCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELV  181

Query  794  DTY  802
            D Y
Sbjct  182  DVY  184



>ref|XP_006380855.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
 gb|ERP58652.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
Length=331

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = +2

Query  263  QLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEG  442
            Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   PE 
Sbjct  4    QFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFPED  63

Query  443  KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLK  622
             PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DDLK
Sbjct  64   TPLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDDLK  123

Query  623  AVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
             VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F++L DLMMELVD Y
Sbjct  124  VVVSYLRSNKQISCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFANLFDLMMELVDVY  183



>ref|XP_003563634.1| PREDICTED: uncharacterized protein LOC100831715 [Brachypodium 
distachyon]
Length=497

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRLDLELSNERNQTLKCSHYVPSVIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFAGSGLSGGEYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLM+ELVD
Sbjct  122  LKCVVSFLRNNKEVSCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KHN40755.1| Hypothetical protein glysoja_015122 [Glycine soja]
Length=497

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 155/194 (80%), Gaps = 12/194 (6%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE------------VKNSRGDA  400
            +EQ +NFIIRPPRAEYDP   L ++EF L G+ YQR+DLE            +KNSRG A
Sbjct  2    IEQFINFIIRPPRAEYDPDQYLWEKEFSLAGRTYQRQDLEANRLSSFFLTLQLKNSRGYA  61

Query  401  LKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG  580
            LKCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G
Sbjct  62   LKCSHYLPSRLPEDISLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDG  121

Query  581  EHVTLGWNEKDDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPF  760
            +HV+LGW+EKDDLK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F
Sbjct  122  DHVSLGWHEKDDLKMVVSHLRSNKQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAF  181

Query  761  SDLVDLMMELVDTY  802
            S+L DLMMEL D Y
Sbjct  182  SNLYDLMMELADVY  195



>gb|KJB57897.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=524

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLRSERQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_003547304.1| PREDICTED: uncharacterized protein LOC100778204 isoform X1 [Glycine 
max]
 ref|XP_006597633.1| PREDICTED: uncharacterized protein LOC100778204 isoform X2 [Glycine 
max]
 ref|XP_006597634.1| PREDICTED: uncharacterized protein LOC100778204 isoform X3 [Glycine 
max]
Length=492

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAQYDPNQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +L+ +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMEL D
Sbjct  122  LKMVVSHLKSNKLVSHIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELAD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_004965908.1| PREDICTED: uncharacterized protein LOC101783766 [Setaria italica]
Length=502

 Score =   279 bits (714),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRLDLELTNERSQTLKCSHYVPAVIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLS GE+V+LGW+EK D
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSSGEYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK  V +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELV+
Sbjct  122  LKCAVSFLRNNKQVSCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELVE  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|EYU45603.1| hypothetical protein MIMGU_mgv1a0037051mg, partial [Erythranthe 
guttata]
Length=529

 Score =   280 bits (716),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  377  VKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDF  556
            + N RGD L+CSHY+PIICP+G PLPCVIYCHGNSGCR DASEAAIILLPSNITVFTLDF
Sbjct  1    IVNVRGDTLQCSHYVPIICPDGNPLPCVIYCHGNSGCRTDASEAAIILLPSNITVFTLDF  60

Query  557  SGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIA  736
            SGSGLSGGEHVTLGWNEKDDLKAVV+YLR+DGNVSLIGLWGRSMGAVTSLMYGAE PSIA
Sbjct  61   SGSGLSGGEHVTLGWNEKDDLKAVVDYLREDGNVSLIGLWGRSMGAVTSLMYGAEDPSIA  120

Query  737  GMVLDSPFSDLVDLMMELVDTY  802
            GMVLDSPFSDLVDLMMELVDTY
Sbjct  121  GMVLDSPFSDLVDLMMELVDTY  142



>ref|XP_006656239.1| PREDICTED: uncharacterized protein LOC102719683 [Oryza brachyantha]
 gb|ACN85318.1| unknown [Oryza brachyantha]
Length=502

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYRRIDLELTNGRDQTLKCSHYVPAVVP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  122  LKCVVSFLRNNKEVSCIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|NP_001118998.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE83855.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=387

 Score =   275 bits (704),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSR  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSEGDYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|XP_006857594.1| PREDICTED: uncharacterized protein LOC18447435 [Amborella trichopoda]
 gb|ERN19061.1| hypothetical protein AMTR_s00061p00094480 [Amborella trichopoda]
Length=509

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRAEY+P   L + +F + G+ Y+R+DLE+ N RG  L+CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWETDFTIAGRKYKRQDLELTNGRGHVLQCSHYVPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+EKDD
Sbjct  62   ENTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFILDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV++LR +  VS IGLWGRSMGAVTSL+YGAE PS+AGMVLDS FS+L DLMMELVD
Sbjct  122  LKTVVDFLRGNKQVSCIGLWGRSMGAVTSLLYGAEDPSVAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_006380856.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
 gb|ERP58653.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
Length=429

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = +2

Query  263  QLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEG  442
            Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   PE 
Sbjct  4    QFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFPED  63

Query  443  KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLK  622
             PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DDLK
Sbjct  64   TPLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDDLK  123

Query  623  AVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
             VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F++L DLMMELVD Y
Sbjct  124  VVVSYLRSNKQISCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFANLFDLMMELVDVY  183



>gb|ACN85247.1| unknown [Oryza officinalis]
Length=502

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  122  LKCVVSFLRNNKEVSCIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|ACN85219.1| unknown [Oryza punctata]
Length=502

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  122  LKCVVSFLRNNKEVSCIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|ACN85260.1| unknown [Oryza alta]
Length=502

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  122  LKCVVSFLRNNKEVSCIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_007026439.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007026440.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29061.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29062.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=492

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L + EF L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEREFTLAGRQYKRQDLELTNARGYMLRCSHYMPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   KETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLRSEKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_001780178.1| predicted protein [Physcomitrella patens]
 gb|EDQ55019.1| predicted protein [Physcomitrella patens]
Length=328

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 152/187 (81%), Gaps = 5/187 (3%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE-----VKNSRGDALKCSHYI  421
            MEQLVNF+IRPPRA+Y P  DLL +EF+LK + + RKDL+     +   RG  L+CSHY 
Sbjct  2    MEQLVNFVIRPPRADYSPSFDLLSQEFLLKSRKFTRKDLQAGSLLLSGCRGHVLQCSHYT  61

Query  422  PIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGW  601
            P+   E +PLPCVIYCHGNSGCRADA+EAAI+LLP NITVFTLDFSGSGLS G +V+LGW
Sbjct  62   PLSPLEDEPLPCVIYCHGNSGCRADANEAAIVLLPCNITVFTLDFSGSGLSDGNYVSLGW  121

Query  602  NEKDDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLM  781
            NEKDDLKAVV +LR D  VS IGLWGRSMGAVT LMYGA+ PSIA MVLDSPF++L +LM
Sbjct  122  NEKDDLKAVVNHLRTDEKVSRIGLWGRSMGAVTCLMYGAQDPSIACMVLDSPFANLNNLM  181

Query  782  MELVDTY  802
            MELVD Y
Sbjct  182  MELVDVY  188



>ref|XP_004951562.1| PREDICTED: uncharacterized protein LOC101776234 [Setaria italica]
Length=503

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPR+EYDP   L D EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYDPDQYLWDTEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILL SNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLSSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK  V  LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F++L DLMMELVD
Sbjct  122  LKCAVSCLRANKQVSSIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFTNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_006350228.1| PREDICTED: uncharacterized protein LOC102589452 isoform X2 [Solanum 
tuberosum]
Length=490

 Score =   277 bits (708),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L ++EF L G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQFLWEKEFSLGGRKYKREDFELKNERGHTLRCSHYTPSSFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVVTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKVVVSYLRSNLKVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_006350227.1| PREDICTED: uncharacterized protein LOC102589452 isoform X1 [Solanum 
tuberosum]
Length=492

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L ++EF L G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQFLWEKEFSLGGRKYKREDFELKNERGHTLRCSHYTPSSFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVVTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKVVVSYLRSNLKVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|ACN85273.1| unknown [Oryza alta]
Length=502

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWETEFTLAGRKYRRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +    PCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTAFPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  122  LKCVVSFLRNNKEVSCIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010434714.1| PREDICTED: uncharacterized protein LOC104718633 isoform X2 [Camelina 
sativa]
Length=505

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHYIP    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYIPSSSQ  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|XP_010434713.1| PREDICTED: uncharacterized protein LOC104718633 isoform X1 [Camelina 
sativa]
Length=506

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHYIP    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYIPSSSQ  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|XP_006373549.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
 ref|XP_006373550.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
 gb|ERP51346.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
 gb|ERP51347.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
Length=482

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G+HV+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDHVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F++L DLMMELVD
Sbjct  122  LKVVVSYLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFANLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_012082208.1| PREDICTED: uncharacterized protein LOC105642121 isoform X2 [Jatropha 
curcas]
Length=488

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L + +F L  + Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  4    IDQFINFVIRPPRADYNPDQYLWERDFTLASRAYKRQDLELTNARGHTLRCSHYVPSPFP  63

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  64   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  123

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK V+ YLR +  +S IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  124  LKVVISYLRSNQQISCIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  183

Query  797  TY  802
             Y
Sbjct  184  VY  185



>ref|XP_009802385.1| PREDICTED: uncharacterized protein LOC104247929 isoform X2 [Nicotiana 
sylvestris]
Length=490

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA+Y+P+  L ++EF + G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IEQFINFVIRPPRADYNPEQFLWEKEFSVGGRKYKREDFELKNERGHTLQCSHYTPSSFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVLTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKVVVSHLRSNLKVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_004514786.1| PREDICTED: uncharacterized protein LOC101501041 isoform X1 [Cicer 
arietinum]
Length=495

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA+Y+P   L + EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEREFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDF GSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFLGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L +LMMELVD
Sbjct  122  LKIVVSHLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYNLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KDP29023.1| hypothetical protein JCGZ_16412 [Jatropha curcas]
Length=493

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L + +F L  + Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWERDFTLASRAYKRQDLELTNARGHTLRCSHYVPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK V+ YLR +  +S IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKVVISYLRSNQQISCIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008782969.1| PREDICTED: uncharacterized protein LOC103702352 isoform X2 [Phoenix 
dactylifera]
Length=503

 Score =   276 bits (707),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q VNF+IRPPRAEYDP   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFVNFVIRPPRAEYDPDQYLWESEFTLASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMEL D
Sbjct  122  LRIVVSFLRSNKQVSCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELGD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010942494.1| PREDICTED: uncharacterized protein LOC105060476 [Elaeis guineensis]
Length=503

 Score =   276 bits (707),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWESEFTLASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   EDTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  122  LRIVVSFLRSNKQVSCIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_012082205.1| PREDICTED: uncharacterized protein LOC105642121 isoform X1 [Jatropha 
curcas]
 ref|XP_012082206.1| PREDICTED: uncharacterized protein LOC105642121 isoform X1 [Jatropha 
curcas]
Length=495

 Score =   276 bits (706),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L + +F L  + Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  4    IDQFINFVIRPPRADYNPDQYLWERDFTLASRAYKRQDLELTNARGHTLRCSHYVPSPFP  63

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  64   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  123

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK V+ YLR +  +S IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  124  LKVVISYLRSNQQISCIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  183

Query  797  TY  802
             Y
Sbjct  184  VY  185



>ref|XP_002525239.1| catalytic, putative [Ricinus communis]
 gb|EEF37205.1| catalytic, putative [Ricinus communis]
Length=493

 Score =   276 bits (706),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA Y+P   L + +F L G+ Y+R DLE+ N RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAAYNPDQYLWERDFTLAGRAYKRLDLELTNIRGHTLQCSHYVPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKVVVSYLRSSKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_009620526.1| PREDICTED: uncharacterized protein LOC104112345 [Nicotiana tomentosiformis]
Length=490

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA+Y+P+  L ++EF + G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IEQFINFVIRPPRADYNPEQFLWEKEFSVGGRKYKREDFELKNERGHTLQCSHYTPSSFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVLTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKVVVSHLRSNLKVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|NP_193448.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 dbj|BAC43443.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83854.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=502

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSR  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSEGDYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|NP_001058047.1| Os06g0609700 [Oryza sativa Japonica Group]
 dbj|BAD35477.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19961.1| Os06g0609700 [Oryza sativa Japonica Group]
 dbj|BAG90325.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80956.1| hypothetical protein OsI_23672 [Oryza sativa Indica Group]
 gb|EEE66001.1| hypothetical protein OsJ_21943 [Oryza sativa Japonica Group]
 gb|ACN85169.1| unknown [Oryza nivara]
 gb|ACN85186.1| unknown [Oryza rufipogon]
 gb|ACN85202.1| unknown [Oryza glaberrima]
Length=502

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK  V +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAG+VLDS FS+L DLMMELVD
Sbjct  122  LKCAVSFLRNNKEVSCIGLWGRSMGAVTSLLYGAEDPSIAGLVLDSAFSNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010530100.1| PREDICTED: uncharacterized protein LOC104806750 isoform X6 [Tarenaya 
hassleriana]
Length=377

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YL+    VS IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLKNSKLVSRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|AFW70735.1| hypothetical protein ZEAMMB73_068292 [Zea mays]
Length=444

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK  V  LR +  VS IGLWGRSMGAVT L+YGAE PSI GM+LDS F++L DLMMELVD
Sbjct  122  LKCAVSCLRDNKQVSTIGLWGRSMGAVTCLLYGAEDPSIGGMILDSAFTNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008782966.1| PREDICTED: uncharacterized protein LOC103702352 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782967.1| PREDICTED: uncharacterized protein LOC103702352 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782968.1| PREDICTED: uncharacterized protein LOC103702352 isoform X1 [Phoenix 
dactylifera]
Length=535

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q VNF+IRPPRAEYDP   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFVNFVIRPPRAEYDPDQYLWESEFTLASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMEL D
Sbjct  122  LRIVVSFLRSNKQVSCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELGD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010440051.1| PREDICTED: uncharacterized protein LOC104723387 isoform X4 [Camelina 
sativa]
Length=475

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSI+GMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSISGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|XP_010440050.1| PREDICTED: uncharacterized protein LOC104723387 isoform X3 [Camelina 
sativa]
Length=500

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSI+GMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSISGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|XP_010233983.1| PREDICTED: uncharacterized protein LOC100830635 isoform X2 [Brachypodium 
distachyon]
Length=496

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPR+EY+P   L + EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWETEFILAGRRYKRLDLELTNARGHTLKCSHYVPAFIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKED  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK+VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIA MVLDS F++L  LM+ELVD
Sbjct  122  LKSVVSFLRTNKQVSRIGLWGRSMGAVTSLLYGAEDPSIAAMVLDSAFTNLHGLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010440048.1| PREDICTED: uncharacterized protein LOC104723387 isoform X1 [Camelina 
sativa]
Length=502

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSI+GMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSISGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|XP_010686591.1| PREDICTED: uncharacterized protein LOC104900779 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=415

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA YDP   L ++EF L G+ Y+R+DLE+++ RG+ LKCSHY+P + P
Sbjct  2    IEQFINFVIRPPRAVYDPDQYLWEKEFTLAGRAYKREDLELESGRGETLKCSHYMPYLNP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EA  +LLP+NITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   EDSALPCVVYCHGNSGCRADANEAVTVLLPANITVFTLDFSGSGLSEGNYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV YLR   +VS IGLWGRSMGAVTSL+YG+E PSI+GMVLDS FS+L DLMMELVD
Sbjct  122  LRVVVAYLRSKDHVSHIGLWGRSMGAVTSLLYGSEDPSISGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_003571271.1| PREDICTED: uncharacterized protein LOC100830635 isoform X1 [Brachypodium 
distachyon]
Length=500

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPR+EY+P   L + EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWETEFILAGRRYKRLDLELTNARGHTLKCSHYVPAFIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKED  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK+VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIA MVLDS F++L  LM+ELVD
Sbjct  122  LKSVVSFLRTNKQVSRIGLWGRSMGAVTSLLYGAEDPSIAAMVLDSAFTNLHGLMLELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008644127.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=471

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK  V  LR +  VS IGLWGRSMGAVT L+YGAE PSI GM+LDS F++L DLMMELVD
Sbjct  122  LKCAVSCLRDNKQVSTIGLWGRSMGAVTCLLYGAEDPSIGGMILDSAFTNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010440049.1| PREDICTED: uncharacterized protein LOC104723387 isoform X2 [Camelina 
sativa]
Length=501

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSI+GMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSISGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|XP_002870121.1| hypothetical protein ARALYDRAFT_915007 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46380.1| hypothetical protein ARALYDRAFT_915007 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTECKRQDLELTNSRGHTLRCSHYVPSSSL  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSEGDYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSDQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|XP_010449663.1| PREDICTED: uncharacterized protein LOC104731865 isoform X1 [Camelina 
sativa]
Length=500

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKREDLELTNSRGHTLRCSHYVPSSSQ  70

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   DDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  130

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  131  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  190

Query  797  TY  802
             Y
Sbjct  191  VY  192



>ref|XP_011040087.1| PREDICTED: uncharacterized protein LOC105136438 isoform X3 [Populus 
euphratica]
Length=482

 Score =   273 bits (699),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F++L DLMMELVD
Sbjct  122  LKVVVSYLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFANLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_011040085.1| PREDICTED: uncharacterized protein LOC105136438 isoform X1 [Populus 
euphratica]
Length=497

 Score =   274 bits (700),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F++L DLMMELVD
Sbjct  122  LKVVVSYLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFANLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_011040086.1| PREDICTED: uncharacterized protein LOC105136438 isoform X2 [Populus 
euphratica]
Length=493

 Score =   274 bits (700),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F++L DLMMELVD
Sbjct  122  LKVVVSYLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFANLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010319209.1| PREDICTED: uncharacterized protein LOC101251464 [Solanum lycopersicum]
Length=490

 Score =   273 bits (699),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L ++EF L G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQFLWEKEFSLGGRKYKREDFELKNERGHTLRCSHYTPSSFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVVTLDFSGSGLSDGNYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV +LR +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKVVVSHLRSNLKVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|NP_001170041.1| hypothetical protein [Zea mays]
 gb|ACN35611.1| unknown [Zea mays]
 gb|AFW70736.1| hypothetical protein ZEAMMB73_068292 [Zea mays]
Length=504

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK  V  LR +  VS IGLWGRSMGAVT L+YGAE PSI GM+LDS F++L DLMMELVD
Sbjct  122  LKCAVSCLRDNKQVSTIGLWGRSMGAVTCLLYGAEDPSIGGMILDSAFTNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008649080.1| PREDICTED: uncharacterized protein LOC103629745 [Zea mays]
Length=501

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRLDLELTNERSQTLKCSHYVPAVIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLS G++V+LGW+EK D
Sbjct  62   ENTSLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSSGDYVSLGWHEKQD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK  V +LR++  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F++L DLMMELV+
Sbjct  122  LKCAVSFLRKNKQVSCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFANLYDLMMELVE  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008644126.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=502

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK  V  LR +  VS IGLWGRSMGAVT L+YGAE PSI GM+LDS F++L DLMMELVD
Sbjct  122  LKCAVSCLRDNKQVSTIGLWGRSMGAVTCLLYGAEDPSIGGMILDSAFTNLYDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010530099.1| PREDICTED: uncharacterized protein LOC104806750 isoform X5 [Tarenaya 
hassleriana]
Length=419

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YL+    VS IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLKNSKLVSRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010686590.1| PREDICTED: uncharacterized protein LOC104900779 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=439

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA YDP   L ++EF L G+ Y+R+DLE+++ RG+ LKCSHY+P + P
Sbjct  2    IEQFINFVIRPPRAVYDPDQYLWEKEFTLAGRAYKREDLELESGRGETLKCSHYMPYLNP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EA  +LLP+NITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   EDSALPCVVYCHGNSGCRADANEAVTVLLPANITVFTLDFSGSGLSEGNYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV YLR   +VS IGLWGRSMGAVTSL+YG+E PSI+GMVLDS FS+L DLMMELVD
Sbjct  122  LRVVVAYLRSKDHVSHIGLWGRSMGAVTSLLYGSEDPSISGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010530097.1| PREDICTED: uncharacterized protein LOC104806750 isoform X3 [Tarenaya 
hassleriana]
Length=475

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YL+    VS IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLKNSKLVSRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010530091.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530092.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530094.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530095.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
Length=494

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YL+    VS IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  122  LKIVVSYLKNSKLVSRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_006414266.1| hypothetical protein EUTSA_v10027147mg [Eutrema salsugineum]
 gb|ESQ55719.1| hypothetical protein EUTSA_v10027147mg [Eutrema salsugineum]
Length=505

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L +++F +     +R+DLE+ NSRG  L+CSHYIP    
Sbjct  12   IDQFINFVIRPPRAEYDPDQYLWEKDFSIGSTKCKRQDLELTNSRGHTLRCSHYIPSSSL  71

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  72   EDNPLPCVIYCHGNSGCRADANEAAMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  131

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  132  LKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSGFSNLFDLMMELVD  191

Query  797  TY  802
             Y
Sbjct  192  VY  193



>ref|XP_010686588.1| PREDICTED: uncharacterized protein LOC104900779 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA YDP   L ++EF L G+ Y+R+DLE+++ RG+ LKCSHY+P + P
Sbjct  2    IEQFINFVIRPPRAVYDPDQYLWEKEFTLAGRAYKREDLELESGRGETLKCSHYMPYLNP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EA  +LLP+NITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   EDSALPCVVYCHGNSGCRADANEAVTVLLPANITVFTLDFSGSGLSEGNYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV YLR   +VS IGLWGRSMGAVTSL+YG+E PSI+GMVLDS FS+L DLMMELVD
Sbjct  122  LRVVVAYLRSKDHVSHIGLWGRSMGAVTSLLYGSEDPSISGMVLDSAFSNLFDLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_010058007.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104445782 
[Eucalyptus grandis]
Length=491

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N RG  LKCSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEKDFTLAGRSYKRQDLELTNKRGHTLKCSHYVPAPLP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNS CRADA+EA +ILLPSNITVFTLDFSGSGLS GE V+LGW+EK+D
Sbjct  62   EETPLPCVIYCHGNSXCRADANEAVVILLPSNITVFTLDFSGSGLSDGEFVSLGWHEKND  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            L+ VV +LR +  +S IGLWGRSMGAVTS++YGAE PSIAGMVLDS FS+L DLM+EL D
Sbjct  122  LQVVVSHLRSNKQISRIGLWGRSMGAVTSILYGAEDPSIAGMVLDSAFSNLFDLMLELAD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KFK32200.1| hypothetical protein AALP_AA6G210300 [Arabis alpina]
Length=493

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L D++F L G   QR+DLE+ NSRG  L+CSHYIP    
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWDKDFTLAGTNCQRQDLELTNSRGHTLRCSHYIP--SS  59

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
               PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  60   HTPPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  119

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR   +VS IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  120  LKTVVTYLRNSNHVSRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  179

Query  797  TY  802
             Y
Sbjct  180  VY  181



>ref|XP_009108297.1| PREDICTED: uncharacterized protein LOC103833996 isoform X1 [Brassica 
rapa]
Length=500

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L +++F + G   +R+DLE+ NSRG  L+CSHYIP    
Sbjct  12   IDQFINFVIRPPRAEYDPDQYLWEKDFSIGGTKCKRQDLELTNSRGHTLRCSHYIPSSSL  71

Query  437  EGK-PLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  613
            E   PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EKD
Sbjct  72   ENTTPLPCVIYCHGNSGCRADANEAAMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKD  131

Query  614  DLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELV  793
            DLK VV YLR    VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELV
Sbjct  132  DLKTVVSYLRSSNQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELV  191

Query  794  DTY  802
            D Y
Sbjct  192  DVY  194



>ref|XP_007213932.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
 gb|EMJ15131.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
Length=491

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFTLAGRTYIRQDLELTNARGHTLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDASLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L  LMMELVD
Sbjct  122  LKVVVSYLRSNKQISRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLYVLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_007213931.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
 gb|EMJ15130.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
Length=492

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFTLAGRTYIRQDLELTNARGHTLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDASLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L  LMMELVD
Sbjct  122  LKVVVSYLRSNKQISRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLYVLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_011460088.1| PREDICTED: uncharacterized protein LOC101309618 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            + Q +NF+IRPPRA+Y+P   L + +F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRADYNPDQYLWERDFTLAGRAYKRQDLELTNARGHTLQCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDSSLPCVVYCHGNSGCRADANEAALILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L  LMMELVD
Sbjct  122  LKIVVSYLRSNKQISRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLYVLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_004293431.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460084.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460085.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460086.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            + Q +NF+IRPPRA+Y+P   L + +F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRADYNPDQYLWERDFTLAGRAYKRQDLELTNARGHTLQCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDSSLPCVVYCHGNSGCRADANEAALILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L  LMMELVD
Sbjct  122  LKIVVSYLRSNKQISRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLYVLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008224685.1| PREDICTED: uncharacterized protein LOC103324410 [Prunus mume]
Length=480

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y R+DLE+ N+RG  L CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFTLAGRTYIRQDLELTNARGHTLHCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDASLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR +  +S IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L  LMMELVD
Sbjct  122  LKVVVSYLRSNKQISRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLYVLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|KHN14394.1| Hypothetical protein glysoja_012432 [Glycine soja]
Length=494

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 148/184 (80%), Gaps = 2/184 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNS--RGDALKCSHYIPII  430
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE       G  L+CSHY+P  
Sbjct  2    IEQFINFIIRPPRAQYDPDQYLWEKEFTLAGRTYQRQDLEASMDIFLGYTLQCSHYLPSP  61

Query  431  CPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEK  610
             PE   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS GEHV+LGW+EK
Sbjct  62   LPEDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGEHVSLGWHEK  121

Query  611  DDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMEL  790
            DDLK VV +L+ +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMEL
Sbjct  122  DDLKMVVSHLKSNKLVSHIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMEL  181

Query  791  VDTY  802
             D Y
Sbjct  182  ADVY  185



>ref|XP_008384339.1| PREDICTED: uncharacterized protein LOC103446950 isoform X3 [Malus 
domestica]
Length=456

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            + Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR       IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS L  LMMELVD
Sbjct  122  LKIVVSYLRSKKQNLRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSSLYVLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008384332.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384333.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384335.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384336.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384337.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
Length=483

 Score =   263 bits (673),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            + Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR       IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS L  LMMELVD
Sbjct  122  LKIVVSYLRSKKQNLRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSSLYVLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>ref|XP_008384338.1| PREDICTED: uncharacterized protein LOC103446950 isoform X2 [Malus 
domestica]
Length=482

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            + Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR       IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS L  LMMELVD
Sbjct  122  LKIVVSYLRSKKQNLRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSSLYVLMMELVD  181

Query  797  TY  802
             Y
Sbjct  182  VY  183



>gb|EYU27617.1| hypothetical protein MIMGU_mgv1a005188mg [Erythranthe guttata]
Length=494

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 151/182 (83%), Gaps = 2/182 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DL   N RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRKYKREDLT--NERGHTLRCSHYVPSQFP  59

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +  PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  60   DDSPLPCVIYCHGNSGCRADANEAAVVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKND  119

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK V+ +LR +  +S IGLWGRSMGAVTSL+YG+E PSIAGMVLDS FS+L +LM+EL D
Sbjct  120  LKVVISHLRSNEKISRIGLWGRSMGAVTSLLYGSEDPSIAGMVLDSAFSNLFNLMLELAD  179

Query  797  TY  802
             Y
Sbjct  180  VY  181



>ref|XP_010911200.1| PREDICTED: uncharacterized protein LOC105037208, partial [Elaeis 
guineensis]
Length=182

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  293  RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCH  472
            RAEY+P   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   PE   LPCVIYCH
Sbjct  5    RAEYNPDQYLWESEFTLASRKFKRLDLELTNTRGHTLQCSHYVPSDVPENMALPCVIYCH  64

Query  473  GNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDG  652
            GNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG+HV+LGW+EKDDL+ VV +LR + 
Sbjct  65   GNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDHVSLGWHEKDDLRIVVSFLRSNK  124

Query  653  NVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
             VS IGLWGRSMGAVTSL+YGAE  SIAG+VLDS FS+L DLMMEL D Y
Sbjct  125  QVSCIGLWGRSMGAVTSLLYGAEDLSIAGLVLDSAFSNLFDLMMELGDVY  174



>ref|XP_009374809.1| PREDICTED: uncharacterized protein LOC103963697 [Pyrus x bretschneideri]
Length=491

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            + Q +NF+IRPPRAEY+P +  L E F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNP-DQYLWESFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  60

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            +   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G +V+LGW+E+ D
Sbjct  61   DDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGNYVSLGWHERYD  120

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR    +S IGLWGRSMGAVT L+YGAE PSI+GMVLDS FS L  LMMELVD
Sbjct  121  LKIVVSYLRSKKQISRIGLWGRSMGAVTCLLYGAEDPSISGMVLDSAFSSLYVLMMELVD  180



>ref|XP_004499346.1| PREDICTED: uncharacterized protein LOC101489957 isoform X3 [Cicer 
arietinum]
Length=469

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMV  745
            LK VV +LR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMV
Sbjct  122  LKIVVSHLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMV  164



>ref|XP_009802386.1| PREDICTED: uncharacterized protein LOC104247929 isoform X3 [Nicotiana 
sylvestris]
Length=488

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 144/174 (83%), Gaps = 2/174 (1%)
 Frame = +2

Query  287  PP--RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCV  460
            PP  RA+Y+P+  L ++EF + G+ Y+R+D E+KN RG  L+CSHY P   P+G PLPCV
Sbjct  8    PPLSRADYNPEQFLWEKEFSVGGRKYKREDFELKNERGHTLQCSHYTPSSFPDGAPLPCV  67

Query  461  IYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYL  640
            IYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDDLK VV +L
Sbjct  68   IYCHGNSGCRADANEAAVILLSSNITVLTLDFSGSGLSDGDYVSLGWHEKDDLKVVVSHL  127

Query  641  RQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
            R +  VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMELVD Y
Sbjct  128  RSNLKVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVDVY  181



>gb|EEC72683.1| hypothetical protein OsI_06247 [Oryza sativa Indica Group]
Length=514

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 150/201 (75%), Gaps = 19/201 (9%)
 Frame = +2

Query  257  MEQLVNFIIRPPR-----------AEYDPKNDLLDEEFMLKGKWYQRKDLE--------V  379
            +EQ VNF+IRPPR           +EY+P   L + EF+L G+ Y+R DLE        +
Sbjct  2    IEQFVNFVIRPPRYPHSVALVCLWSEYNPDQYLWETEFILAGRKYKRLDLEATLFCLYQL  61

Query  380  KNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFS  559
             N+RG  +KCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA+ILLP+NITVFTLDFS
Sbjct  62   TNARGLTIKCSHYVPAFIPENTSLPCVIYCHGNSGCRADANEAAVILLPANITVFTLDFS  121

Query  560  GSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAG  739
            GSGLSGG++V+LG +EK+DLK VV YLR    VS IGLWGRSMGAVTSL+YGAE  SIAG
Sbjct  122  GSGLSGGDYVSLGCHEKEDLKCVVSYLRTTKQVSCIGLWGRSMGAVTSLLYGAEDSSIAG  181

Query  740  MVLDSPFSDLVDLMMELVDTY  802
            MVLDS F++L  LMMELVD Y
Sbjct  182  MVLDSAFTNLYGLMMELVDVY  202



>ref|XP_010530096.1| PREDICTED: uncharacterized protein LOC104806750 isoform X2 [Tarenaya 
hassleriana]
Length=487

 Score =   253 bits (646),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 142/182 (78%), Gaps = 7/182 (4%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+H        DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDH-------SDD  114

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YL+    VS IGLWGRSMGAVT L+YGAE PSIAGMVLDS FS+L DLMMELVD
Sbjct  115  LKIVVSYLKNSKLVSRIGLWGRSMGAVTCLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD  174

Query  797  TY  802
             Y
Sbjct  175  VY  176



>ref|XP_004514787.1| PREDICTED: uncharacterized protein LOC101501041 isoform X2 [Cicer 
arietinum]
Length=468

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            +EQ +NF+IRPPRA+Y+P   L + EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEREFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDF GSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFLGSGLSDGDYVSLGWHEKDD  121

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMV  745
            LK VV +LR +  +S IGLWGRSMGAVTSL+YGAE PSIAGMV
Sbjct  122  LKIVVSHLRSNKQISRIGLWGRSMGAVTSLLYGAEDPSIAGMV  164



>ref|XP_011090822.1| PREDICTED: uncharacterized protein LOC105171411 isoform X7 [Sesamum 
indicum]
Length=561

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  419  IPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLG  598
            +PIICPEG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLG
Sbjct  1    MPIICPEGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLG  60

Query  599  WNEKDDLKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDL  778
            WNEKDDLKAVV+YLR DGNVSLIGLWGRSMGAVTS+MYGAE PSIAGMVLDSPFSDLVDL
Sbjct  61   WNEKDDLKAVVDYLRADGNVSLIGLWGRSMGAVTSMMYGAEDPSIAGMVLDSPFSDLVDL  120

Query  779  MMELVDTY  802
            MMELVD+Y
Sbjct  121  MMELVDSY  128



>ref|XP_002438665.1| hypothetical protein SORBIDRAFT_10g023905 [Sorghum bicolor]
 gb|EER90032.1| hypothetical protein SORBIDRAFT_10g023905, partial [Sorghum bicolor]
Length=501

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  293  RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCH  472
            R EY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + PE   LPCV+YCH
Sbjct  11   RLEYNPDQYLWEPEFTLAGRKYKRLDLELTNERSQTLKCSHYVPAVIPENTALPCVVYCH  70

Query  473  GNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDG  652
            GNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLS G++V+LGW+EK DLK  V +LR + 
Sbjct  71   GNSGCRADANEAAVILLPSNITLFTLDFAGSGLSSGDYVSLGWHEKQDLKCAVSFLRNNK  130

Query  653  NVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
             VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS F++L DLMMELV+ Y
Sbjct  131  QVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFANLYDLMMELVEVY  180



>emb|CDP04561.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 142/182 (78%), Gaps = 19/182 (10%)
 Frame = +2

Query  257  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  436
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE                    
Sbjct  2    IDQFINFVIRPPRAQYNPDQYLWEKDFTLAGRKYKRQDLEA-------------------  42

Query  437  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  616
             G PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  43   NGTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSGGDYVSLGWHEKND  102

Query  617  LKAVVEYLRQDGNVSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVD  796
            LK VV YLR + N+S IGLWGRSMGAVTSL+YGAE PS+AGMVLDS FS+L  LMMELVD
Sbjct  103  LKVVVSYLRSNPNISRIGLWGRSMGAVTSLLYGAEDPSVAGMVLDSAFSNLFHLMMELVD  162

Query  797  TY  802
             Y
Sbjct  163  VY  164



>dbj|BAK06433.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   239 bits (611),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  338  MLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAII  517
            ML G+ Y+R DLE+ N+RG  LKCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA++
Sbjct  1    MLAGRRYKRIDLELTNARGHTLKCSHYLPAFVPENIALPCVIYCHGNSGCRADANEAAVV  60

Query  518  LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGLWGRSMGAV  697
            LLPSNITVFTLDFSGSGLS G++V+LGW+EK+DLK  V +LR +  VS IGLWGRSMGAV
Sbjct  61   LLPSNITVFTLDFSGSGLSDGDYVSLGWHEKEDLKCAVSFLRTNKQVSRIGLWGRSMGAV  120

Query  698  TSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
            TSL+YGAE PSIAGMVLDS F++L  LMMELVD Y
Sbjct  121  TSLLYGAEDPSIAGMVLDSAFTNLYGLMMELVDVY  155



>ref|XP_006586806.1| PREDICTED: uncharacterized protein LOC100787162 isoform X3 [Glycine 
max]
Length=481

 Score =   237 bits (604),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 132/169 (78%), Gaps = 5/169 (3%)
 Frame = +2

Query  296  AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHG  475
            + Y  +N  L EE      W Q     +KNSRG ALKCSHY+P   PE   LPCVIYCHG
Sbjct  5    STYGKRNSPLQEEHTKGRIWRQ-----LKNSRGYALKCSHYLPSRLPEDISLPCVIYCHG  59

Query  476  NSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGN  655
            NSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDDLK VV +LR +  
Sbjct  60   NSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDDLKMVVSHLRSNKQ  119

Query  656  VSLIGLWGRSMGAVTSLMYGAEYPSIAGMVLDSPFSDLVDLMMELVDTY  802
            VS IGLWGRSMGAVTSL+YGAE PSIAGMVLDS FS+L DLMMEL D Y
Sbjct  120  VSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELADVY  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1655620752480