BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2195

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798644.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.4    3e-16   Nicotiana sylvestris
ref|XP_004250912.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.0    5e-16   
ref|XP_011090146.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  86.7    7e-16   Sesamum indicum [beniseed]
gb|EYU35920.1|  hypothetical protein MIMGU_mgv1a004115mg              85.9    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_006362319.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  84.0    6e-15   Solanum tuberosum [potatoes]
ref|XP_009622478.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  82.0    2e-14   Nicotiana tomentosiformis
ref|XP_010250989.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  75.1    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010250990.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  70.9    9e-11   
ref|XP_010250988.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  70.9    1e-10   
ref|XP_010246627.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  68.9    5e-10   Nelumbo nucifera [Indian lotus]
gb|EPS68450.1|  hypothetical protein M569_06319                       59.3    2e-07   Genlisea aurea
ref|XP_008800259.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  55.8    1e-05   Phoenix dactylifera



>ref|XP_009798644.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24 [Nicotiana 
sylvestris]
Length=531

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +2

Query  365  MTDPKVFIFGSFTEDEIRSLQGHPMKNDVEITFGSLDSATLRSVGILNSNPTKVDYSRGA  544
            M D KV IFGSFTEDEI++LQ  P   DV ITFGSLDSATL+SVG+ N+  T +D+S+  
Sbjct  1    MNDQKVLIFGSFTEDEIKTLQSQPTTTDVGITFGSLDSATLKSVGLFNAKLTDLDHSKKP  60

Query  545  QPSKVFSKEN  574
            QP ++  KEN
Sbjct  61   QPPELAHKEN  70



>ref|XP_004250912.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Solanum 
lycopersicum]
 ref|XP_010313254.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Solanum 
lycopersicum]
Length=534

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +2

Query  365  MTDPKVFIFGSFTEDEIRSLQGHPMKNDVEITFGSLDSATLRSVGILNSNPTKVDYSRGA  544
            M D KV IFGSFTEDEIR+LQ  P   DV ITFGSLDSATL+SVGI ++  T+ D+S+  
Sbjct  1    MNDQKVLIFGSFTEDEIRTLQSQPT-TDVGITFGSLDSATLKSVGIFDTKLTEFDHSKKL  59

Query  545  QPSKVFSKENSKNTSGSTEK  604
            QPS++  +EN      +T K
Sbjct  60   QPSELAHRENVTEGHSNTRK  79



>ref|XP_011090146.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Sesamum 
indicum]
Length=540

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = +2

Query  365  MTDPKVFIFGSFTEDEIRSLQGHPMKNDVEITFGSLDSATLRSVGILNSNPTKVDYSRGA  544
            MT  +V IFGSFTEDEIRS+Q  P KNDV+ITFGSLDS TLRSVGI ++  T +    G+
Sbjct  1    MTHHQVLIFGSFTEDEIRSMQCQPQKNDVDITFGSLDSETLRSVGIFSTRVTDLLSPGGS  60

Query  545  QPSKVFSKENSKNTSGSTEKATIPVIFSQENGSIGGSDLGYHSTAHEVKP  694
            + SK  S    +  S S   + + V F +ENG    +  G +S A E+KP
Sbjct  61   ELSKPASTNVFRLPSISETTSEVEVAFVKENGCRSSTCPG-NSGAKELKP  109



>gb|EYU35920.1| hypothetical protein MIMGU_mgv1a004115mg [Erythranthe guttata]
Length=543

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 64/102 (63%), Gaps = 2/102 (2%)
 Frame = +2

Query  365  MTDPKVFIFGSFTEDEIRSLQGHPMKNDVEITFGSLDSATLRSVGILNSNPTKVDYSRGA  544
            MTD +V IFGSFTEDE+RS+Q  P KNDVE TFGS D  TLRSVGI NS  T++   +G+
Sbjct  1    MTDHQVLIFGSFTEDEVRSMQCQPQKNDVEFTFGSFDIETLRSVGIFNSKVTQIFPLKGS  60

Query  545  QPSKVFSKENSKNTSGSTEKAT--IPVIFSQENGSIGGSDLG  664
            + S      N      S+ ++T  + V F++ENG I  +  G
Sbjct  61   ELSNPAGTPNVFFNPPSSAESTSDLKVAFAEENGYISSACCG  102



>ref|XP_006362319.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Solanum 
tuberosum]
Length=534

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = +2

Query  365  MTDPKVFIFGSFTEDEIRSLQGHPMKNDVEITFGSLDSATLRSVGILNSNPTKVDYSRGA  544
            M D KV IFGSFTEDEI++LQ  P   DV ITFGSLDSATL+SVGI ++  T+ D+S+  
Sbjct  1    MNDQKVLIFGSFTEDEIKTLQSQPT-TDVGITFGSLDSATLKSVGIFDTKLTEFDHSKKL  59

Query  545  QPSKVFSKEN---SKNTSGSTEKA  607
            QPS++  + N   + + +G T+K+
Sbjct  60   QPSELVHRANVTEAHSNTGKTKKS  83



>ref|XP_009622478.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24 [Nicotiana 
tomentosiformis]
Length=533

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  365  MTDPKVFIFGSFTEDEIRSLQGHPMKNDVEITFGSLDSATLRSVGILNSNPTKVDYSRGA  544
            M D KV IFGSFTEDEI++LQ  P   DV I FGSLDSATL+SVG+ N+  T +D+S+  
Sbjct  1    MNDQKVLIFGSFTEDEIKTLQSQPTTTDVGIIFGSLDSATLKSVGLFNTKLTDLDHSKKP  60

Query  545  QPSKVFSKEN  574
            Q  ++  KEN
Sbjct  61   QLPELAHKEN  70



>ref|XP_010250989.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like isoform 
X2 [Nelumbo nucifera]
Length=559

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 69/120 (58%), Gaps = 17/120 (14%)
 Frame = +2

Query  356  SSNMTDPKVFIFGSFTEDEIRSLQGHPMKNDV------EITFGSLDSATLRSVGILNSNP  517
            S  M+  KV IFGSFTEDE+RS Q    +N V      E  FGSLD  T+RS+G LN  P
Sbjct  8    SEKMSGSKVLIFGSFTEDEVRSFQKQSSENAVQPSEKKEFQFGSLDFETIRSLGGLNGEP  67

Query  518  TKVDYSRGA---QPSKVFSKENS----KNTSGSTEKATIPVIFSQENGSIGG-SDLGYHS  673
             + ++++G+   QPSKV  K+N+    K ++ + + A   V   +ENGSI   SD   HS
Sbjct  68   VRTNFTKGSKETQPSKVVGKDNAIKIVKTSNDNLQTAPESV---KENGSIQNTSDCSSHS  124



>ref|XP_010250990.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like isoform 
X3 [Nelumbo nucifera]
Length=500

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 66/113 (58%), Gaps = 17/113 (15%)
 Frame = +2

Query  377  KVFIFGSFTEDEIRSLQGHPMKNDV------EITFGSLDSATLRSVGILNSNPTKVDYSR  538
            +V IFGSFTEDE+RS Q    +N V      E  FGSLD  T+RS+G LN  P + ++++
Sbjct  16   QVLIFGSFTEDEVRSFQKQSSENAVQPSEKKEFQFGSLDFETIRSLGGLNGEPVRTNFTK  75

Query  539  GA---QPSKVFSKENS----KNTSGSTEKATIPVIFSQENGSIGG-SDLGYHS  673
            G+   QPSKV  K+N+    K ++ + + A   V   +ENGSI   SD   HS
Sbjct  76   GSKETQPSKVVGKDNAIKIVKTSNDNLQTAPESV---KENGSIQNTSDCSSHS  125



>ref|XP_010250988.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like isoform 
X1 [Nelumbo nucifera]
Length=560

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 66/113 (58%), Gaps = 17/113 (15%)
 Frame = +2

Query  377  KVFIFGSFTEDEIRSLQGHPMKNDV------EITFGSLDSATLRSVGILNSNPTKVDYSR  538
            +V IFGSFTEDE+RS Q    +N V      E  FGSLD  T+RS+G LN  P + ++++
Sbjct  16   QVLIFGSFTEDEVRSFQKQSSENAVQPSEKKEFQFGSLDFETIRSLGGLNGEPVRTNFTK  75

Query  539  GA---QPSKVFSKENS----KNTSGSTEKATIPVIFSQENGSIGG-SDLGYHS  673
            G+   QPSKV  K+N+    K ++ + + A   V   +ENGSI   SD   HS
Sbjct  76   GSKETQPSKVVGKDNAIKIVKTSNDNLQTAPESV---KENGSIQNTSDCSSHS  125



>ref|XP_010246627.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Nelumbo 
nucifera]
Length=545

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 58/107 (54%), Gaps = 10/107 (9%)
 Frame = +2

Query  365  MTDPKVFIFGSFTEDEIRSLQGHPMKNDVE------ITFGSLDSATLRSVGILNSNPTKV  526
            M+D KVFIFGSFTEDE+RS Q    +N V+      + FGSLD  T+RS+G L   P + 
Sbjct  1    MSDSKVFIFGSFTEDEVRSFQRQASENTVQPLGKKDLRFGSLDFETVRSLGGLKCEPVQA  60

Query  527  DYSRGAQ----PSKVFSKENSKNTSGSTEKATIPVIFSQENGSIGGS  655
            D  +G++    P+ V      K  + +T K        +ENGSI  S
Sbjct  61   DSLKGSKDFQLPNMVVKDNAIKTVNAATNKLQRVSGSMKENGSIQNS  107



>gb|EPS68450.1| hypothetical protein M569_06319, partial [Genlisea aurea]
Length=201

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  KVFIFGSFTEDEIRSLQGHPMKNDVEITFGSLDSATLRSVGILNSNPTKV  526
            +V IFGSFT++E++S+Q  P K ++EI FGS D  TLRSVG+L +  T++
Sbjct  2    QVIIFGSFTKEEVKSIQCQPPKENLEIKFGSFDLKTLRSVGVLATEATEL  51



>ref|XP_008800259.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
24-like [Phoenix dactylifera]
Length=541

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 56/103 (54%), Gaps = 15/103 (15%)
 Frame = +2

Query  365  MTDPKVFIFGSFTEDEIRSLQGHPMKNDV------EITFGSLDSATLRSVGILNSNPTKV  526
            M+D KV IFGSFTEDE R  Q   ++N+V         FGSLDSA+L      N+ P + 
Sbjct  1    MSDHKVLIFGSFTEDETRFFQRQLVENNVCPLEKAGSQFGSLDSASLNPSNGSNAEPKQT  60

Query  527  DYSRGA---QPSKVFSKE-NSKNTSGSTEKATIPVIFSQENGS  643
            D S  +   Q SK+ SK+  +KN     EKA I   F Q+ G+
Sbjct  61   DSSVSSNDIQGSKLVSKDKRTKN-----EKAKISNNFKQDTGA  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1281324548632