BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2193

Length=644
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588215.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    163   9e-44   Nicotiana tomentosiformis
sp|Q8W1W9.1|5MAT1_SALSN  RecName: Full=Malonyl-coenzyme:anthocyan...    160   8e-43   Salvia splendens [bonfire salvia]
ref|XP_009593467.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    160   1e-42   Nicotiana tomentosiformis
gb|EYU24858.1|  hypothetical protein MIMGU_mgv1a024815mg                156   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_011090949.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    155   7e-41   Sesamum indicum [beniseed]
ref|XP_011090972.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    155   1e-40   Sesamum indicum [beniseed]
gb|EYU24860.1|  hypothetical protein MIMGU_mgv1a022453mg                154   2e-40   Erythranthe guttata [common monkey flower]
gb|EYU24851.1|  hypothetical protein MIMGU_mgv1a006146mg                152   1e-39   Erythranthe guttata [common monkey flower]
gb|EYU24855.1|  hypothetical protein MIMGU_mgv1a005957mg                151   2e-39   Erythranthe guttata [common monkey flower]
gb|AAR26386.1|  putative acyltransferase                                150   5e-39   Salvia splendens [bonfire salvia]
gb|AAS77402.1|  quercetin 3-O-glucoside-6''-O-malonyltransferase        150   7e-39   Glandularia x hybrida [garden verbena]
ref|XP_009780993.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    149   1e-38   Nicotiana sylvestris
ref|XP_011093436.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    149   1e-38   Sesamum indicum [beniseed]
sp|Q8GSN8.1|3MAT_DAHPI  RecName: Full=Malonyl-coenzyme A:anthocya...    149   2e-38   Dahlia pinnata
ref|XP_009620758.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    148   2e-38   Nicotiana tomentosiformis
ref|XP_011093437.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    148   2e-38   Sesamum indicum [beniseed]
ref|XP_009620757.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    148   3e-38   Nicotiana tomentosiformis
dbj|BAD93691.1|  malonyltransferase                                     148   3e-38   Nicotiana tabacum [American tobacco]
ref|XP_010657385.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    145   4e-38   
pdb|2XR7|A  Chain A, Crystal Structure Of Nicotiana Tabacum Malon...    147   5e-38   Nicotiana tabacum [American tobacco]
pdb|2E1T|A  Chain A, Crystal Structure Of Dendranthema Morifolium...    147   6e-38   Chrysanthemum x morifolium [florist's chrysanthemum]
pdb|2E1V|A  Chain A, Crystal Structure Of Dendranthema Morifolium...    147   6e-38   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011079049.1|  PREDICTED: anthocyanidin 3-O-glucoside 6''-O...    147   8e-38   Sesamum indicum [beniseed]
ref|XP_011093435.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    146   1e-37   Sesamum indicum [beniseed]
ref|XP_009769443.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    146   2e-37   Nicotiana sylvestris
ref|XP_002313292.2|  hypothetical protein POPTR_0009s06800g             146   2e-37   Populus trichocarpa [western balsam poplar]
gb|AAL50565.1|AF405204_1  malonyl CoA:anthocyanin 5-O-glucoside-6...    145   4e-37   Perilla frutescens [beefsteak-mint]
emb|CAN83833.1|  hypothetical protein VITISV_039456                     145   4e-37   Vitis vinifera
ref|XP_011025419.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    145   6e-37   Populus euphratica
ref|XP_002276090.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    144   7e-37   Vitis vinifera
emb|CAN71050.1|  hypothetical protein VITISV_003717                     144   8e-37   Vitis vinifera
emb|CDP11900.1|  unnamed protein product                                144   1e-36   Coffea canephora [robusta coffee]
emb|CAN64565.1|  hypothetical protein VITISV_044304                     143   1e-36   Vitis vinifera
gb|EYU24862.1|  hypothetical protein MIMGU_mgv1a006330mg                143   1e-36   Erythranthe guttata [common monkey flower]
emb|CAN83656.1|  hypothetical protein VITISV_009941                     143   2e-36   Vitis vinifera
gb|EYU24856.1|  hypothetical protein MIMGU_mgv1a017714mg                143   2e-36   Erythranthe guttata [common monkey flower]
emb|CDP11905.1|  unnamed protein product                                143   3e-36   Coffea canephora [robusta coffee]
emb|CBI18011.3|  unnamed protein product                                143   3e-36   Vitis vinifera
gb|AAS77404.1|  quercetin 3-O-glucoside-6''-O-malonyltransferase        142   4e-36   Lamium purpureum [purple dead-nettle]
ref|XP_006367188.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    142   4e-36   Solanum tuberosum [potatoes]
ref|XP_010657393.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    141   1e-35   Vitis vinifera
ref|XP_011100332.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    140   1e-35   Sesamum indicum [beniseed]
ref|XP_010657386.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    140   1e-35   Vitis vinifera
ref|XP_010940606.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    140   2e-35   Elaeis guineensis
gb|EYU24859.1|  hypothetical protein MIMGU_mgv1a023480mg                140   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_004248143.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    139   8e-35   
gb|AAQ63615.1|  anthocyanidin 3-O-glucoside-6''-O-malonyltransferase    138   9e-35   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_008779426.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    138   1e-34   Phoenix dactylifera
gb|AAS77403.1|  quercetin 3-O-glucoside-6''-O-malonyltransferase        138   2e-34   Glandularia x hybrida [garden verbena]
ref|XP_008346924.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanin ...    137   4e-34   
ref|XP_009354720.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    137   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_007219500.1|  hypothetical protein PRUPE_ppa022332mg             136   5e-34   Prunus persica
ref|XP_011100333.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    136   5e-34   
sp|Q9MBC1.1|3AT_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside ...    136   6e-34   Perilla frutescens [beefsteak-mint]
ref|XP_008231363.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    136   9e-34   Prunus mume [ume]
gb|EYU24861.1|  hypothetical protein MIMGU_mgv1a006931mg                135   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_011658005.1|  PREDICTED: phenolic glucoside malonyltransfe...    135   1e-33   Cucumis sativus [cucumbers]
ref|XP_007043451.1|  HXXXD-type acyl-transferase family protein, ...    135   1e-33   
ref|XP_006362146.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    135   2e-33   Solanum tuberosum [potatoes]
ref|XP_011079048.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    135   2e-33   
ref|XP_002513167.1|  Anthocyanin 5-aromatic acyltransferase, puta...    134   5e-33   Ricinus communis
ref|XP_006361075.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    133   5e-33   Solanum tuberosum [potatoes]
ref|XP_010265765.1|  PREDICTED: phenolic glucoside malonyltransfe...    133   6e-33   Nelumbo nucifera [Indian lotus]
ref|XP_007052549.1|  Malonyl CoA:flavonoid malonyltransferase 5, ...    133   8e-33   
gb|AAO38058.1|  malonyl-coenzyme A: anthocyanidin 3-O-glucoside-6...    133   9e-33   Pericallis cruenta
ref|XP_011079054.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    133   9e-33   Sesamum indicum [beniseed]
dbj|BAF99692.1|  putative anthocyanin acyltransferase                   133   1e-32   Lobelia erinus
ref|XP_010268734.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    133   1e-32   Nelumbo nucifera [Indian lotus]
ref|XP_007033865.1|  HXXXD-type acyl-transferase family protein, ...    132   1e-32   
gb|AAQ63616.1|  anthocyanidin 3-O-glucoside-3'',6''-O-dimalonyltr...    132   1e-32   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAO12207.1|  putative malonyl CoA:anthocyanidin 3-O-glucoside-...    132   2e-32   Dahlia pinnata
ref|XP_006361062.1|  PREDICTED: LOW QUALITY PROTEIN: malonyl-coen...    132   2e-32   
dbj|BAF99691.1|  putative anthocyanin acyltransferase                   132   2e-32   Lobelia erinus
gb|KJB25033.1|  hypothetical protein B456_004G173600                    132   3e-32   Gossypium raimondii
dbj|BAF93857.1|  anthocyanin acyltransferase                            132   3e-32   Torenia hybrid cultivar
gb|EPS62795.1|  hypothetical protein M569_11994                         131   3e-32   Genlisea aurea
gb|EYU32009.1|  hypothetical protein MIMGU_mgv1a006060mg                131   5e-32   Erythranthe guttata [common monkey flower]
gb|EPS62076.1|  hypothetical protein M569_12721                         130   5e-32   Genlisea aurea
ref|XP_010277331.1|  PREDICTED: phenolic glucoside malonyltransfe...    130   6e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006447403.1|  hypothetical protein CICLE_v10015168mg             130   7e-32   Citrus clementina [clementine]
ref|XP_002275913.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    130   7e-32   Vitis vinifera
gb|EYU24852.1|  hypothetical protein MIMGU_mgv1a006230mg                130   9e-32   Erythranthe guttata [common monkey flower]
gb|EYU24853.1|  hypothetical protein MIMGU_mgv1a006246mg                130   9e-32   Erythranthe guttata [common monkey flower]
ref|XP_011100334.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    130   1e-31   Sesamum indicum [beniseed]
ref|XP_003633577.1|  PREDICTED: anthocyanidin 3-O-glucoside 6''-O...    130   1e-31   Vitis vinifera
dbj|BAF49288.1|  hydroxycinnamoyl-CoA:anthocyanin 5-glucoside-6''...    130   1e-31   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_011079053.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    129   2e-31   Sesamum indicum [beniseed]
gb|KDO55796.1|  hypothetical protein CISIN_1g012440mg                   129   2e-31   Citrus sinensis [apfelsine]
ref|XP_002454697.1|  hypothetical protein SORBIDRAFT_04g035790          129   2e-31   Sorghum bicolor [broomcorn]
ref|XP_008457512.1|  PREDICTED: phenolic glucoside malonyltransfe...    128   3e-31   Cucumis melo [Oriental melon]
gb|EYU42209.1|  hypothetical protein MIMGU_mgv1a007129mg                128   4e-31   Erythranthe guttata [common monkey flower]
ref|XP_010261004.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    128   5e-31   Nelumbo nucifera [Indian lotus]
gb|EYU26095.1|  hypothetical protein MIMGU_mgv1a006012mg                127   7e-31   Erythranthe guttata [common monkey flower]
ref|XP_011100429.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    127   7e-31   Sesamum indicum [beniseed]
dbj|BAF99690.1|  putative anthocyanin acyltransferase                   127   1e-30   Lobelia erinus
ref|XP_011658008.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    126   2e-30   Cucumis sativus [cucumbers]
ref|XP_009391701.1|  PREDICTED: phenolic glucoside malonyltransfe...    126   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010089644.1|  Agmatine coumaroyltransferase                      126   2e-30   Morus notabilis
ref|XP_008813246.1|  PREDICTED: phenolic glucoside malonyltransfe...    126   3e-30   Phoenix dactylifera
dbj|BAF99693.1|  putative anthocyanin acyltransferase                   125   3e-30   Lobelia erinus
ref|XP_008457511.1|  PREDICTED: phenolic glucoside malonyltransfe...    125   4e-30   Cucumis melo [Oriental melon]
ref|XP_010035652.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    123   4e-30   Eucalyptus grandis [rose gum]
ref|XP_010102960.1|  Anthocyanin 5-aromatic acyltransferase             124   4e-30   
gb|EYU26094.1|  hypothetical protein MIMGU_mgv1a005927mg                125   4e-30   Erythranthe guttata [common monkey flower]
ref|XP_010257336.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    125   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_008779727.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    125   5e-30   Phoenix dactylifera
ref|XP_004954208.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    125   5e-30   Setaria italica
gb|AAR28757.1|  anthocyanin 3-O-glucoside-6''-O-hydroxycinnamoylt...    125   6e-30   Salvia splendens [bonfire salvia]
gb|EYU26102.1|  hypothetical protein MIMGU_mgv1a005739mg                125   6e-30   Erythranthe guttata [common monkey flower]
ref|XP_010035651.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    123   7e-30   Eucalyptus grandis [rose gum]
gb|KJB50065.1|  hypothetical protein B456_008G151700                    124   9e-30   Gossypium raimondii
gb|KHN37926.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-...    120   1e-29   Glycine soja [wild soybean]
ref|XP_008457510.1|  PREDICTED: phenolic glucoside malonyltransfe...    124   1e-29   Cucumis melo [Oriental melon]
gb|EYU17682.1|  hypothetical protein MIMGU_mgv1a023077mg                124   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_010263233.1|  PREDICTED: agmatine coumaroyltransferase-like      124   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_011047481.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    123   3e-29   Populus euphratica
ref|XP_010274321.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    123   3e-29   Nelumbo nucifera [Indian lotus]
ref|XP_008679228.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    123   3e-29   Zea mays [maize]
dbj|BAD44688.1|  Hydroxycinnamoyl-CoA:anthocyanin 5-glucoside-6-O...    123   4e-29   Gentiana scabra var. buergeri
sp|Q9ZWR8.1|ANTA_GENTR  RecName: Full=Anthocyanin 5-aromatic acyl...    122   4e-29   Gentiana triflora
ref|XP_010918788.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    122   4e-29   Elaeis guineensis
ref|XP_008454724.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    122   5e-29   Cucumis melo [Oriental melon]
gb|KDO38874.1|  hypothetical protein CISIN_1g036678mg                   122   5e-29   Citrus sinensis [apfelsine]
ref|XP_010035650.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    122   6e-29   Eucalyptus grandis [rose gum]
ref|XP_006451717.1|  hypothetical protein CICLE_v10010154mg             122   6e-29   
ref|XP_007043458.1|  HXXXD-type acyl-transferase family protein, ...    122   7e-29   
ref|XP_010102963.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside...    122   7e-29   Morus notabilis
emb|CDP11903.1|  unnamed protein product                                122   8e-29   Coffea canephora [robusta coffee]
ref|XP_010246275.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    121   9e-29   Nelumbo nucifera [Indian lotus]
ref|XP_004151485.2|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    121   1e-28   Cucumis sativus [cucumbers]
ref|XP_010089639.1|  Agmatine coumaroyltransferase                      121   1e-28   Morus notabilis
ref|XP_004487342.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    121   1e-28   Cicer arietinum [garbanzo]
ref|XP_010089640.1|  Anthocyanin 5-aromatic acyltransferase             121   1e-28   Morus notabilis
ref|XP_009397893.1|  PREDICTED: phenolic glucoside malonyltransfe...    121   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012065542.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    120   2e-28   
gb|AGT37413.1|  anthocyanin 5-aromatic acyltransferase                  120   2e-28   
ref|XP_009629767.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    120   4e-28   Nicotiana tomentosiformis
ref|XP_007042677.1|  HXXXD-type acyl-transferase family protein, ...    120   4e-28   
ref|XP_006664958.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    119   4e-28   
ref|XP_009382788.1|  PREDICTED: anthocyanidin 3-O-glucoside 6''-O...    119   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS62073.1|  hypothetical protein M569_12718                         119   6e-28   Genlisea aurea
ref|XP_012084834.1|  PREDICTED: phenolic glucoside malonyltransfe...    119   6e-28   Jatropha curcas
gb|AIS92513.1|  putative anthocyanin acyltransferase                    119   7e-28   Epimedium sagittatum
ref|XP_008231014.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    118   1e-27   Prunus mume [ume]
ref|XP_008797924.1|  PREDICTED: LOW QUALITY PROTEIN: malonyl-coen...    117   2e-27   
ref|XP_009397892.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...    117   2e-27   
gb|KGN65691.1|  hypothetical protein Csa_1G499320                       117   3e-27   Cucumis sativus [cucumbers]
ref|XP_010107164.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside...    117   3e-27   Morus notabilis
ref|XP_011079059.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    117   3e-27   Sesamum indicum [beniseed]
ref|XP_003599128.1|  Anthocyanin 5-aromatic acyltransferase             117   3e-27   Medicago truncatula
ref|XP_011468648.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    116   3e-27   Fragaria vesca subsp. vesca
ref|XP_010105247.1|  Agmatine coumaroyltransferase                      117   3e-27   Morus notabilis
ref|XP_010089642.1|  Agmatine coumaroyltransferase                      117   4e-27   Morus notabilis
ref|XP_003552578.1|  PREDICTED: phenolic glucoside malonyltransfe...    117   5e-27   Glycine max [soybeans]
ref|XP_010089643.1|  Agmatine coumaroyltransferase                      116   6e-27   
ref|XP_011467880.1|  PREDICTED: phenolic glucoside malonyltransfe...    116   7e-27   Fragaria vesca subsp. vesca
ref|XP_009774760.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    116   7e-27   Nicotiana sylvestris
ref|XP_007217864.1|  hypothetical protein PRUPE_ppa021495mg             116   8e-27   Prunus persica
ref|XP_010030472.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    116   1e-26   Eucalyptus grandis [rose gum]
ref|XP_004308681.1|  PREDICTED: phenolic glucoside malonyltransfe...    115   1e-26   Fragaria vesca subsp. vesca
ref|XP_007033867.1|  HXXXD-type acyl-transferase family protein, ...    115   1e-26   
ref|XP_006593287.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    111   2e-26   
ref|XP_004491975.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    115   2e-26   Cicer arietinum [garbanzo]
ref|XP_007216324.1|  hypothetical protein PRUPE_ppa019904mg             115   2e-26   
gb|KEH25130.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...    115   2e-26   Medicago truncatula
gb|KJB64646.1|  hypothetical protein B456_010G059400                    115   2e-26   Gossypium raimondii
ref|XP_006421786.1|  hypothetical protein CICLE_v10004870mg             115   2e-26   Citrus clementina [clementine]
ref|XP_004304224.1|  PREDICTED: phenolic glucoside malonyltransfe...    114   3e-26   Fragaria vesca subsp. vesca
ref|XP_003560987.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    114   3e-26   Brachypodium distachyon [annual false brome]
ref|XP_004507303.1|  PREDICTED: phenolic glucoside malonyltransfe...    115   3e-26   Cicer arietinum [garbanzo]
gb|KDO65331.1|  hypothetical protein CISIN_1g011670mg                   114   3e-26   Citrus sinensis [apfelsine]
ref|XP_006490275.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    114   3e-26   Citrus sinensis [apfelsine]
ref|XP_010102962.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside...    114   3e-26   Morus notabilis
gb|KJB79463.1|  hypothetical protein B456_013G051200                    114   3e-26   Gossypium raimondii
gb|AGT37412.1|  anthocyanin 5-aromatic acyltransferase                  114   3e-26   Vaccinium dunalianum
ref|XP_003541924.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    114   4e-26   
ref|XP_008348091.1|  PREDICTED: phenolic glucoside malonyltransfe...    114   4e-26   
ref|XP_002326110.2|  anthocyanin acyltransferase family protein         114   4e-26   
ref|XP_008357786.1|  PREDICTED: phenolic glucoside malonyltransfe...    114   5e-26   
ref|XP_007139438.1|  hypothetical protein PHAVU_008G029400g             114   5e-26   Phaseolus vulgaris [French bean]
gb|KEH25128.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...    114   6e-26   Medicago truncatula
ref|XP_004507302.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    114   6e-26   Cicer arietinum [garbanzo]
gb|KCW47095.1|  hypothetical protein EUGRSUZ_K00901                     114   6e-26   Eucalyptus grandis [rose gum]
ref|XP_012076156.1|  PREDICTED: phenolic glucoside malonyltransfe...    113   7e-26   Jatropha curcas
ref|XP_002518001.1|  Anthocyanin 5-aromatic acyltransferase, puta...    113   1e-25   Ricinus communis
ref|XP_006370740.1|  hypothetical protein POPTR_0001s45940g             112   1e-25   
gb|EAZ03602.1|  hypothetical protein OsI_25739                          113   1e-25   Oryza sativa Indica Group [Indian rice]
gb|KHN36592.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-...    113   1e-25   Glycine soja [wild soybean]
ref|XP_002298991.2|  hypothetical protein POPTR_0001s45940g             112   1e-25   
ref|XP_008379435.1|  PREDICTED: phenolic glucoside malonyltransfe...    113   1e-25   
ref|XP_010035654.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    112   1e-25   Eucalyptus grandis [rose gum]
ref|XP_002892187.1|  transferase                                        112   2e-25   
ref|XP_002527623.1|  Anthocyanin 5-aromatic acyltransferase, puta...    112   2e-25   Ricinus communis
ref|XP_011038069.1|  PREDICTED: phenolic glucoside malonyltransfe...    112   2e-25   Populus euphratica
ref|XP_008361942.1|  PREDICTED: phenolic glucoside malonyltransfe...    112   2e-25   
ref|XP_009365921.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...    112   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_003543364.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    112   2e-25   Glycine max [soybeans]
gb|KJB11558.1|  hypothetical protein B456_001G265700                    112   2e-25   Gossypium raimondii
ref|XP_007149905.1|  hypothetical protein PHAVU_005G108800g             112   3e-25   Phaseolus vulgaris [French bean]
gb|KGN65692.1|  hypothetical protein Csa_1G499330                       111   3e-25   Cucumis sativus [cucumbers]
gb|ACU20547.1|  unknown                                                 108   4e-25   Glycine max [soybeans]
ref|XP_007139473.1|  hypothetical protein PHAVU_008G032400g             111   4e-25   Phaseolus vulgaris [French bean]
gb|KEH25127.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...    111   5e-25   Medicago truncatula
gb|KEH18149.1|  anthocyanin 5-aromatic acyltransferase                  111   5e-25   Medicago truncatula
ref|NP_001059455.1|  Os07g0414000                                       111   5e-25   
ref|XP_009365888.1|  PREDICTED: phenolic glucoside malonyltransfe...    110   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_011047482.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    110   6e-25   Populus euphratica
ref|XP_009111796.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    110   6e-25   Brassica rapa
ref|NP_171890.1|  coumaroyl-CoA:anthocyanidin 3-O-glucoside-6"-O-...    110   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007032768.1|  HXXXD-type acyl-transferase family protein, ...    110   6e-25   
ref|XP_008348092.1|  PREDICTED: phenolic glucoside malonyltransfe...    110   6e-25   
emb|CBI18015.3|  unnamed protein product                                111   6e-25   Vitis vinifera
gb|KJB11557.1|  hypothetical protein B456_001G265600                    110   6e-25   Gossypium raimondii
ref|NP_171849.2|  coumaroyl-CoA:anthocyanidin 3-O-glucoside-6"-O-...    110   7e-25   
ref|XP_008353552.1|  PREDICTED: phenolic glucoside malonyltransfe...    110   7e-25   
ref|XP_008342065.1|  PREDICTED: phenolic glucoside malonyltransfe...    110   7e-25   
gb|KGN57759.1|  hypothetical protein Csa_3G280980                       108   7e-25   Cucumis sativus [cucumbers]
ref|XP_009365966.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...    110   7e-25   
ref|XP_009365919.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...    110   7e-25   
ref|XP_003555054.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    110   8e-25   Glycine max [soybeans]
ref|XP_010095851.1|  Anthocyanin 5-aromatic acyltransferase             110   9e-25   Morus notabilis
ref|XP_009400675.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    110   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008379438.1|  PREDICTED: phenolic glucoside malonyltransfe...    110   1e-24   
ref|XP_010522645.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    110   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_008363917.1|  PREDICTED: phenolic glucoside malonyltransfe...    110   1e-24   
gb|EEE67022.1|  hypothetical protein OsJ_23954                          111   1e-24   Oryza sativa Japonica Group [Japonica rice]
gb|KHN04295.1|  Anthocyanin 5-aromatic acyltransferase                  110   1e-24   Glycine soja [wild soybean]
ref|XP_007032771.1|  HXXXD-type acyl-transferase family protein, ...    109   1e-24   
ref|XP_007139467.1|  hypothetical protein PHAVU_008G032000g             110   1e-24   Phaseolus vulgaris [French bean]
gb|KHN48832.1|  Agmatine coumaroyltransferase                           109   1e-24   Glycine soja [wild soybean]
ref|XP_004304225.1|  PREDICTED: phenolic glucoside malonyltransfe...    109   2e-24   Fragaria vesca subsp. vesca
gb|KHN04293.1|  Anthocyanin 5-aromatic acyltransferase                  109   2e-24   Glycine soja [wild soybean]
ref|XP_009400673.1|  PREDICTED: phenolic glucoside malonyltransfe...    109   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003554894.2|  PREDICTED: phenolic glucoside malonyltransfe...    109   2e-24   Glycine max [soybeans]
ref|XP_009360572.1|  PREDICTED: phenolic glucoside malonyltransfe...    110   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_010553962.1|  PREDICTED: phenolic glucoside malonyltransfe...    109   2e-24   Tarenaya hassleriana [spider flower]
gb|KJB50068.1|  hypothetical protein B456_008G151900                    108   2e-24   Gossypium raimondii
ref|XP_006442122.1|  hypothetical protein CICLE_v10020021mg             109   2e-24   Citrus clementina [clementine]
ref|XP_004145869.2|  PREDICTED: phenolic glucoside malonyltransfe...    109   2e-24   Cucumis sativus [cucumbers]
ref|XP_004954417.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    109   2e-24   Setaria italica
ref|XP_006475382.1|  PREDICTED: phenolic glucoside malonyltransfe...    109   3e-24   Citrus sinensis [apfelsine]
ref|XP_008357928.1|  PREDICTED: BAHD acyltransferase At3g29680-like     108   3e-24   
ref|XP_006384220.1|  transferase family protein                         108   3e-24   
gb|KJB11559.1|  hypothetical protein B456_001G265800                    108   3e-24   Gossypium raimondii
ref|XP_007217619.1|  hypothetical protein PRUPE_ppa016299mg             108   4e-24   
ref|NP_198724.1|  HXXXD-type acyl-transferase-like protein              108   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003621462.1|  Isoflavonoid malonyl transferase                   108   4e-24   
gb|ABY91220.1|  isoflavonoid malonyl transferase 1                      108   4e-24   Medicago truncatula
ref|XP_006478553.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    108   5e-24   Citrus sinensis [apfelsine]
ref|XP_010243532.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    108   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006421639.1|  hypothetical protein CICLE_v10004912mg             108   5e-24   Citrus clementina [clementine]
gb|KEH39034.1|  anthocyanin 5-aromatic acyltransferase                  108   5e-24   Medicago truncatula
ref|XP_006451382.1|  hypothetical protein CICLE_v10007994mg             108   5e-24   
gb|AAM65241.1|  acyltransferase-like protein                            108   6e-24   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA93452.1|  acyltransferase homolog                                108   6e-24   Gentiana triflora
gb|AHA84200.1|  anthocyanin malonyltransferase                          108   6e-24   Phaseolus vulgaris [French bean]
ref|XP_006304592.1|  hypothetical protein CARUB_v10011644mg             108   7e-24   Capsella rubella
gb|KDO39555.1|  hypothetical protein CISIN_1g012242mg                   107   7e-24   Citrus sinensis [apfelsine]
emb|CDY19987.1|  BnaA09g02640D                                          107   8e-24   Brassica napus [oilseed rape]
gb|KCW54645.1|  hypothetical protein EUGRSUZ_I00591                     107   8e-24   Eucalyptus grandis [rose gum]
gb|KEH25061.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...    107   9e-24   Medicago truncatula
ref|XP_003572896.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    107   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_007216893.1|  hypothetical protein PRUPE_ppa020216mg             106   1e-23   
ref|XP_004306067.1|  PREDICTED: phenolic glucoside malonyltransfe...    107   1e-23   Fragaria vesca subsp. vesca
ref|XP_009350417.1|  PREDICTED: phenolic glucoside malonyltransfe...    107   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_008341623.1|  PREDICTED: phenolic glucoside malonyltransfe...    107   1e-23   
ref|XP_007217573.1|  hypothetical protein PRUPE_ppa020665mg             107   1e-23   Prunus persica
ref|XP_010027980.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    107   1e-23   Eucalyptus grandis [rose gum]
emb|CBI18016.3|  unnamed protein product                                106   1e-23   Vitis vinifera
emb|CDY36997.1|  BnaC06g12660D                                          107   2e-23   Brassica napus [oilseed rape]
gb|KHN30328.1|  Anthocyanin 5-aromatic acyltransferase                  107   2e-23   Glycine soja [wild soybean]
ref|XP_003531870.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    107   2e-23   Glycine max [soybeans]
ref|XP_008230891.1|  PREDICTED: phenolic glucoside malonyltransfe...    107   2e-23   Prunus mume [ume]
ref|XP_010474975.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    107   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006490136.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    106   2e-23   Citrus sinensis [apfelsine]
gb|KFK42702.1|  hypothetical protein AALP_AA1G028900                    106   2e-23   Arabis alpina [alpine rockcress]
ref|XP_009360568.1|  PREDICTED: phenolic glucoside malonyltransfe...    106   3e-23   Pyrus x bretschneideri [bai li]
gb|KJB64648.1|  hypothetical protein B456_010G059500                    106   4e-23   Gossypium raimondii
ref|XP_011048513.1|  PREDICTED: malonyl-coenzyme A:anthocyanin 3-...    104   4e-23   Populus euphratica
ref|XP_006421640.1|  hypothetical protein CICLE_v10004896mg             105   4e-23   
ref|XP_010482850.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    105   4e-23   
ref|XP_009139831.1|  PREDICTED: phenolic glucoside malonyltransfe...    105   5e-23   
ref|XP_007043460.1|  HXXXD-type acyl-transferase family protein, ...    105   5e-23   
ref|XP_008365521.1|  PREDICTED: phenolic glucoside malonyltransfe...    105   5e-23   
ref|XP_006293178.1|  hypothetical protein CARUB_v10019495mg             105   5e-23   
ref|XP_011012668.1|  PREDICTED: phenolic glucoside malonyltransfe...    105   6e-23   
ref|XP_008353429.1|  PREDICTED: phenolic glucoside malonyltransfe...    105   6e-23   
ref|XP_008341621.1|  PREDICTED: phenolic glucoside malonyltransfe...    105   7e-23   
ref|XP_007043459.1|  HXXXD-type acyl-transferase family protein, ...    105   7e-23   
gb|KFK33373.1|  hypothetical protein AALP_AA5G005000                    105   7e-23   
gb|KFK33372.1|  hypothetical protein AALP_AA5G005000                    104   8e-23   
ref|XP_006421642.1|  hypothetical protein CICLE_v10004906mg             105   8e-23   
ref|XP_002527622.1|  Anthocyanin 5-aromatic acyltransferase, puta...    105   8e-23   
ref|XP_006384219.1|  hypothetical protein POPTR_0004s10320g             105   9e-23   
emb|CDX67424.1|  BnaA07g14640D                                          104   9e-23   
ref|XP_010482858.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    105   9e-23   
gb|KJB40932.1|  hypothetical protein B456_007G083200                    104   1e-22   
ref|XP_006649178.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    104   1e-22   
ref|XP_012084862.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    104   1e-22   
ref|XP_009365887.1|  PREDICTED: phenolic glucoside malonyltransfe...    104   1e-22   
ref|XP_009125100.1|  PREDICTED: BAHD acyltransferase At3g29680-like     104   1e-22   
ref|XP_009365918.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...    104   1e-22   
ref|XP_008357916.1|  PREDICTED: phenolic glucoside malonyltransfe...    105   1e-22   
gb|KHN13543.1|  Anthocyanin 5-aromatic acyltransferase                  103   2e-22   
ref|XP_003551761.1|  PREDICTED: phenolic glucoside malonyltransfe...    103   2e-22   
ref|XP_011004421.1|  PREDICTED: phenolic glucoside malonyltransfe...    104   2e-22   
ref|XP_006436440.1|  hypothetical protein CICLE_v10031484mg             103   2e-22   
gb|KDO37562.1|  hypothetical protein CISIN_1g041416mg                   104   2e-22   
ref|XP_006418229.1|  hypothetical protein EUTSA_v10007549mg             103   2e-22   
ref|XP_006384604.1|  hypothetical protein POPTR_0004s18940g             103   2e-22   
ref|XP_006491548.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...    104   2e-22   
ref|XP_010553964.1|  PREDICTED: phenolic glucoside malonyltransfe...    103   2e-22   
ref|XP_008357784.1|  PREDICTED: phenolic glucoside malonyltransfe...    103   2e-22   
ref|XP_006421222.1|  hypothetical protein CICLE_v10004836mg             104   2e-22   
ref|XP_006485702.1|  PREDICTED: phenolic glucoside malonyltransfe...    103   2e-22   
ref|XP_008230890.1|  PREDICTED: phenolic glucoside malonyltransfe...    103   2e-22   
emb|CDY15482.1|  BnaA08g27660D                                          103   3e-22   
ref|XP_009365920.1|  PREDICTED: phenolic glucoside malonyltransfe...    103   3e-22   
ref|XP_006384218.1|  hypothetical protein POPTR_0004s10300g             103   3e-22   
ref|XP_009387932.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    103   3e-22   
ref|XP_006409945.1|  hypothetical protein EUTSA_v10017968mg             103   3e-22   
emb|CDY37870.1|  BnaC04g31360D                                          103   4e-22   
ref|XP_004499461.1|  PREDICTED: phenolic glucoside malonyltransfe...    102   5e-22   
ref|NP_200924.1|  anthocyanin 5-aromatic acyltransferase 1              102   6e-22   
ref|XP_009111134.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    102   7e-22   
ref|XP_002306023.1|  hypothetical protein POPTR_0004s11990g             102   7e-22   
ref|XP_006384236.1|  hypothetical protein POPTR_0004s10920g             102   7e-22   
ref|XP_010265764.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...    102   8e-22   
ref|XP_009353357.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    102   9e-22   
ref|XP_008379902.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    102   9e-22   
ref|XP_002527626.1|  Anthocyanin 5-aromatic acyltransferase, puta...    102   9e-22   
ref|XP_009151768.1|  PREDICTED: BAHD acyltransferase At3g29680-like     102   1e-21   
gb|KHN13630.1|  Agmatine coumaroyltransferase                           102   1e-21   
ref|XP_006283698.1|  hypothetical protein CARUB_v10004762mg             101   1e-21   
ref|XP_004489466.1|  PREDICTED: phenolic glucoside malonyltransfe...    101   1e-21   
ref|XP_004305990.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...    101   1e-21   
gb|KDO44672.1|  hypothetical protein CISIN_1g042461mg                   100   1e-21   
ref|XP_006384610.1|  hypothetical protein POPTR_0004s19020g             101   2e-21   
ref|XP_006395269.1|  hypothetical protein EUTSA_v10004190mg             101   2e-21   
ref|XP_007216246.1|  hypothetical protein PRUPE_ppa016949mg             100   2e-21   
ref|XP_009378321.1|  PREDICTED: phenolic glucoside malonyltransfe...    101   2e-21   
emb|CAN65238.1|  hypothetical protein VITISV_018675                     100   2e-21   
ref|XP_010553967.1|  PREDICTED: phenolic glucoside malonyltransfe...    100   3e-21   
ref|XP_006395271.1|  hypothetical protein EUTSA_v10005674mg             100   3e-21   
ref|XP_007139469.1|  hypothetical protein PHAVU_008G032100g             100   3e-21   
gb|KEH21741.1|  anthocyanin 5-aromatic acyltransferase                  100   3e-21   
gb|EYU36657.1|  hypothetical protein MIMGU_mgv1a019731mg                100   3e-21   
ref|XP_007151362.1|  hypothetical protein PHAVU_004G040200g             100   4e-21   
ref|XP_007215354.1|  hypothetical protein PRUPE_ppa005488mg             100   4e-21   
ref|NP_001236819.1|  malonyl-CoA:isoflavone 7-O-glucoside-6''-O-m...    100   5e-21   
ref|XP_011013415.1|  PREDICTED: phenolic glucoside malonyltransfe...    100   5e-21   
ref|XP_007139470.1|  hypothetical protein PHAVU_008G032200g             100   5e-21   
ref|XP_010552527.1|  PREDICTED: phenolic glucoside malonyltransfe...    100   5e-21   
ref|XP_006282597.1|  hypothetical protein CARUB_v10004768mg             100   5e-21   
dbj|BAK02456.1|  predicted protein                                      100   5e-21   
emb|CDY11577.1|  BnaC06g31620D                                        98.2    6e-21   
ref|XP_006490223.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  96.7    6e-21   
ref|XP_006602942.1|  PREDICTED: phenolic glucoside malonyltransfe...  99.8    6e-21   
ref|XP_007139468.1|  hypothetical protein PHAVU_008G032100g           99.8    7e-21   
gb|KHN13544.1|  Agmatine coumaroyltransferase                         99.8    7e-21   
ref|XP_011467881.1|  PREDICTED: phenolic glucoside malonyltransfe...  99.8    7e-21   
gb|AES67352.2|  anthocyanin 5-aromatic acyltransferase                99.8    7e-21   
ref|XP_006404631.1|  hypothetical protein EUTSA_v10000636mg           99.4    7e-21   
ref|XP_008230892.1|  PREDICTED: phenolic glucoside malonyltransfe...  99.8    8e-21   
ref|XP_003621467.1|  Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma...  99.4    8e-21   
ref|XP_008230893.1|  PREDICTED: phenolic glucoside malonyltransfe...  99.4    8e-21   
ref|NP_198725.1|  HXXXD-type acyl-transferase-like protein            99.4    9e-21   
ref|XP_009391727.1|  PREDICTED: uncharacterized protein LOC103977818    100   9e-21   
ref|XP_007217231.1|  hypothetical protein PRUPE_ppa005502mg           99.4    1e-20   
ref|XP_006378727.1|  hypothetical protein POPTR_0010s21520g           99.4    1e-20   
emb|CDY69977.1|  BnaAnng32210D                                        97.8    1e-20   
ref|XP_002877196.1|  hypothetical protein ARALYDRAFT_905267           99.4    1e-20   
ref|XP_003597100.1|  Anthocyanin 5-aromatic acyltransferase           96.3    1e-20   
ref|NP_189605.1|  HXXXD-type acyl-transferase-like protein            99.0    1e-20   
ref|XP_002870800.1|  hypothetical protein ARALYDRAFT_330573           99.0    1e-20   
ref|XP_007032765.1|  HXXXD-type acyl-transferase family protein, ...  99.4    1e-20   
emb|CDY15959.1|  BnaA04g11520D                                        98.6    1e-20   
ref|XP_003552518.1|  PREDICTED: phenolic glucoside malonyltransfe...  99.4    1e-20   
ref|XP_006851052.1|  PREDICTED: malonyl-coenzyme:anthocyanin 5-O-...  98.2    2e-20   
ref|XP_006451381.1|  hypothetical protein CICLE_v10010626mg           99.4    2e-20   
ref|XP_007139589.1|  hypothetical protein PHAVU_008G042400g           98.6    2e-20   
gb|AGL94766.1|  anthocyanin malonyltransferase-like protein           97.1    2e-20   
ref|XP_002305314.2|  hypothetical protein POPTR_0004s18920g           98.6    2e-20   
ref|XP_006405209.1|  hypothetical protein EUTSA_v10000474mg           97.8    2e-20   
ref|XP_009140676.1|  PREDICTED: BAHD acyltransferase At3g29680-like   97.8    2e-20   
ref|XP_003621494.1|  Isoflavonoid malonyl transferase                 97.1    2e-20   
emb|CDX99673.1|  BnaC04g34300D                                        96.7    3e-20   
ref|XP_006395267.1|  hypothetical protein EUTSA_v10004175mg           98.2    3e-20   
ref|XP_004499462.1|  PREDICTED: phenolic glucoside malonyltransfe...  98.2    3e-20   
ref|XP_011011768.1|  PREDICTED: phenolic glucoside malonyltransfe...  97.8    3e-20   
ref|XP_009391749.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...  97.4    3e-20   
emb|CDY37881.1|  BnaC04g31250D                                        97.1    3e-20   
ref|XP_008230894.1|  PREDICTED: phenolic glucoside malonyltransfe...  97.8    4e-20   
gb|ACU18360.1|  unknown                                               95.5    4e-20   
ref|XP_006475381.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  98.2    4e-20   
ref|XP_010657394.1|  PREDICTED: LOW QUALITY PROTEIN: malonyl-coen...  97.1    4e-20   
emb|CDY00091.1|  BnaC09g02100D                                        96.7    5e-20   
ref|XP_003597101.1|  Anthocyanin 5-aromatic acyltransferase           98.2    5e-20   
ref|XP_011027150.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  97.4    5e-20   
emb|CDY70863.1|  BnaCnng70090D                                        97.4    5e-20   
dbj|BAF49307.1|  putative anthocyanin malonyltransferase              97.1    5e-20   
emb|CDX86660.1|  BnaC08g00430D                                        97.1    5e-20   
ref|XP_006395270.1|  hypothetical protein EUTSA_v10005615mg           94.0    5e-20   
gb|EYU36651.1|  hypothetical protein MIMGU_mgv1a006328mg              97.1    6e-20   
ref|XP_009139821.1|  PREDICTED: phenolic glucoside malonyltransfe...  97.1    6e-20   
ref|XP_007214879.1|  hypothetical protein PRUPE_ppa026936mg           97.1    6e-20   
ref|XP_008465394.1|  PREDICTED: phenolic glucoside malonyltransfe...  95.9    6e-20   
ref|XP_007151367.1|  hypothetical protein PHAVU_004G040700g           97.1    6e-20   
ref|XP_007216387.1|  hypothetical protein PRUPE_ppa021452mg           97.1    6e-20   
ref|XP_010102957.1|  Malonyl-coenzyme A:anthocyanin 3-O-glucoside...  97.1    6e-20   
ref|XP_006602943.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...  96.7    7e-20   
ref|XP_004489467.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.7    7e-20   
ref|XP_010528413.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.7    8e-20   
ref|XP_009391715.1|  PREDICTED: phenolic glucoside malonyltransfe...  94.4    9e-20   
ref|XP_009398032.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.3    9e-20   
ref|XP_003608205.1|  Isoflavonoid malonyl transferase                 97.8    1e-19   
gb|KHN13546.1|  Agmatine coumaroyltransferase                         96.7    1e-19   
gb|ABY91221.1|  isoflavonoid malonyl transferase 3                    96.7    1e-19   
ref|XP_002877193.1|  predicted protein                                96.3    1e-19   
ref|XP_010425762.1|  PREDICTED: BAHD acyltransferase At3g29680-like   96.3    1e-19   
ref|XP_008465393.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.7    1e-19   
ref|XP_003552580.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.3    1e-19   
gb|KJB71711.1|  hypothetical protein B456_011G138500                  95.9    1e-19   
ref|XP_003552581.1|  PREDICTED: phenolic glucoside malonyltransfe...  96.3    1e-19   
gb|KHN13545.1|  Agmatine coumaroyltransferase                         96.3    1e-19   
ref|XP_004306152.1|  PREDICTED: phenolic glucoside malonyltransfe...  95.9    2e-19   
ref|XP_009140207.1|  PREDICTED: phenolic glucoside malonyltransfe...  95.9    2e-19   
gb|KEH33306.1|  transferase family protein                            94.0    2e-19   
ref|XP_002877192.1|  AT5MAT                                           95.5    2e-19   
ref|XP_009140407.1|  PREDICTED: BAHD acyltransferase At3g29680-like   95.5    2e-19   
ref|XP_010111948.1|  Anthocyanin 5-aromatic acyltransferase           95.9    2e-19   
ref|XP_011076802.1|  PREDICTED: anthocyanidin 3-O-glucoside 6''-O...  95.5    2e-19   
ref|XP_006436966.1|  hypothetical protein CICLE_v10031508mg           95.5    2e-19   
gb|KHN48831.1|  Agmatine coumaroyltransferase                         95.5    2e-19   
ref|XP_006395273.1|  hypothetical protein EUTSA_v10004202mg           95.1    3e-19   
ref|XP_003555055.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  95.1    3e-19   
emb|CDY15948.1|  BnaA04g11630D                                        95.1    3e-19   
gb|ACU23115.1|  unknown                                               95.1    3e-19   
ref|XP_003554890.2|  PREDICTED: phenolic glucoside malonyltransfe...  95.5    3e-19   
gb|AIA22175.1|  malonyltransferase                                    94.7    5e-19   
ref|XP_006285761.1|  hypothetical protein CARUB_v10007235mg           94.4    5e-19   
ref|NP_189609.1|  phenolic glucoside malonyltransferase 2             94.4    5e-19   
ref|XP_007151361.1|  hypothetical protein PHAVU_004G040100g           94.0    5e-19   
ref|XP_002870801.1|  transferase family protein                       94.4    5e-19   
gb|KJB40931.1|  hypothetical protein B456_007G083100                  94.4    6e-19   
gb|KHN28496.1|  Anthocyanin 5-aromatic acyltransferase                94.4    7e-19   
gb|KEH39030.1|  anthocyanin 5-aromatic acyltransferase                92.4    9e-19   
ref|XP_009140208.1|  PREDICTED: phenolic glucoside malonyltransfe...  93.6    1e-18   
ref|XP_002877195.1|  predicted protein                                93.2    1e-18   
ref|XP_003570416.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  93.6    1e-18   
gb|KDO59152.1|  hypothetical protein CISIN_1g042848mg                 92.0    1e-18   
ref|XP_006603948.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  93.6    1e-18   
ref|XP_008231011.1|  PREDICTED: LOW QUALITY PROTEIN: phenolic glu...  93.6    1e-18   
emb|CDY04088.1|  BnaC02g38030D                                        92.4    1e-18   
ref|XP_006405192.1|  hypothetical protein EUTSA_v10000450mg           93.2    1e-18   
gb|KEH25060.1|  malonyl-CoA:isoflavone 7-O-glucoside malonyltrans...  93.2    1e-18   
gb|KFK43306.1|  hypothetical protein AALP_AA1G107200                  93.2    1e-18   
gb|AES77678.2|  anthocyanin 5-aromatic acyltransferase                93.2    2e-18   
gb|KHN07114.1|  Agmatine coumaroyltransferase                         93.2    2e-18   
gb|EMT28352.1|  Anthocyanin 5-aromatic acyltransferase                92.4    2e-18   
ref|XP_003608200.1|  Isoflavonoid malonyl transferase                 93.2    2e-18   
ref|XP_003543881.1|  PREDICTED: phenolic glucoside malonyltransfe...  92.8    2e-18   
gb|KFK26322.1|  hypothetical protein AALP_AA8G232600                  92.8    2e-18   
ref|XP_010502981.1|  PREDICTED: BAHD acyltransferase At3g29680-like   92.8    2e-18   
emb|CDY15958.1|  BnaA04g11530D                                        91.3    2e-18   
ref|XP_011012393.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  92.8    2e-18   
ref|XP_010450840.1|  PREDICTED: phenolic glucoside malonyltransfe...  92.8    2e-18   
ref|XP_008458037.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  92.0    3e-18   
ref|XP_008379864.1|  PREDICTED: phenolic glucoside malonyltransfe...  92.4    3e-18   
ref|XP_007217389.1|  hypothetical protein PRUPE_ppa026050mg           93.2    4e-18   
emb|CDX90309.1|  BnaA08g16750D                                        88.6    4e-18   
ref|XP_006452621.1|  hypothetical protein CICLE_v10010723mg           92.4    4e-18   
ref|XP_010447709.1|  PREDICTED: phenolic glucoside malonyltransfe...  91.7    5e-18   
ref|XP_011015767.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  92.0    5e-18   
ref|XP_009109503.1|  PREDICTED: BAHD acyltransferase At3g29680-like   91.7    5e-18   
ref|NP_001237760.1|  malonyl-CoA:isoflavone 7-O-glucoside-6''-O-m...  91.7    6e-18   
ref|XP_008231008.1|  PREDICTED: phenolic glucoside malonyltransfe...  91.3    6e-18   
ref|XP_006475110.1|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  91.7    7e-18   
gb|EYU17681.1|  hypothetical protein MIMGU_mgv1a022408mg              87.4    7e-18   
gb|AES77692.2|  anthocyanin 5-aromatic acyltransferase                91.3    8e-18   
ref|XP_003576889.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  90.9    9e-18   
ref|XP_004139706.2|  PREDICTED: malonyl-CoA:anthocyanidin 5-O-glu...  90.5    9e-18   
dbj|BAK04520.1|  predicted protein                                    90.9    1e-17   
ref|XP_002438902.1|  hypothetical protein SORBIDRAFT_10g027950        90.9    1e-17   
ref|XP_010104710.1|  Anthocyanin 5-aromatic acyltransferase           90.9    1e-17   
ref|XP_003608206.1|  Isoflavonoid malonyl transferase                 90.9    1e-17   
ref|XP_003621474.1|  Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma...  90.5    1e-17   
gb|AFW63968.1|  anthocyanin 5-aromatic acyltransferase                90.5    1e-17   
ref|NP_001147570.1|  anthocyanin 5-aromatic acyltransferase           90.5    1e-17   
ref|XP_006405136.1|  hypothetical protein EUTSA_v10000635mg           90.1    2e-17   
gb|KDO55936.1|  hypothetical protein CISIN_1g047419mg                 90.1    2e-17   
ref|XP_010435810.1|  PREDICTED: phenolic glucoside malonyltransfe...  89.7    3e-17   
ref|XP_003621465.1|  Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma...  89.7    3e-17   
ref|XP_002527629.1|  Anthocyanin 5-aromatic acyltransferase, puta...  89.7    3e-17   
gb|ABY91222.1|  isoflavonoid malonyl transferase 2                    89.4    3e-17   
ref|XP_010089648.1|  Anthocyanin 5-aromatic acyltransferase           89.4    3e-17   
emb|CDY47140.1|  BnaA08g05430D                                        89.4    3e-17   
ref|XP_003539521.1|  PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g...  89.4    4e-17   
ref|XP_010918830.1|  PREDICTED: anthocyanin 5-aromatic acyltransf...  87.4    4e-17   
ref|XP_007139466.1|  hypothetical protein PHAVU_008G031900g           89.0    4e-17   



>ref|XP_009588215.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nicotiana 
tomentosiformis]
Length=453

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 114/189 (60%), Gaps = 10/189 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A V+EQ  VAP PG VA  +LPL +FD +WL+   + R++FY+  +S+T F  TIIP L 
Sbjct  2    ALVIEQCQVAPSPGSVAELTLPLTYFDFQWLNFHRMRRILFYKFPISKTTFVQTIIPSLT  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+ L++Y  LA  +  P D S  PE  Y  GD V ++F+   ++   FD L  NH R
Sbjct  62   NSLSLTLKHYISLAGNVVCPLDLSGYPELRYLTGDSVSVIFS---ESYMDFDFLVGNHPR  118

Query  445  NSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            N+KEFYP +P L   +         + A++VTLFP  GI +G  +HHV GDG+S  GF K
Sbjct  119  NAKEFYPFVPQLADAKHAPGVLLAPLLAIQVTLFPNHGISIGSTHHHVAGDGASFAGFTK  178

Query  604  AWTALSLLG  630
            AW +L+  G
Sbjct  179  AWASLNKFG  187



>sp|Q8W1W9.1|5MAT1_SALSN RecName: Full=Malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase; 
Short=Malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase; 
Short=Ss5MaT1 [Salvia splendens]
 gb|AAL50566.1|AF405707_1 malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
[Salvia splendens]
Length=462

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 115/187 (61%), Gaps = 11/187 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E   + PPP      S+PL+FFD+KWLH  PV RL+FY H  S++ F  TI+PHLK S
Sbjct  7    ILETCHIPPPPA-ANDLSIPLSFFDIKWLHYHPVRRLLFYHHPSSKSQFLHTIVPHLKQS  65

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+AL +Y  +A  L  P++    P+  Y  GD VP+  A S+ +   F+ L+ NH R++
Sbjct  66   LSLALTHYLPVAGNLLYPSNTEKFPQLRYAAGDSVPVTIAESNSD---FESLTGNHTRDA  122

Query  451  KEFYPLIPTLPSVRR-------GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
             +FY L+P +P +          +FAV++TLFP  GIC+G + HH +GD  SI GF+ AW
Sbjct  123  DQFYDLLPPIPPIEEESDWKLINIFAVQITLFPGEGICIGFSNHHCLGDARSIVGFISAW  182

Query  610  TALSLLG  630
              ++ +G
Sbjct  183  GEINGIG  189



>ref|XP_009593467.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
{ECO:0000303|PubMed:11598135}-like [Nicotiana 
tomentosiformis]
Length=451

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 117/189 (62%), Gaps = 10/189 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A+V+EQ  VAPPPG     +LPL +FD  WL    + R++FY+  VS+++F  TI+P+LK
Sbjct  2    ASVIEQCQVAPPPGSAPELTLPLTYFDYVWLSFHRMRRILFYKIPVSKSNFVQTIVPNLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+AL++Y  LA  +  P + S  PE  Y  GD + + F+ +D N   F+ L  NH R
Sbjct  62   DSLSLALKHYTPLAGYVVCPVNSSGYPELRYVTGDSISVTFSETDTN---FNYLIGNHLR  118

Query  445  NSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            N+K+FY L+P L   R         + A++VTLFP  GI +G   HH+VGDG+S+ GF++
Sbjct  119  NAKDFYHLVPQLAGPRHALGVQLAPLLAIQVTLFPNHGISIGFTTHHIVGDGASMVGFVR  178

Query  604  AWTALSLLG  630
            AW  L+  G
Sbjct  179  AWALLNKFG  187



>gb|EYU24858.1| hypothetical protein MIMGU_mgv1a024815mg [Erythranthe guttata]
Length=295

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 118/190 (62%), Gaps = 11/190 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKV-AGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
            ++E   VAPPPG + A  SLPL FFD++W+H  PV  ++FY H  S+ +F +T++P LK 
Sbjct  4    LLETCGVAPPPGGILAELSLPLTFFDIRWIHHHPVGSVLFYNHPCSKPYFLETLVPKLKE  63

Query  268  SLSIALQYYPLLAAKLAVP-TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
            SLS+ L++Y  +A  L  P       P F +  GD V L  A S++++  FD L +NHAR
Sbjct  64   SLSLTLKHYLPIAGNLLYPLITTEKKPVFRFISGDSVSLTIAESENDN--FDELVTNHAR  121

Query  445  NSKEFYPLIPTLPSVRR-------GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            ++ +FY  +P +P ++         + A++VTLFP  GICVG   HH +GDGSSI GFM 
Sbjct  122  DADQFYDFMPNMPPIKDETEYKILDVMAIQVTLFPGRGICVGFTNHHSLGDGSSIVGFMH  181

Query  604  AWTALSLLGH  633
            AW +++ LG 
Sbjct  182  AWASVNKLGE  191



>ref|XP_011090949.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=463

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 119/200 (60%), Gaps = 12/200 (6%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPP-GKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTH  234
            MA + PP    + E+  +AP   G     SLPL FFD+ WLH  P+ RLIFY    +  H
Sbjct  1    MASTEPPKAVTIHERCRIAPSSDGGSEQVSLPLVFFDMVWLHFHPIQRLIFYNFPCANEH  60

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            F +T++P++K SLS  L+++  LA  L  P + S  PEF Y  GD V +  A S++ S  
Sbjct  61   FMETLVPNIKKSLSQTLKHFLPLAGNLIYPLE-SGNPEFRYIPGDSVSVAIAESNEASD-  118

Query  415  FDCLSSNHARNSKEFYPLIPTLPS---------VRRGMFAVKVTLFPEAGICVGIAYHHV  567
            F  L+ +  R++  FY L+P LP           R  +FAV+VTLF + GIC+G+  HH 
Sbjct  119  FHYLTGDEPRDADRFYALVPALPRPEIDFESGFKRIPVFAVQVTLFRDTGICLGLTNHHA  178

Query  568  VGDGSSIFGFMKAWTALSLL  627
            VGDGSSI GF+KAW+A+S+L
Sbjct  179  VGDGSSIVGFIKAWSAVSML  198



>ref|XP_011090972.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=468

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 108/195 (55%), Gaps = 12/195 (6%)
 Frame = +1

Query  91   VVEQSSVAPP--PGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            V E  ++APP   G  A  SLPL FFD+ WL+  P  RL+FYQ   S   F +TI+P LK
Sbjct  10   VQECCNIAPPTAAGDEAEQSLPLTFFDILWLYIHPTQRLLFYQFPCSAKDFLETIVPSLK  69

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS  L  Y  LA  L +    S  PEF Y  GD V + FA   +N   FD L+ N AR
Sbjct  70   KSLSRTLGNYLPLAGNLLIHPSNSGMPEFRYSPGDSVSVTFAEWSENFD-FDYLTGNQAR  128

Query  445  NSKEFYPLIPTLPSVRRG---------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
            NS  FY L+P LP  R           + A++ TLFPE GIC+GI  HH VGD SSI GF
Sbjct  129  NSDMFYALVPVLPEPRVESESAFKIIPLLAIQATLFPETGICIGITNHHAVGDASSIVGF  188

Query  598  MKAWTALSLLGHKSS  642
            +KAW+  + LG    
Sbjct  189  IKAWSRAAKLGENQQ  203



>gb|EYU24860.1| hypothetical protein MIMGU_mgv1a022453mg, partial [Erythranthe 
guttata]
Length=450

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 114/183 (62%), Gaps = 11/183 (6%)
 Frame = +1

Query  112  APPPGK-VAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQ  288
            APPPG  VA  SLPL FFD++W+H  PV  ++FY H  S+ +F +T++P LK SLS+ L+
Sbjct  1    APPPGGIVAELSLPLTFFDIRWIHHHPVGSVLFYNHPCSKPYFLETLVPKLKESLSLTLK  60

Query  289  YYPLLAAKLAVP-TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYP  465
            +Y  +A  L  P       P F +  GD V L  A S++++  FD L +NHAR++ +FY 
Sbjct  61   HYLPIAGNLLYPLITTEKKPVFRFISGDSVSLTIAESENDN--FDELVTNHARDADQFYD  118

Query  466  LIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSL  624
             +P +P ++         + A++VTLFP  GICVG   HH +GDGSSI GFM AW +++ 
Sbjct  119  FMPNMPPIKDETEYKILHVMAIQVTLFPGRGICVGFTNHHSLGDGSSIVGFMHAWASVNK  178

Query  625  LGH  633
            LG 
Sbjct  179  LGE  181



>gb|EYU24851.1| hypothetical protein MIMGU_mgv1a006146mg [Erythranthe guttata]
Length=455

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 114/194 (59%), Gaps = 13/194 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGK-VAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
            ++E   + PP G   A   LPL+FFD+ WLH  P+ RL+FY+++ S +HF +T+IP+LK 
Sbjct  5    LLETCRIQPPAGAATAELELPLSFFDVLWLHFHPIRRLLFYEYSCSESHFSETLIPNLKE  64

Query  268  SLSIALQYYPLLAAKLAVPTDY-STPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
            SLS+ L++Y  +AA L  P +     P   Y  GD V +  AVS    G FD L  NH R
Sbjct  65   SLSLTLKHYLPVAANLLYPINTDDQKPVLRYAAGDSVSMKIAVS---GGNFDDLVGNHPR  121

Query  445  NSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            ++ +FY  +P +P V           +FA++VTLFP  GIC+G + HH +GD  SI GFM
Sbjct  122  DADQFYDFVPEIPPVTEDSDGHKIVPVFALQVTLFPGRGICIGFSNHHTLGDARSIVGFM  181

Query  601  KAWTALSLLGHKSS  642
             AW +++  G +  
Sbjct  182  WAWASIAKFGGEEE  195



>gb|EYU24855.1| hypothetical protein MIMGU_mgv1a005957mg [Erythranthe guttata]
Length=463

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 120/209 (57%), Gaps = 17/209 (8%)
 Frame = +1

Query  55   HMAQSSPPTYAAV----VEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAV  222
            H+   SPP +++V    + ++   PPP   A   LPL FFD+ W+H  P+ RL+FY+++ 
Sbjct  4    HLPNKSPPPHSSVAMITLLETCRIPPPPSSAELQLPLTFFDIVWIHFQPIRRLLFYEYSC  63

Query  223  SRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVP--TDYSTPPEFVYGDGDGVPLVFAVS  396
            S +HF +T++P+LK SLS+ L++Y  LA  L  P  TD+  P    Y  GD V L  AVS
Sbjct  64   SESHFLETLVPNLKESLSLTLKHYLPLAGNLLYPLNTDHQKPL-LRYVSGDSVSLKIAVS  122

Query  397  DDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIA  555
                G FD L  NH R++ +FY  +P +P            +FA++VTLFP  GIC+G +
Sbjct  123  ---GGNFDDLVGNHPRDADQFYDFVPEIPPATEDSEYKIVPVFALQVTLFPGRGICIGFS  179

Query  556  YHHVVGDGSSIFGFMKAWTALSLLGHKSS  642
              H +GD  SI GFM AW ++  L  +S 
Sbjct  180  NLHSLGDARSIVGFMCAWASMCKLSKESE  208



>gb|AAR26386.1| putative acyltransferase [Salvia splendens]
Length=459

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 109/183 (60%), Gaps = 14/183 (8%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E S+++PPPG  A  +LPL FFD+ WLH  P+ RLIFY H  +   F  TI+P+LK S
Sbjct  5    VLETSAISPPPGSAADLTLPLCFFDIIWLHFHPIRRLIFYNHPCTEAEFSSTIVPNLKHS  64

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFV-YGDGDGVPLVFAVSDDNSGR-FDCL-SSNHA  441
            LS+ LQ++P +A  L  P D      F+ Y  GD  PL  AV    SGR FD L + + A
Sbjct  65   LSLTLQHFPPVAGNLLFPVDTDKSRPFLRYVSGDTAPLTIAV----SGRDFDELVAGSRA  120

Query  442  RNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            R+S +FY  +P +P +          + A++ TLFP  GIC+G++ HH +GD  SI  F+
Sbjct  121  RDSDQFYEFLPLMPPIAEEEDYKIAPLIALQATLFPGRGICIGVSNHHCLGDARSIVAFV  180

Query  601  KAW  609
             AW
Sbjct  181  SAW  183



>gb|AAS77402.1| quercetin 3-O-glucoside-6''-O-malonyltransferase [Glandularia 
x hybrida]
Length=461

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 114/194 (59%), Gaps = 17/194 (9%)
 Frame = +1

Query  88   AVVEQSSVAPPP--GKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHL  261
             V E+  +APP   G+     LP+ +FD  WL+  P+ RL+FYQ+  S+THF + ++P+L
Sbjct  9    TVRERCGIAPPADAGEAVEQRLPITYFDTIWLYFHPIQRLLFYQYPCSKTHFVEHLVPNL  68

Query  262  KTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDC--LSSN  435
            K SL   L++Y  LA KL  P D S  PE  Y  GD V + FA   + +G FD   L+ N
Sbjct  69   KKSLKQTLRHYRPLAGKLIRPVD-SGMPELRYSPGDSVSVTFA---ETNGDFDFNHLTGN  124

Query  436  HARNSKEFYPLIPTLPS---------VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
            H R+S EFY   P LP              +FA++VTLFPE GIC+G   HH VGD SSI
Sbjct  125  HVRDSDEFYSFAPDLPEPVTEPDPGFTVVPLFAIQVTLFPEVGICMGFTNHHAVGDASSI  184

Query  589  FGFMKAWTALSLLG  630
             GF+K+W++++  G
Sbjct  185  VGFIKSWSSVAKSG  198



>ref|XP_009780993.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nicotiana 
sylvestris]
Length=453

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 111/186 (60%), Gaps = 10/186 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A+V+EQ  VAP PG  A  +LPL +FD  WL    + R++FY+  +SR  F  TIIP LK
Sbjct  2    ASVIEQCQVAPSPGSAAELTLPLTYFDHGWLGFHRMRRILFYKLPISRPDFVQTIIPTLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+ L++Y  LA  +A P D+S  PE  Y  GD V ++F+ SD +   F+ L  NH R
Sbjct  62   DSLSLTLKHYIPLAGNVACPQDWSGYPELRYITGDSVSVIFSESDMD---FNYLVGNHPR  118

Query  445  NSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            ++ +FY  IP L   +         + A++VTLFP  GI +G   HHV GDG++I  F++
Sbjct  119  DANDFYHFIPQLAEPKDAPGFQLAPVLAIQVTLFPNHGISIGFTNHHVAGDGATIVKFVR  178

Query  604  AWTALS  621
            AW  L+
Sbjct  179  AWALLN  184



>ref|XP_011093436.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 111/188 (59%), Gaps = 11/188 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E   V  PPG  A  SLPL FFD++WLH  P+  L+FY +  S+ +F +T+ P LK S
Sbjct  5    ILETCRVPAPPGAAANLSLPLTFFDIQWLHFHPIRHLLFYDYPCSKPYFLETVAPKLKES  64

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGD-GVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ L++Y  LA  L  P +    PE  Y  GD  V L  A   +++  FD L+ NHAR+
Sbjct  65   LSLTLRHYLPLAGNLIFPLNSEKKPEIQYVAGDSAVSLTIA---ESASDFDHLTGNHARD  121

Query  448  SKEFYPLIPTLPSV-------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            + +FY  +P +  V       R  + A+KVTLF   GICVG A  H +GD SS+ GF+KA
Sbjct  122  ADQFYEFVPEIDPVTDESEYQRVPVVALKVTLFTGRGICVGFANLHCLGDASSVVGFIKA  181

Query  607  WTALSLLG  630
            W ++S LG
Sbjct  182  WASISKLG  189



>sp|Q8GSN8.1|3MAT_DAHPI RecName: Full=Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase; 
Short=Dv3MaT; Short=Malonyl CoA:anthocyanin 
3-O-glucoside-6''-O-malonyltransferase [Dahlia pinnata]
 gb|AAO12206.1| malonyl CoA:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Dahlia pinnata]
Length=460

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 114/192 (59%), Gaps = 13/192 (7%)
 Frame = +1

Query  88   AVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
             ++E S ++PPP  +   SLPL FFD+ WL   PVH L FY    S++HF +T+IP+LK 
Sbjct  8    TILEHSRISPPPSTIGHRSLPLTFFDIAWLLFPPVHHLYFYHFPYSKSHFTETVIPNLKH  67

Query  268  SLSIALQYYPLLAAKLAV---PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            SLSI LQ+Y     KL V   P D +  PE  + +GD V L FA   + +  F+ LS+NH
Sbjct  68   SLSITLQHYFPFVGKLIVYPNPHDSTRKPEIRHVEGDSVALTFA---ETTLDFNDLSANH  124

Query  439  ARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
             R  + FYPL+P L +  +        +F+V+VT FP +GI +G+  HH + D ++ FGF
Sbjct  125  PRKCENFYPLVPPLGNAVKESDYVTLPVFSVQVTYFPNSGISIGLTNHHSLSDANTRFGF  184

Query  598  MKAWTALSLLGH  633
            +KAW ++   G 
Sbjct  185  LKAWASVCETGE  196



>ref|XP_009620758.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
{ECO:0000303|PubMed:11598135}-like [Nicotiana 
tomentosiformis]
Length=452

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 113/190 (59%), Gaps = 11/190 (6%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A+V+EQ  VAPPPG  A  +LPL +FD  WL  +   R++FY+  +S+  F  TIIP LK
Sbjct  2    ASVIEQCQVAPPPGSAAELTLPLTYFDHIWLLFNHNRRILFYKFPISKPEFVQTIIPTLK  61

Query  265  TSLSIALQYYPLLAAKLAVP-TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
             SLS+ L++Y  LA  +  P  D S  PE  Y  GD V + F+ +D N   FD L  NH 
Sbjct  62   DSLSLTLKHYLPLAGNIVCPLLDCSGYPELRYVTGDSVFVTFSETDMN---FDFLVGNHP  118

Query  442  RNSKEFYPLIPTL--PSVRRG-----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            RN K+FY  +P L  P   +G     + A++VTLFP  GI +G   HHVVGDG++I  F+
Sbjct  119  RNLKDFYHFVPQLREPKDAQGVQLAPVLAIQVTLFPNHGISIGFTNHHVVGDGATIVRFI  178

Query  601  KAWTALSLLG  630
            +AW  L+  G
Sbjct  179  RAWALLNKFG  188



>ref|XP_011093437.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 111/188 (59%), Gaps = 11/188 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E   V  PPG  A  SLPL FFDL WLH  P+ RL+FY +  S+ +F +T+ P LK S
Sbjct  5    ILETCRVPAPPGAAADLSLPLTFFDLPWLHFHPIRRLLFYDYPCSKPYFLETVAPKLKES  64

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGD-GVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ L++Y  LA  L  P +    PE  Y  G+  V L  A   +++  FD L+ NHAR+
Sbjct  65   LSLTLRHYLPLAGDLIFPLNSEKKPEIQYVAGESAVSLTVA---ESASDFDHLTGNHARD  121

Query  448  SKEFYPLIPTLPSV-------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            + +FY  +P +  V       R  + A+KVTLFP  GICV  A  H +GD SS+ GF+KA
Sbjct  122  ADQFYEFVPEIDPVTDESEYQRVPVVALKVTLFPGRGICVRFANLHCLGDASSVVGFIKA  181

Query  607  WTALSLLG  630
            W ++S LG
Sbjct  182  WASISKLG  189



>ref|XP_009620757.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
{ECO:0000303|PubMed:11598135}-like [Nicotiana 
tomentosiformis]
Length=453

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 109/189 (58%), Gaps = 10/189 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A+V+EQ  V P PG     +LPL +FD  WL    + R++FY+  +SR  F  TIIP LK
Sbjct  2    ASVIEQCQVVPSPGSATELTLPLTYFDHVWLAFHRMRRILFYKLPISRPDFVQTIIPTLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+ L+YY  LA  +A P D+S  PE  Y  G+ V ++F+ SD +   F+ L   H R
Sbjct  62   DSLSLTLKYYLPLAGNVACPQDWSGYPELRYVTGNSVSVIFSESDMD---FNYLIGYHPR  118

Query  445  NSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            N+K FY  IP L   +         + A++VTLFP  GI +G   HHV GDG++I  F++
Sbjct  119  NTKNFYHFIPQLAESKDAPGVQLAPVLAIQVTLFPNHGISIGFTNHHVAGDGATIVKFVR  178

Query  604  AWTALSLLG  630
            AW  L+  G
Sbjct  179  AWALLNKFG  187



>dbj|BAD93691.1| malonyltransferase [Nicotiana tabacum]
Length=453

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 112/189 (59%), Gaps = 10/189 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A+V+EQ  V P PG     +LPL +FD  WL    + R++FY+  +SR  F  TIIP LK
Sbjct  2    ASVIEQCQVVPSPGSATELTLPLTYFDHVWLAFHRMRRILFYKLPISRPDFVQTIIPTLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+ L+YY  LA  +A P D+S  PE  Y  G+ V ++F+ SD +   F+ L   H R
Sbjct  62   DSLSLTLKYYLPLAGNVACPQDWSGYPELRYVTGNSVSVIFSESDMD---FNYLIGYHPR  118

Query  445  NSKEFYPLIPTL------PSVRRG-MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            N+K+FY  +P L      P V+   + A++VTLFP  GI +G   HHV GDG++I  F++
Sbjct  119  NTKDFYHFVPQLAEPKDAPGVQLAPVLAIQVTLFPNHGISIGFTNHHVAGDGATIVKFVR  178

Query  604  AWTALSLLG  630
            AW  L+  G
Sbjct  179  AWALLNKFG  187



>ref|XP_010657385.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Vitis 
vinifera]
Length=336

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 111/193 (58%), Gaps = 12/193 (6%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            P    V+E   +APPPG V G SLPL FFDL WLH   ++   FY+ +  +T+F +TIIP
Sbjct  4    PEMVHVLEHCRIAPPPGSVDGKSLPLTFFDLPWLHFPLMNFFFFYEFSHPKTYFVETIIP  63

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             LK SLS+ L+++  L+  L  P D S  PE  Y DGD V L F    + S  FD LS +
Sbjct  64   RLKHSLSLTLKHFFPLSGNLIFPLDCSI-PEIRYKDGDSVSLTFV---EGSFDFDHLSGH  119

Query  436  HARNSKEFYPLIPTLPSVRRGMF--------AVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
            H RN  +F+PL   +       F        A++VTLFP +GIC+G  +HH+ G+ ++ F
Sbjct  120  HQRNEIDFHPLAVQMSPASTSTFGPLIVPLLAIQVTLFPNSGICIGFTFHHIAGNANTFF  179

Query  592  GFMKAWTALSLLG  630
               ++W +++ LG
Sbjct  180  RLARSWASINKLG  192



>pdb|2XR7|A Chain A, Crystal Structure Of Nicotiana Tabacum Malonyltransferase 
(Ntmat1) Complexed With Malonyl-Coa
Length=453

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 111/189 (59%), Gaps = 10/189 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A+V+EQ  V P PG     +LPL +FD  WL      R++FY+  +SR  F  TIIP LK
Sbjct  2    ASVIEQCQVVPSPGSATELTLPLTYFDHVWLAFHRXRRILFYKLPISRPDFVQTIIPTLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+ L+YY  LA  +A P D+S  PE  Y  G+ V ++F+ SD +   F+ L   H R
Sbjct  62   DSLSLTLKYYLPLAGNVACPQDWSGYPELRYVTGNSVSVIFSESDXD---FNYLIGYHPR  118

Query  445  NSKEFYPLIPTL------PSVRRG-MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            N+K+FY  +P L      P V+   + A++VTLFP  GI +G   HHV GDG++I  F++
Sbjct  119  NTKDFYHFVPQLAEPKDAPGVQLAPVLAIQVTLFPNHGISIGFTNHHVAGDGATIVKFVR  178

Query  604  AWTALSLLG  630
            AW  L+  G
Sbjct  179  AWALLNKFG  187



>pdb|2E1T|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat Complexed 
With Malonyl-coa
 pdb|2E1T|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat Complexed 
With Malonyl-coa
 pdb|2E1U|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat
 pdb|2E1U|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat
 dbj|BAF50706.1| anthocyanin malonyltransferase homolog [Chrysanthemum x morifolium]
Length=454

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 112/192 (58%), Gaps = 10/192 (5%)
 Frame = +1

Query  88   AVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
             V+EQS V+PPP  +   SL L FFD  WL   P++ L FY+  ++R+ F +T++P++K 
Sbjct  8    TVLEQSQVSPPPDTLGDKSLQLTFFDFFWLRSPPINNLFFYELPITRSQFTETVVPNIKH  67

Query  268  SLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            SLSI L+++     KL V    +  PE  Y +GD V + FA  + +      L+ NH RN
Sbjct  68   SLSITLKHFYPFVGKLVVYPAPTKKPEICYVEGDSVAVTFAECNLDLNE---LTGNHPRN  124

Query  448  SKEFYPLIPTL-------PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
              +FY L+P L         ++  +F+V+VTLFP  GI +GI  HH +GD S+ F F+KA
Sbjct  125  CDKFYDLVPILGESTRLSDCIKIPLFSVQVTLFPNQGIAIGITNHHCLGDASTRFCFLKA  184

Query  607  WTALSLLGHKSS  642
            WT+++  G+   
Sbjct  185  WTSIARSGNNDE  196



>pdb|2E1V|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno- 
Methionine Derivative
 pdb|2E1V|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno- 
Methionine Derivative
Length=454

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 112/192 (58%), Gaps = 10/192 (5%)
 Frame = +1

Query  88   AVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
             V+EQS V+PPP  +   SL L FFD  WL   P++ L FY+  ++R+ F +T++P++K 
Sbjct  8    TVLEQSQVSPPPDTLGDKSLQLTFFDFFWLRSPPINNLFFYELPITRSQFTETVVPNIKH  67

Query  268  SLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            SLSI L+++     KL V    +  PE  Y +GD V + FA  + +      L+ NH RN
Sbjct  68   SLSITLKHFYPFVGKLVVYPAPTKKPEICYVEGDSVAVTFAECNLDLNE---LTGNHPRN  124

Query  448  SKEFYPLIPTL-------PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
              +FY L+P L         ++  +F+V+VTLFP  GI +GI  HH +GD S+ F F+KA
Sbjct  125  CDKFYDLVPILGESTRLSDCIKIPLFSVQVTLFPNQGIAIGITNHHCLGDASTRFCFLKA  184

Query  607  WTALSLLGHKSS  642
            WT+++  G+   
Sbjct  185  WTSIARSGNNDE  196



>ref|XP_011079049.1| PREDICTED: anthocyanidin 3-O-glucoside 6''-O-acyltransferase-like 
[Sesamum indicum]
Length=483

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 115/196 (59%), Gaps = 12/196 (6%)
 Frame = +1

Query  55   HMAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTH  234
            H+  SS  T  +++E   ++P PG  A  SLP+ F D+ WLH  P+ RL+FY+   S+++
Sbjct  17   HLTASSSMT--SLLESCQISPAPGGAAELSLPMTFIDIFWLHFHPIRRLLFYEFPCSKSY  74

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            F +T++P LK SLS  L++Y  LA  L  P++    P   Y  G+ V +  A S ++   
Sbjct  75   FLETLVPKLKESLSQTLKHYLPLAGNLVYPSNTERKPIIRYVAGESVSVSIAESAND---  131

Query  415  FDCLSSNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVG  573
            FD L  NHAR++ +FY  +P L  +          + AV+VTLFP+ GIC+G+  HH  G
Sbjct  132  FDNLVGNHARDADQFYDFMPQLQLITDESGDKLLRLLAVQVTLFPDRGICIGLTNHHSAG  191

Query  574  DGSSIFGFMKAWTALS  621
            D +SI GF+++W  +S
Sbjct  192  DANSIVGFIRSWATIS  207



>ref|XP_011093435.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 111/188 (59%), Gaps = 11/188 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E   V  PPG  A  SLPL FFD+ WLH  P+ RL+FY +  S+ +F +T+ P LK S
Sbjct  5    ILEICRVPAPPGAAADLSLPLTFFDIPWLHFHPIRRLLFYDYPCSKPYFLETVAPKLKES  64

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGD-GVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ L++Y  LA  L  P +    PE  Y  G+  V L  A   +++  F  L+ NHAR+
Sbjct  65   LSLTLRHYLPLAGDLIFPLNSEKKPEIQYVAGESAVSLTIA---ESASDFHHLTGNHARD  121

Query  448  SKEFYPLIPTLPSV-------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            + +FY  +P +  V       R  + A+KVTLFP  GICVG A  H +GD SS+ GF+KA
Sbjct  122  ADQFYEFVPEIDPVTDESEYQRVPVVALKVTLFPGRGICVGFANLHCLGDASSVVGFIKA  181

Query  607  WTALSLLG  630
            W ++S LG
Sbjct  182  WASISKLG  189



>ref|XP_009769443.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Nicotiana sylvestris]
Length=452

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 115/190 (61%), Gaps = 11/190 (6%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A+++EQ  VAPPPG  A  +LPL +FD  WL  +   R++FY+  +S+  F  TIIP LK
Sbjct  2    ASLIEQCQVAPPPGSAAELTLPLTYFDNLWLLFNHNRRILFYKFPISKPEFVQTIIPTLK  61

Query  265  TSLSIALQYYPLLAAKLAVP-TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
             SLS+AL++Y  LA  +  P  D S+ PE  Y  G+ V + F+ ++ +   FD L  NH 
Sbjct  62   DSLSLALKHYLPLAGNVVCPLLDCSSYPELRYVTGNSVSVTFSETNMD---FDFLVGNHP  118

Query  442  RNSKEFYPLIPTL------PSVRRG-MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            RN K+FY  +P L      P V+   + A++VTLFP  GI +G   HHVVGDG++I  F+
Sbjct  119  RNLKDFYHFVPQLREPKDAPGVQLAPVLAIQVTLFPNHGISIGFTNHHVVGDGATIVRFI  178

Query  601  KAWTALSLLG  630
            +AW  L+  G
Sbjct  179  RAWALLTKFG  188



>ref|XP_002313292.2| hypothetical protein POPTR_0009s06800g [Populus trichocarpa]
 gb|EEE87247.2| hypothetical protein POPTR_0009s06800g [Populus trichocarpa]
Length=471

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 112/198 (57%), Gaps = 16/198 (8%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA+SS      VVE   V+PPP       LPL F D+ WL  SP   L FY++  S +HF
Sbjct  1    MAKSST---VKVVEHCIVSPPPNSAPPTILPLTFLDIPWLFFSPSQPLTFYEYPHSTSHF  57

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
              T IP LK SLS+ALQ++   A  L      ST P  VY DGD V L  A   ++SG F
Sbjct  58   LSTTIPSLKHSLSLALQHFFPFAGNLVFSPAGSTKPNIVYNDGDYVTLTVA---ESSGDF  114

Query  418  DCLSSNHARNSKEFYPLIPTLP---SVRRG-------MFAVKVTLFPEAGICVGIAYHHV  567
               +SN+AR+   FYPL+P L    +V  G       +FAV+VT+F   GIC+G+AYHHV
Sbjct  115  SYFTSNYARDVNGFYPLVPKLATTSTVATGTREEVVPLFAVQVTVFANCGICIGLAYHHV  174

Query  568  VGDGSSIFGFMKAWTALS  621
            V DG +   F+KAW  LS
Sbjct  175  VADGRTFNNFIKAWAFLS  192



>gb|AAL50565.1|AF405204_1 malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
[Perilla frutescens]
Length=447

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 112/188 (60%), Gaps = 13/188 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E   + PPP      S+PL+FFD+KWLH  P+ RL+FY H  S+  F D I+PHLK S
Sbjct  5    LLETCRILPPP--TDEVSIPLSFFDMKWLHFHPLRRLLFYDHPCSKPQFLDAIVPHLKQS  62

Query  271  LSIALQYYPLLAAKLAVP-TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ L++Y  +A  L  P ++    P      GD VPL  A   +++  FD L+ NHAR+
Sbjct  63   LSLTLKHYLPVAGNLLYPSSNTDQKPRLRCVAGDSVPLTIA---ESTTDFDMLTGNHARD  119

Query  448  SKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            + +FY  +  +P +          +F+++VTLFP  GIC+G++ HH +GD  S+ GF+ A
Sbjct  120  ADQFYDFVAPMPPIAEEFECKIVPVFSLQVTLFPGRGICIGLSNHHCLGDARSVVGFVLA  179

Query  607  WTALSLLG  630
            W +++  G
Sbjct  180  WASINKFG  187



>emb|CAN83833.1| hypothetical protein VITISV_039456 [Vitis vinifera]
Length=457

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 108/188 (57%), Gaps = 12/188 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E   +APPPG V G SL L FFDL WLH   +    FY+ +  +T+F +TIIP LK S
Sbjct  9    VLEHCRIAPPPGSVDGKSLSLTFFDLPWLHFPLMKLFFFYEFSHPKTYFVETIIPRLKHS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L+++  L+  L  P D S  PE  Y DGD V L F    + S  FD LS NH RN 
Sbjct  69   LSLTLKHFFPLSGNLIFPLDCSI-PEIRYKDGDSVSLTFV---EGSFDFDHLSGNHQRND  124

Query  451  KEFYPLIPTLPSVRRGMF--------AVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
             +F+PL   +       F        A++VTLFP +GIC+G  +HH+ GD ++ F   ++
Sbjct  125  IDFHPLAVQMSPASTSTFGPLIVPLLAIQVTLFPNSGICIGFTFHHIAGDANTFFRLARS  184

Query  607  WTALSLLG  630
            W +++ LG
Sbjct  185  WASINKLG  192



>ref|XP_011025419.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Populus 
euphratica]
Length=471

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 111/198 (56%), Gaps = 16/198 (8%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA+SS      VVE   V+PPP       LPL F D+ WL  SP   L FY +  S +HF
Sbjct  1    MAKSST---VRVVEHCKVSPPPNSAPPTILPLTFLDIPWLFFSPSQTLTFYGYPQSTSHF  57

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
              T IP LK SLS ALQ++   A  L +    S  P+ VY +GD V L  A   ++SG F
Sbjct  58   LSTTIPKLKHSLSHALQHFFPFAGDLVLSPAGSNKPKIVYNEGDSVKLTVA---ESSGDF  114

Query  418  DCLSSNHARNSKEFYPLIPTLP---SVRRG-------MFAVKVTLFPEAGICVGIAYHHV  567
               +SN+AR+   FYPL+P L    SV  G       +FAV+VT+F   GIC+G+AYHHV
Sbjct  115  SYFTSNYARDVNGFYPLVPKLATTSSVATGTQEEVVPLFAVQVTVFANCGICIGLAYHHV  174

Query  568  VGDGSSIFGFMKAWTALS  621
            V DG +   F+KAW  LS
Sbjct  175  VADGRTFNNFIKAWALLS  192



>ref|XP_002276090.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Vitis vinifera]
Length=454

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 115/191 (60%), Gaps = 11/191 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E   +AP PG V   SLPL FFD+ WLH   +  L FY+    ++HF DTIIP LK S
Sbjct  9    VLEHCRLAPAPGTVDEKSLPLTFFDIPWLHFPLIQHLFFYEFPYPKSHFIDTIIPLLKHS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+AL+++   A KL  P ++   PE  Y  GD V LVFA S+ +   F+ ++ NH RN 
Sbjct  69   LSLALKHFYPFAGKLIFPPNFGK-PEIRYVSGDAVSLVFAESNKD---FNHITGNHQRNV  124

Query  451  KEFYPLIPTLP-------SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
             EF+ L+  LP       S+   + AV+VTLFP +GIC+G  +  V  DG++   F+++W
Sbjct  125  AEFHSLVAQLPPVSIISDSLVAPLLAVQVTLFPNSGICIGFTFRRVTADGNACTRFIRSW  184

Query  610  TALSLLGHKSS  642
             +++ +G +++
Sbjct  185  ASINKVGRETT  195



>emb|CAN71050.1| hypothetical protein VITISV_003717 [Vitis vinifera]
Length=449

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 114/191 (60%), Gaps = 11/191 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E   +AP PG V   SLPL FFD+ WLH   +  L FY+    ++HF DTIIP LK S
Sbjct  4    VLEHCRLAPAPGTVDEKSLPLTFFDIPWLHFPLIQHLFFYEFPYPKSHFIDTIIPLLKHS  63

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+AL+++   A KL  P ++   PE  Y  GD V LVFA S+ +   F+ ++ NH RN 
Sbjct  64   LSLALKHFYPFAGKLIFPPNFGK-PEIRYVSGDAVSLVFAESNKD---FNHITGNHQRNV  119

Query  451  KEFYPLIPTLPSVRR-------GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
             EF+ L+  LP V          + AV+VTLFP +GIC+G  +  V  DG++   F+++W
Sbjct  120  AEFHSLVAQLPPVSXISDXLVAPLLAVQVTLFPNSGICIGFTFRRVTADGNACTRFIRSW  179

Query  610  TALSLLGHKSS  642
             +++ +G +++
Sbjct  180  ASINKVGRETT  190



>emb|CDP11900.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 117/195 (60%), Gaps = 15/195 (8%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVA-GFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTI  249
            P    V++ S V+PP    A   SLPL F D+ WLH SP+ RL+ Y+   +SR HF + I
Sbjct  4    PDAVTVLKHSLVSPPSSAAATEMSLPLTFLDMPWLHFSPIQRLVLYEVPQLSRAHFIEHI  63

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTD-YSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            IP L+ SLS+ LQ++  LA  L VP++  S  PE  Y +G  + L+ A  +  +  F+ L
Sbjct  64   IPKLEHSLSLTLQHFLPLAGNLIVPSNSNSGTPEIRYKNGSSLALIIA--ECTTTDFNYL  121

Query  427  SSNHARNSKEFYPLIPTL-PSVRRG---------MFAVKVTLFPEAGICVGIAYHHVVGD  576
            ++NH+RN  +F+PLIP L PS +           + A++VTLFP  G+ VGI+ HH VGD
Sbjct  122  TANHSRNCCDFHPLIPELKPSNQDDSGSTAWTTPVLALQVTLFPHCGMSVGISNHHTVGD  181

Query  577  GSSIFGFMKAWTALS  621
              S+F FMK W ALS
Sbjct  182  AGSVFRFMKTWAALS  196



>emb|CAN64565.1| hypothetical protein VITISV_044304 [Vitis vinifera]
Length=433

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 114/193 (59%), Gaps = 13/193 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKV--AGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            V+E+  VAPPP  V     SLPL FFD+ WLH   +  LIFY     +THF +TIIP+ K
Sbjct  9    VLERCQVAPPPVMVDEKSKSLPLTFFDMPWLHSHLMESLIFYAFPHPKTHFIETIIPNFK  68

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+AL+++  LA  L  P ++ T PE  Y DGD V L+FA S  +   F+ L  NH R
Sbjct  69   HSLSLALRHFYFLAGNLIFPPNF-TKPEIRYKDGDSVSLIFAESTRD---FNYLIGNHPR  124

Query  445  NSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            N  EF+PL+P L  V          + A++VTLFP  GI +G  + H V DG++   F++
Sbjct  125  NVAEFHPLVPQLSPVSMSSSILAAPLLAIQVTLFPNFGISLGFTFPHSVADGNTFSQFVR  184

Query  604  AWTALSLLGHKSS  642
             W +++ LG +++
Sbjct  185  LWASINKLGEETA  197



>gb|EYU24862.1| hypothetical protein MIMGU_mgv1a006330mg [Erythranthe guttata]
Length=448

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 109/194 (56%), Gaps = 13/194 (7%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            AA++E+  + P P  VA  +LPL  FD+ WL+  PV RL+F+    SRTHF D+I+P LK
Sbjct  3    AALIERCQIQPSPDTVAELTLPLLHFDITWLYFHPVQRLLFFDLPCSRTHFLDSIVPQLK  62

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTP-PEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
             SL   L ++  LA  +  P +   P   FV   GD V L  A    N   +  L+ NHA
Sbjct  63   ESLLRTLNHFLPLAGNIVHPINAGRPFSRFVV--GDSVTLTIAECSKN---YKHLTRNHA  117

Query  442  RNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            R++ EFY  +P LP  R         + A++VTLFPE G+C+G   HH +GD S+I  F+
Sbjct  118  RSADEFYACVPQLPPARHAPDAVVLPVLALQVTLFPEHGLCLGFTNHHAIGDASTIVRFI  177

Query  601  KAWTALSLLGHKSS  642
            KAW +++  G  S 
Sbjct  178  KAWASVNRFGGDSK  191



>emb|CAN83656.1| hypothetical protein VITISV_009941 [Vitis vinifera]
Length=456

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 110/187 (59%), Gaps = 11/187 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E   +APPPG V G SL L FFDL WLH   +    FY+ +  +T+F +TIIP LK S
Sbjct  9    VLEHCRIAPPPGSVDGKSLSLTFFDLPWLHFPLMKLFFFYEFSHPKTYFVETIIPRLKHS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L+++  L+  L  P D S  PE  Y DGD V L F    + S  FD LS NH RN 
Sbjct  69   LSLTLKHFFPLSGNLIFPLDCSI-PEIRYKDGDSVSLTFV---EGSFDFDHLSGNHQRND  124

Query  451  KEFYPLIPTL--PSVRRG-----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
             +F+PL   +   S   G     + A++VTLFP +GIC+G  +HH+ GD ++   F ++W
Sbjct  125  IDFHPLAVQMSPASTTFGPLIVPLLAIQVTLFPNSGICIGFTFHHIAGDANTFVRFARSW  184

Query  610  TALSLLG  630
             +++ LG
Sbjct  185  ASINKLG  191



>gb|EYU24856.1| hypothetical protein MIMGU_mgv1a017714mg [Erythranthe guttata]
Length=462

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 110/189 (58%), Gaps = 12/189 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAG-FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
            +++   + PPP   A    LPL+FFD+ W+   P+ RL+FY+++ S +HF +T++P LK 
Sbjct  10   LIKTCRIPPPPSSAAAELQLPLSFFDIVWIRSQPIRRLLFYEYSCSESHFLETLVPKLKE  69

Query  268  SLSIALQYYPLLAAKLAVPTDYST-PPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
            SLS+ L++Y  LA  L  P + +   P   Y  GD V L  AVS  N   FD L  NH R
Sbjct  70   SLSLTLKHYLPLAGNLLYPLNTADHKPLLRYVSGDSVSLKIAVSGRN---FDELVGNHPR  126

Query  445  NSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            ++ +FY  +P +P            +FA++VTLFP  GIC+G +  H +GD  SI GFM+
Sbjct  127  DADQFYDFVPEIPPATEDSEYKIVPVFALQVTLFPGRGICIGFSNLHSLGDARSIAGFMQ  186

Query  604  AWTALSLLG  630
            AW ++S  G
Sbjct  187  AWASISKSG  195



>emb|CDP11905.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 116/193 (60%), Gaps = 13/193 (7%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTH  234
            MA S  PT   V+++    PPPG V+  SL L+FFD+ WLH  PV RL+FY+   +++T+
Sbjct  1    MAPSGEPT--TVLDRCLATPPPGLVSRMSLRLSFFDVLWLHAPPVQRLVFYEIPEITKTN  58

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYS-TPPEFVYGDGDGVPLVFAVSDDNSG  411
            F + IIP L+ SL++ L+YY  LA  L +P +     PE +Y  G+ VPL+  V++ N+ 
Sbjct  59   FIEEIIPKLRDSLNLTLKYYIPLAGNLIIPPNSGPDSPEILYKRGNSVPLI--VAESNAM  116

Query  412  RFDCLSSNHARNSKEFYPLIPTL-------PSVRRGMFAVKVTLFPEAGICVGIAYHHVV  570
             F+ L +NHAR+S +F+ L+P L        S+   + A++VTLFP  G  +GI  H   
Sbjct  117  DFEWLVANHARDSSDFHCLVPKLVQSTDDSGSILSSVLALQVTLFPNMGFSIGITSHQAA  176

Query  571  GDGSSIFGFMKAW  609
            GD  +IF F + W
Sbjct  177  GDACTIFRFSRIW  189



>emb|CBI18011.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 117/205 (57%), Gaps = 13/205 (6%)
 Frame = +1

Query  55   HMAQSSPPTYAAVVEQSSVAPPPGKV--AGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSR  228
            H+A  +      V+E+  VAPPP  V     SLPL FFD+ WLH   +  LIFY     +
Sbjct  18   HLAHMASFETVNVLERCQVAPPPVMVDEKSKSLPLTFFDMPWLHSHLMESLIFYAFPHPK  77

Query  229  THFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNS  408
            THF + IIP+ K SLS+AL+++  LA  L  P ++ T PE  Y DGD V L+FA S  + 
Sbjct  78   THFIEAIIPNFKHSLSLALRHFYFLAGNLIFPPNF-TKPEIRYKDGDSVSLIFAESTRD-  135

Query  409  GRFDCLSSNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHV  567
              F+ L  NH RN  EF+PL+P L  V          + A++VTLFP  GI +G  + H 
Sbjct  136  --FNYLIGNHPRNVAEFHPLVPQLSPVSMSSSILAAPLLAIQVTLFPNFGISLGFTFPHS  193

Query  568  VGDGSSIFGFMKAWTALSLLGHKSS  642
            V DG++   F++ W +++ LG +++
Sbjct  194  VADGNTFSQFVRLWASINKLGEETA  218



>gb|AAS77404.1| quercetin 3-O-glucoside-6''-O-malonyltransferase [Lamium purpureum]
Length=461

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 105/172 (61%), Gaps = 11/172 (6%)
 Frame = +1

Query  145  LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVP  324
            LPL +FD+ WL+  P+ RL+FYQH  S THF  TIIP+LK SLS  L+ YP LA  L  P
Sbjct  30   LPLTYFDVLWLYFHPIKRLLFYQHPCSATHFLQTIIPNLKNSLSQTLRRYPPLAGHLFYP  89

Query  325  TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRRG--  498
             D S  PE  Y  GD V + FA S + +  F+ L+ + AR + EF+  +P LP  +    
Sbjct  90   LD-SGFPELRYLPGDSVTVTFAESTE-AFDFNYLTGDQARVADEFHHFVPDLPQHKIDSD  147

Query  499  -------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLLGH  633
                   + A++VTLFPE GI VG   +HV GD SSI GF+KAW++ S LGH
Sbjct  148  SGFRIIPLLAIQVTLFPETGISVGFTNNHVAGDASSIVGFIKAWSSSSKLGH  199



>ref|XP_006367188.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Solanum 
tuberosum]
Length=454

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 109/187 (58%), Gaps = 10/187 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A+V+EQ  V P P   A  +L L +FD  WL      RL+FY   +S+ HF  TIIP LK
Sbjct  2    ASVIEQCQVEPHPSGAAELTLRLTYFDHTWLAFGRNRRLLFYNLPISKPHFVQTIIPSLK  61

Query  265  TSLSIALQYYPLLAAKLAVP-TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
             SLS+AL++Y +LA  L  P  + S  PE  Y  GD V ++F+ + D +  F+ L  NH 
Sbjct  62   HSLSLALKHYTILAGNLVCPIINSSGYPELRYNTGDSVSVIFSETIDMN--FNYLIGNHP  119

Query  442  RNSKEFYPLIPTL------PSVRRG-MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            RN+K+ YPLIP L      P V+   + A+KVTLFP  GI +G + HH   DG++I  F 
Sbjct  120  RNAKDLYPLIPQLAEPKDAPGVQLAPILAIKVTLFPNFGISIGFSNHHAACDGNTIVRFT  179

Query  601  KAWTALS  621
            +AW  L+
Sbjct  180  RAWALLN  186



>ref|XP_010657393.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Vitis 
vinifera]
Length=458

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 113/193 (59%), Gaps = 13/193 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKV--AGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            V+E+  VAPPP  V     SLPL FFD+ WLH   +  LIFY     +THF + IIP+ K
Sbjct  9    VLERCQVAPPPVMVDEKSKSLPLTFFDMPWLHSHLMESLIFYAFPHPKTHFIEAIIPNFK  68

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+AL+++  LA  L  P ++ T PE  Y DGD V L+FA S  +   F+ L  NH R
Sbjct  69   HSLSLALRHFYFLAGNLIFPPNF-TKPEIRYKDGDSVSLIFAESTRD---FNYLIGNHPR  124

Query  445  NSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            N  EF+PL+P L  V          + A++VTLFP  GI +G  + H V DG++   F++
Sbjct  125  NVAEFHPLVPQLSPVSMSSSILAAPLLAIQVTLFPNFGISLGFTFPHSVADGNTFSQFVR  184

Query  604  AWTALSLLGHKSS  642
             W +++ LG +++
Sbjct  185  LWASINKLGEETA  197



>ref|XP_011100332.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=450

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 108/189 (57%), Gaps = 9/189 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A V+E   V  PP      S+PL F D+ WLH +PVHRL+FY +  S+ +F +T+ P LK
Sbjct  2    ATVLETCRVLAPPCVAPELSMPLNFLDIPWLHSNPVHRLLFYDYPCSKPYFLETVAPKLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+ L++Y L+A  L    +    PE  Y   D   +   +++  SG FD +  NHAR
Sbjct  62   ESLSLTLRHYLLVAGDLIFHLNSEKVPEIRYVARDSA-VSLTIAESASG-FDDIIGNHAR  119

Query  445  NSKEFYPLIPTLPSV-------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            ++ +FY  +  +  V       R  + A+KVTLFP  G+C+G    H +GD SSI GFMK
Sbjct  120  DADQFYEFVAEIDPVTDESGYQRLPVMALKVTLFPGRGMCIGFTNLHCLGDASSIVGFMK  179

Query  604  AWTALSLLG  630
            AW ++S LG
Sbjct  180  AWASISKLG  188



>ref|XP_010657386.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Vitis vinifera]
Length=432

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 110/197 (56%), Gaps = 11/197 (6%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDT  246
            +S      V+E+  V+PPP  V   SLPL FFDL WLH   V  L FY+   S+THF + 
Sbjct  2    ASSDEMVNVLEECRVSPPPNAVGEKSLPLTFFDLLWLHFHLVQSLFFYKFPHSKTHFIEI  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
             IP LK SLS+AL+++   A  L  P +    PE  Y DGD V L F  S+ +   FD L
Sbjct  62   TIPSLKHSLSLALKHFYPFAGNLLFPPNLRE-PEIHYVDGDSVSLTFVESNSD---FDYL  117

Query  427  SSNHARNSKEFYPLIPTLP--SVRRG-----MFAVKVTLFPEAGICVGIAYHHVVGDGSS  585
              NH R    F+PL+P LP  SV++G     +FAV+VTLFP +GI  G    HVV DG++
Sbjct  118  IKNHQRKIAHFHPLVPQLPPVSVQQGTIIAPVFAVQVTLFPNSGISFGFTCDHVVADGNA  177

Query  586  IFGFMKAWTALSLLGHK  636
               F++ W  +  L  +
Sbjct  178  FIRFIRLWATIHKLQRE  194



>ref|XP_010940606.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Elaeis guineensis]
Length=463

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 114/197 (58%), Gaps = 8/197 (4%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDT  246
            +S P+   V++Q  ++PPPG V   SLPL FFD+ WL   PV R+ FY      +HF   
Sbjct  2    ASSPSSLQVLDQFQISPPPGSVPDTSLPLTFFDIVWLFTGPVERVFFYPFPHPTSHFVTH  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEF--VYGDGDGVPLVFAVSDDNSGRFD  420
            ++P LK+SLS+ LQ++  LA ++    D S+  +F   Y  GD + L+ A   D+   FD
Sbjct  62   LLPTLKSSLSLTLQHFYPLAGRVRSSPDPSSDSKFEICYSAGDSITLISAECSDD---FD  118

Query  421  CLSSNHARNSKEFYPLIPTLPSVRRG---MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
             LS NH RN +E Y LIP LP    G   + A++VTLFP+ GI +G+A HHV  D SS  
Sbjct  119  QLSGNHPRNFRELYKLIPQLPHSNDGTIPLLALQVTLFPDHGISIGVAIHHVACDDSSSM  178

Query  592  GFMKAWTALSLLGHKSS  642
             F+K+W A   LG   S
Sbjct  179  HFIKSWAASCRLGGSDS  195



>gb|EYU24859.1| hypothetical protein MIMGU_mgv1a023480mg [Erythranthe guttata]
Length=458

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 109/190 (57%), Gaps = 13/190 (7%)
 Frame = +1

Query  91   VVEQSSVAPPP--GKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            +VE   + PPP     A   LPL+F D+ W+H  P+  L+ Y+++ S +HF +T++P LK
Sbjct  5    LVETCQIPPPPCSSAAAELQLPLSFLDIVWIHSKPMRGLLLYKYSCSESHFLETLVPKLK  64

Query  265  TSLSIALQYYPLLAAKLAVPTDYST-PPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
             SLS+ L++Y  LA  L  P + +   P   Y  GD V L  AVS    G FD L  NH 
Sbjct  65   ESLSLTLKHYLPLAGNLLYPLNTADHKPLLRYVSGDSVSLKIAVS---GGNFDDLVGNHP  121

Query  442  RNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            R++ +FY  +P +P            +FA++VTLFP  GIC+G++  H +GD  SI GFM
Sbjct  122  RDADQFYDFVPEIPPATEDSEYKIVPVFALQVTLFPGRGICIGLSNLHSLGDARSIAGFM  181

Query  601  KAWTALSLLG  630
            +AW ++S  G
Sbjct  182  RAWASISKSG  191



>ref|XP_004248143.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
[Solanum lycopersicum]
Length=454

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 104/188 (55%), Gaps = 10/188 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A V+EQ  VAPPPG      LPL +FD  WL    + R++FY+ ++S+  F   IIP LK
Sbjct  2    ATVIEQCQVAPPPGGATEVILPLTYFDHVWLGFRRMRRILFYKLSISKPDFVQNIIPTLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+ L++Y  L   +A P + S  PE  Y  GD V   F  +D +   F+ L  NH R
Sbjct  62   HSLSLTLKHYTPLVGNIACPLNSSGYPELCYVTGDSVSDTFTETDMD---FNHLIGNHPR  118

Query  445  NSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            N+ +FYP IP L   +         + A++VTLFP  GI +G + HHV  DG+ I  F++
Sbjct  119  NANDFYPFIPQLAQPKDAPGLKLVPVLAIQVTLFPNLGISIGFSNHHVACDGNIIVKFIR  178

Query  604  AWTALSLL  627
             W  L+ L
Sbjct  179  TWGLLNKL  186



>gb|AAQ63615.1| anthocyanidin 3-O-glucoside-6''-O-malonyltransferase [Chrysanthemum 
x morifolium]
Length=459

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 118/197 (60%), Gaps = 15/197 (8%)
 Frame = +1

Query  88   AVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
             ++EQS ++ PPG +   SLPL FFD+ W+   PVH + FY+   S++HF +T++P+LK 
Sbjct  8    TILEQSRISSPPGTIGERSLPLTFFDIGWVPFPPVHHVFFYRFPHSKSHFLETVVPNLKH  67

Query  268  SLSIALQYYPLLAAKLAVPTDYS-----TPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSS  432
            SLS+ALQ++   A+ L V  +         PE  + +GD V L FA   + S  F+ L+ 
Sbjct  68   SLSLALQHFFPFASNLYVSPNADDFGVIRKPEIRHVEGDYVALTFA---ECSLDFNDLTG  124

Query  433  NHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
            NH R  + FYPL+P L +V +        +F+V+VT F ++GI +G+  HH +GD S+  
Sbjct  125  NHPRKCENFYPLVPPLGNVVKMADCVTIPLFSVQVTYFRDSGISIGMTNHHSLGDASTRL  184

Query  592  GFMKAWTALSLLGHKSS  642
            GF+K WT+++  G   S
Sbjct  185  GFLKVWTSIAKSGGDQS  201



>ref|XP_008779426.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Phoenix dactylifera]
Length=464

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 111/197 (56%), Gaps = 8/197 (4%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDT  246
            +S PT   +++Q  ++PPPG V   SLPL FFD+ WL   PV R+ FY      +HF   
Sbjct  2    ASSPTSLQILDQFQISPPPGSVPETSLPLTFFDIVWLFTGPVERVFFYPFPHPTSHFVTH  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEF--VYGDGDGVPLVFAVSDDNSGRFD  420
            ++P LK+SLS+ LQ++  LA ++    D S+  EF      GD V L+ A   + S  F 
Sbjct  62   LLPTLKSSLSLTLQHFYPLAGRVRPSPDPSSDAEFEICSSGGDSVALILA---ECSHDFH  118

Query  421  CLSSNHARNSKEFYPLIPTLPSVRRG---MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
             LS +H RN  E Y LIP LP    G   + A++VTLFPE GI +G+A HHV  D SS  
Sbjct  119  QLSGDHPRNFGELYELIPQLPHSNDGTIPLLALQVTLFPEHGISIGVAIHHVACDDSSSM  178

Query  592  GFMKAWTALSLLGHKSS  642
             F+K+W A   LG   S
Sbjct  179  HFIKSWAAACRLGGSDS  195



>gb|AAS77403.1| quercetin 3-O-glucoside-6''-O-malonyltransferase [Glandularia 
x hybrida]
Length=470

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 111/198 (56%), Gaps = 14/198 (7%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPP---GKVAGF---SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            P  A V+E+  VAP P   G  A     +LPL F D+ WLH  P  RL+FY+   S+ HF
Sbjct  5    PKPATVLERCRVAPAPPPNGSDAAEHPQTLPLVFSDMVWLHFHPTQRLLFYKFPCSKDHF  64

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
             + I+P+ K  LS AL+++   A  L    D    PE  Y  GD VP+  A S++ S  F
Sbjct  65   IEHIVPNFKKPLSQALKHFLPFAGNLIYEIDSGNIPELQYRPGDSVPVTVAESNEASD-F  123

Query  418  DCLSSNHARNSKEFYPLIPTLP--SVRRG-----MFAVKVTLFPEAGICVGIAYHHVVGD  576
            D LS +  R++ EFY   P  P   +  G     + AV++TLFP+ GIC+G   +H+VGD
Sbjct  124  DYLSGDRPRDAGEFYAFFPDFPPDKIESGWKKIPLLAVQITLFPDTGICIGFNNNHIVGD  183

Query  577  GSSIFGFMKAWTALSLLG  630
             SS+ GF+KAW+++   G
Sbjct  184  ASSVVGFIKAWSSICRHG  201



>ref|XP_008346924.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanin 5-aromatic acyltransferase-like 
[Malus domestica]
Length=474

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 114/211 (54%), Gaps = 28/211 (13%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAG--FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRT  231
            MA+ S P    ++E+  V+PPP   A    SLPL F D+ WL  SP   L FY      +
Sbjct  1    MARLSKPK---LLEKCQVSPPPNSSAAPKRSLPLTFLDIPWLFFSPSLPLFFY----XTS  53

Query  232  HFKDTIIPHLKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNS  408
            HF  T +P+LK SLS+ALQ +YP     LA P  +   PE +Y  GD V L    SD   
Sbjct  54   HFTSTTLPNLKHSLSLALQQFYPFAGTLLARP--HPEKPELLYTQGDSVSLTVVESD---  108

Query  409  GRFDCLSSNHARNSKEFYPLIPTLPSVRR-------------GMFAVKVTLFPEAGICVG  549
            G F+ LSSN  R + EF+ L+P L S                 + +V++T+FP  GIC+G
Sbjct  109  GDFEYLSSNSQRGAVEFHTLVPELASTGSIAHCSNEAQAADISLLSVQITVFPNCGICIG  168

Query  550  IAYHHVVGDGSSIFGFMKAWTALSLLGHKSS  642
            IAYHHVVGD  +   F+KAW + S LG  S+
Sbjct  169  IAYHHVVGDERTFNNFIKAWASFSRLGDSSN  199



>ref|XP_009354720.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Pyrus 
x bretschneideri]
Length=478

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 115/211 (55%), Gaps = 24/211 (11%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGF--SLPLAFFDLKWLHGSPVHRLIFYQHAVSRT  231
            MA+ S P    ++E+  V+PPP   A    SLPL F D+ WL  SP   L FY      +
Sbjct  1    MARLSKPK---LLEKCQVSPPPNSSAAPKPSLPLTFLDIPWLFFSPSLPLFFYDFPFPTS  57

Query  232  HFKDTIIPHLKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNS  408
            HF  T +P++K SLS+ALQ +YP     LA P  +   PE +Y  GD V L  A SD   
Sbjct  58   HFTSTALPNIKHSLSLALQQFYPFAGTLLARP--HPEKPELLYTQGDSVSLTVAESD---  112

Query  409  GRFDCLSSNHARNSKEFYPLIPTLPSV-------------RRGMFAVKVTLFPEAGICVG  549
            G F+ LSSN  R++ EF+ L+P L S                 + +V++T+FP  GIC+G
Sbjct  113  GDFEYLSSNSQRDAVEFHTLVPELASTGSIPNRSNEARAANISLLSVQITVFPNCGICIG  172

Query  550  IAYHHVVGDGSSIFGFMKAWTALSLLGHKSS  642
            +AYH VVGD  +   F+KAW + S LG  S+
Sbjct  173  LAYHQVVGDERTFNNFIKAWASFSRLGDSSN  203



>ref|XP_007219500.1| hypothetical protein PRUPE_ppa022332mg [Prunus persica]
 gb|EMJ20699.1| hypothetical protein PRUPE_ppa022332mg [Prunus persica]
Length=479

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 109/202 (54%), Gaps = 24/202 (12%)
 Frame = +1

Query  91   VVEQSSVAPPPGK----VAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPH  258
            V+EQ  V+PPP      ++  SLPL F D+ WL  SP   L FY+      HF  T++P+
Sbjct  9    VLEQCQVSPPPNSCSPDISQTSLPLTFLDIPWLFFSPSLPLFFYEFPFPTCHFTSTVLPN  68

Query  259  LKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
            LK SLS+ LQ +YP     +A+P      PE VY  GD V +    SD   G F  LSSN
Sbjct  69   LKHSLSLTLQHFYPFAGTLVALPE--PGIPELVYTQGDSVSVTVVESD---GDFVYLSSN  123

Query  436  HARNSKEFYPLIPTLPS--------------VRRGMFAVKVTLFPEAGICVGIAYHHVVG  573
              R  +EFY L+P L S               +  + +V++T+FP  GIC+G+AYHHVV 
Sbjct  124  FPREVEEFYTLVPELASSSSFAPISNATTQAAKLPLSSVQITVFPNCGICIGLAYHHVVA  183

Query  574  DGSSIFGFMKAWTALSLLGHKS  639
            DG +   F+KAW + S LG  S
Sbjct  184  DGRTFNNFIKAWASFSRLGDSS  205



>ref|XP_011100333.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=451

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 108/190 (57%), Gaps = 10/190 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLH-GSPVHRLIFYQHAVSRTHFKDTIIPHL  261
            A ++E   V  P G  A  S+PL FFD+ WLH   P+ RL+FY +  S+ HF +TI P L
Sbjct  2    ATILETCRVPAPSGAAAELSVPLTFFDIPWLHFPHPIRRLLFYDYPCSKPHFLETIAPKL  61

Query  262  KTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
            K SLS  L +Y  +A  L  P +     E  Y  GD V +   +++  S  FD L  NHA
Sbjct  62   KESLSSTLGHYLPVAGDLIFPLNSEKKAEIRYVAGDSV-VSLTIAESGSD-FDDLIGNHA  119

Query  442  RNSKEFYPLIPTLPSV-------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            R++ +FY  +P +  V       R  + A+KVTLFP  GICVG A  H +GD SS+ GF+
Sbjct  120  RDADQFYEFVPDIDPVKDESEYQRVPVMALKVTLFPGRGICVGFANLHCLGDASSLVGFI  179

Query  601  KAWTALSLLG  630
            +AW +++ LG
Sbjct  180  QAWASINKLG  189



>sp|Q9MBC1.1|3AT_PERFR RecName: Full=Anthocyanidin 3-O-glucoside 6''-O-acyltransferase; 
Short=3AT, partial [Perilla frutescens]
 dbj|BAA93475.1| anthocyanin acyltransferase [Perilla frutescens]
Length=446

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 103/184 (56%), Gaps = 10/184 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E   V PPP  VA  S+PL FFD+ WLH  P+ +L+FY+   S+ HF ++I+P LK S
Sbjct  1    VIETCRVGPPPDSVAEQSVPLTFFDMTWLHFHPMLQLLFYEFPCSKQHFSESIVPKLKQS  60

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS  L ++  L+  L  P+     PEF Y  GD V    A S D+   FD L  N   + 
Sbjct  61   LSKTLIHFFPLSCNLIYPSSPEKMPEFRYLSGDSVSFTIAESSDD---FDDLVGNRPESP  117

Query  451  KEFYPLIPTLPSV-----RR--GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
               Y  +P LP +     R+   +FAV+VTLFP  G+ +GIA HH V D  S   F+ AW
Sbjct  118  VRLYNFVPKLPPIVEESDRKLFQVFAVQVTLFPGRGVGIGIATHHTVSDAPSFLAFITAW  177

Query  610  TALS  621
            +++S
Sbjct  178  SSMS  181



>ref|XP_008231363.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Prunus 
mume]
Length=480

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 108/203 (53%), Gaps = 25/203 (12%)
 Frame = +1

Query  91   VVEQSSVAPPPGK----VAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPH  258
            V+EQ  V+PPP      ++  SLPL F D+ WL  SP   L FY+      HF  T++P+
Sbjct  9    VLEQCQVSPPPNSCLPDISQTSLPLTFLDIPWLFFSPSLPLFFYEFPFPTCHFTSTVLPN  68

Query  259  LKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
            LK SLS+ LQ +YP     +A P      PE VY  GD V +    SD   G F  LSSN
Sbjct  69   LKHSLSLTLQHFYPFAGTLVARPE--PGIPELVYTQGDSVSVTVVESD---GDFVYLSSN  123

Query  436  HARNSKEFYPLIPTLPS---------------VRRGMFAVKVTLFPEAGICVGIAYHHVV  570
              R  +EFY L+P L S                +  + +V++T+FP  GIC+G+AYHHVV
Sbjct  124  FPREEEEFYTLVPELASSSSFVPMSNGTQTQAAKLPLSSVQITVFPNCGICIGLAYHHVV  183

Query  571  GDGSSIFGFMKAWTALSLLGHKS  639
             DG +   F+KAW + S LG  S
Sbjct  184  ADGRTFNNFIKAWASFSRLGDSS  206



>gb|EYU24861.1| hypothetical protein MIMGU_mgv1a006931mg [Erythranthe guttata]
Length=426

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 103/182 (57%), Gaps = 12/182 (7%)
 Frame = +1

Query  79   TYAAVVEQSSVAPP-PGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            T   ++E   + PP        S+PL+FFD+ WLH  P+ RL+FY H  S+ +F +T++P
Sbjct  4    TATTLLETCQIQPPISDDELSLSVPLSFFDIAWLHFHPIRRLLFYNHPCSKPYFLETLVP  63

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTP--PEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            +LK SLS+ L++Y   +  L  P   +T   P F Y  GD V L  A S  N+  FD L 
Sbjct  64   NLKESLSLTLKHYLPASGNLLYPKTATTEKKPVFRYVTGDSVSLTIAES--NNDDFDELI  121

Query  430  SNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
            +NHAR++  FY  +P  P  +         + A+++TLFP  GIC+G A HH VGD SSI
Sbjct  122  TNHARDADRFYNFVPEFPPEKDELEYKIVPLIALQITLFPNRGICIGFANHHCVGDASSI  181

Query  589  FG  594
             G
Sbjct  182  VG  183



>ref|XP_011658005.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Cucumis 
sativus]
Length=455

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 102/180 (57%), Gaps = 6/180 (3%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E   V+PPP   A  SLPL FFDL WL   P+ RL FY+   +   F D I+P LK S
Sbjct  9    LIEVCKVSPPPTAAAPSSLPLTFFDLMWLRFHPIQRLFFYEFPSNEVSFHDVIVPKLKNS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L++Y  LA  L  P++ S  P   + +GDGV +  A SDDN   F  LS N  R  
Sbjct  69   LSLTLRHYLPLAGNLVWPSE-SDVPFIEFAEGDGVSMTVAESDDN---FYHLSGNGFREV  124

Query  451  KEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSL  624
             EF+PL+P LP    R  + A++VT F   G  +GI+ HH + DG S   F+K+W  + +
Sbjct  125  SEFHPLVPQLPVSHNRAAVIAIQVTKFQNKGFSIGISNHHGILDGRSSTSFIKSWAQICI  184



>ref|XP_007043451.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX99282.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=466

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 107/196 (55%), Gaps = 11/196 (6%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            P    V++ S+ +PPPG V   SLPL FFD+ WL   P+ RL FY+   S  HF  TI+P
Sbjct  4    PCTIKVLDHSNASPPPGSVPDTSLPLTFFDVPWLVCRPMQRLFFYEFPYSTLHFTQTILP  63

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             L+TSLS ALQ +   AAKL  P      P  +Y DGD V    A   ++S  FD   + 
Sbjct  64   SLRTSLSHALQTFYPFAAKLICPPS-PHKPHILYTDGDCVSFTVA---ESSADFDRTVAY  119

Query  436  HARNSKEFYPLIPTLPSVR-------RGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFG  594
             AR+ KE +P +P L   R         + A++VT+FP +GIC+G  + HV  DG S   
Sbjct  120  LARDVKELHPFVPQLQPSRVLNNTRVLPLLALQVTVFPNSGICIGATFCHVAADGRSFNH  179

Query  595  FMKAWTALSLLGHKSS  642
            FMKAW ++   G  S+
Sbjct  180  FMKAWASILRSGGNSA  195



>ref|XP_006362146.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Solanum 
tuberosum]
Length=451

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 106/190 (56%), Gaps = 11/190 (6%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A++VEQ  VAPP       +LPL +FD+ WL+   V R++FY+  + +  F    IP LK
Sbjct  2    ASIVEQCEVAPPSCATDKLTLPLTYFDMVWLNNQRVPRILFYKLPIDKNSFIQKTIPTLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN-HA  441
             SLS+ L++Y  LA     P + +  PE  Y  GD V + F+ +D +   FD L SN H 
Sbjct  62   HSLSLTLKHYLPLAGNFVCPLNSTDHPELRYVKGDSVSVTFSETDMD---FDYLVSNDHP  118

Query  442  RNSKEFYPLIPTLPSVRRGM-------FAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            RN+K+ Y  +P L   +  +        A++VTLFP  GI +    HH+VGDG +I GF+
Sbjct  119  RNAKDIYHFVPHLTEPKDVLGVQFAPVLAIQVTLFPNHGISICFINHHIVGDGCTIVGFI  178

Query  601  KAWTALSLLG  630
            K+W  L+  G
Sbjct  179  KSWALLNKYG  188



>ref|XP_011079048.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like [Sesamum indicum]
Length=468

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 106/189 (56%), Gaps = 5/189 (3%)
 Frame = +1

Query  79   TYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPH  258
            T   VVE+  ++PPP  V   SLPL F D+ WL  SP   L FY   VS   F  TI+P+
Sbjct  5    TQVTVVERRLISPPPRTVTATSLPLTFLDIPWLLFSPSQPLFFYDLPVSTAEFIQTILPN  64

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPL-VFAVSDDNSGRFDCLSSN  435
            L+ +LS+ LQ++  L+ KL  P   S PP   Y   D + L +   +  ++G F  L+ N
Sbjct  65   LENALSLTLQHFFPLSGKLVTPPLSSMPPRLEYTGDDSIFLTIVEATAADAGDFKNLTGN  124

Query  436  HARNSKEFYPLIPTLPSV----RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            H + +++   L+P L S     ++ + AV++T+FPEAG+C+G A  HVV DG +   F+K
Sbjct  125  HPKLARDLKCLVPVLRSTGVGSKQQLLAVQITVFPEAGVCMGFALRHVVADGRTFNNFLK  184

Query  604  AWTALSLLG  630
             W  L+  G
Sbjct  185  KWGELTKTG  193



>ref|XP_002513167.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
 gb|EEF49158.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
Length=464

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 110/192 (57%), Gaps = 13/192 (7%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTI  249
            + P+   V+E S ++P P      +LPL FFDL WL  SP   L FY +  S +HF  + 
Sbjct  2    AKPSTIKVLEHSKISPSPNSSPSTTLPLTFFDLPWLFFSPCQPLFFYAYPHSTSHFLSST  61

Query  250  IPHLKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            +P+LK SLS+ALQ ++P L   +    D +  P+FVY +GD V   F V  ++SG F   
Sbjct  62   LPNLKHSLSLALQEFFPFLGNLVVSSFDSNKKPKFVYREGDFVS--FTV-QESSGDFSFF  118

Query  427  SSNHARNSKEFYPLIPTLPSVRRG---------MFAVKVTLFPEAGICVGIAYHHVVGDG  579
            +SNHAR+  EFYPL+P L +             + AVK+T+F   GICVG+AYHHV  DG
Sbjct  119  TSNHARDVHEFYPLVPELATSSVAASGLQALIPLLAVKITIFSNMGICVGLAYHHVAADG  178

Query  580  SSIFGFMKAWTA  615
             +   F+ +W +
Sbjct  179  RTFNYFINSWAS  190



>ref|XP_006361075.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Solanum 
tuberosum]
Length=456

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 106/188 (56%), Gaps = 11/188 (6%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWL-HGSPVHRLIFYQHAVSRTHFKDTIIPHL  261
            A+++EQ  VAPP   +   +LPL  FD  WL H + V R++FY+  + +  F   IIP L
Sbjct  2    ASIIEQCQVAPPTCAIDKLTLPLTSFDTLWLFHNNHVPRILFYKLHIDKNSFIQNIIPTL  61

Query  262  KTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN-H  438
            K SLS+ L++Y  LA  L  P +++  PE  Y  GD V + F+ S D    FD L SN H
Sbjct  62   KHSLSLTLKHYLPLAGNLVCPWNFTGYPELRYVTGDSVSVTFSESTDMD--FDYLVSNDH  119

Query  439  ARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
              N  +F+P +P +   +         + A++VTLFP  GI +    HHVVGD S+I GF
Sbjct  120  THNVNDFHPFVPKMAEPKDASGVQFAPVLAIQVTLFPNHGISISFLSHHVVGDASTIVGF  179

Query  598  MKAWTALS  621
            +K+W  L+
Sbjct  180  IKSWALLN  187



>ref|XP_010265765.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Nelumbo 
nucifera]
Length=458

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 106/192 (55%), Gaps = 6/192 (3%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTI  249
            +P +   V+E   +APPPG VA  SLPL FFDL WL   P   L FY+      HF +T+
Sbjct  2    APSSQVKVIEFYKIAPPPGSVAPASLPLTFFDLFWLPFPPPQLLYFYELPHPLAHFTNTL  61

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            +P +K SLS+ L ++   A  L+ P + S  P   Y  GD V L  A S+   G F  LS
Sbjct  62   LPRIKHSLSLTLLHFYPFAGNLSWPEE-SPNPMIHYKGGDSVSLTIARSE---GGFHRLS  117

Query  430  SNHARNSKEFYPLIPTLPSVRR--GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
             N AR SKE +PL+P LP       M A++VT+FP +GICVG+   H V D  +I  F+ 
Sbjct  118  GNQARESKELHPLVPQLPVSGSVVPMLALQVTVFPNSGICVGVTMPHAVADAKTILNFVN  177

Query  604  AWTALSLLGHKS  639
            +W ++   G  S
Sbjct  178  SWASICKFGEAS  189



>ref|XP_007052549.1| Malonyl CoA:flavonoid malonyltransferase 5, putative [Theobroma 
cacao]
 gb|EOX96706.1| Malonyl CoA:flavonoid malonyltransferase 5, putative [Theobroma 
cacao]
Length=518

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 101/187 (54%), Gaps = 10/187 (5%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            P+   VV +  V+PPP      SLPL FFD+ WL  S    L FY++     HF  T +P
Sbjct  5    PSTVEVVARYHVSPPPNSAPPTSLPLTFFDIPWLCFSASQPLFFYKYPFPTNHFLSTTLP  64

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             L  SLS+ LQ++  LA  L  P D    P  VY +G+ V LV A SD   G F   S N
Sbjct  65   TLVHSLSLTLQHFFALAGSLVWPPD-PFKPLIVYNEGNYVSLVVAESD---GDFFHFSGN  120

Query  436  HARNSKEFYPLIPTLPSVRRG------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
            H R   EFYPL+P LPS          + A ++T+F  +GIC+G AYHHVV DG +   F
Sbjct  121  HQRCVNEFYPLLPQLPSRASESKHEIPLLAAQITIFSNSGICIGFAYHHVVADGRTFNSF  180

Query  598  MKAWTAL  618
            +K W +L
Sbjct  181  IKTWASL  187



>gb|AAO38058.1| malonyl-coenzyme A: anthocyanidin 3-O-glucoside-6''-O-malonyltransferase 
[Pericallis cruenta]
Length=461

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 111/188 (59%), Gaps = 15/188 (8%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E + ++ P G +   SL L FFD+ WL   PVH L FY    S++HF DTI+P LK S
Sbjct  9    ILEHARISAPSGTIGHRSLSLTFFDITWLLFPPVHHLFFYDFPHSKSHFMDTIVPRLKQS  68

Query  271  LSIALQYYPLLAAKLAV--PTD---YSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
            LS+ LQ++   A+ L V   TD   ++  PE  + +GD V + FA   +    F+ L+ N
Sbjct  69   LSVTLQHFFPFASNLIVFPNTDGSGFNKKPEIKHVEGDSVVVTFA---ECCLDFNNLTGN  125

Query  436  HARNSKEFYPLIPTLPS-------VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFG  594
            H R  + FYPL+P+L +       V   +F+++VT FP +GI +G+  HH +GD S+ F 
Sbjct  126  HPRKCENFYPLVPSLGNAIKLCDCVTVPLFSLQVTFFPGSGISLGMTNHHSLGDASTRFN  185

Query  595  FMKAWTAL  618
            F+K WT++
Sbjct  186  FLKGWTSI  193



>ref|XP_011079054.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Sesamum 
indicum]
Length=455

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 110/195 (56%), Gaps = 13/195 (7%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA++ P   A V+E+  + P     +  +L L  FD+ WL+  PVHRL+F+    S+T F
Sbjct  1    MAENPPA--AGVLERCDIRPSANTTSELTLSLLHFDITWLYFHPVHRLLFFDFPCSKTEF  58

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
             +T++P LK SL   L ++  LA  +  P + S  P   + DGD V L  A  D +   F
Sbjct  59   LETVVPKLKESLHETLNHFLPLAGNIIHPLN-SGRPFSRFEDGDSVTLTIAECDKD---F  114

Query  418  DCLSSNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGD  576
            D L+ NH R + EFY  +P LP  +         + A+++TLFP+ G+C+GI  HH +GD
Sbjct  115  DYLTGNHPRVADEFYACVPQLPPAKHTPDVVILPVLALQITLFPDRGVCLGITNHHGIGD  174

Query  577  GSSIFGFMKAWTALS  621
             SSI  F+KAW +++
Sbjct  175  ASSIVRFIKAWASVN  189



>dbj|BAF99692.1| putative anthocyanin acyltransferase [Lobelia erinus]
Length=470

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 110/199 (55%), Gaps = 17/199 (9%)
 Frame = +1

Query  88   AVVEQSSVAPPPG-KVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTHFKDTIIPHL  261
             V+E   V+P  G   A  S PL+F D+ WL   P+H+L FY+    S++HF  TI+P+L
Sbjct  8    TVLEHRQVSPAHGISDAEKSFPLSFLDIPWLMFPPIHQLCFYELPQCSKSHFIQTIVPNL  67

Query  262  KTSLSIALQYYPLLAAKLAV-----PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            K SLSI LQ++  LA  L V     P      PE  Y +GD V +  A S  +   FD L
Sbjct  68   KHSLSITLQHFFPLAGNLIVFPCTDPNTIPRKPEIRYVEGDSVSVTIAESTKD---FDYL  124

Query  427  SSNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSS  585
            + N AR + EFYPL+P L S+ +        + A++VTLF   G C+G+  HH   DG++
Sbjct  125  TGNQARKADEFYPLVPKLGSITKESGSIKVPLLAIQVTLFAGHGFCIGLTNHHTACDGNA  184

Query  586  IFGFMKAWTALSLLGHKSS  642
               F+KAW ++S  G+  S
Sbjct  185  RVNFIKAWASISKFGNDES  203



>ref|XP_010268734.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nelumbo 
nucifera]
Length=492

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 110/189 (58%), Gaps = 12/189 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E+  V+PP   +   SL L FFD+ WL+     RL+FY+         ++IIP+LK S
Sbjct  9    VLEKCQVSPPATSIEQKSLQLTFFDVMWLYFRRPSRLLFYEFPHPVILLTESIIPNLKNS  68

Query  271  LSIALQYYPLLAAKLA--VPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
            LS+ALQ++ +LA  L   +P   ST PE  Y +GD + L  A S D+   F+ L  +H R
Sbjct  69   LSLALQHFYILAGNLTQLLP---STEPELRYVNGDSISLTIAESSDD---FNYLCGHHPR  122

Query  445  NSKEFYPLIPTLPSVRRG----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWT  612
            +   F+PL+P LPS+       + A++VTLFP +G  +GI   HVV DG S+F F+++W 
Sbjct  123  DENRFHPLVPQLPSLSDSQTVPLLAIQVTLFPNSGFSIGITSSHVVADGRSLFHFIRSWA  182

Query  613  ALSLLGHKS  639
             +  LG  S
Sbjct  183  TVCRLGGDS  191



>ref|XP_007033865.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY04791.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=465

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 110/196 (56%), Gaps = 23/196 (12%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            P    V+E + V PPPG V   SLPL FFD+ WL  SP+ RL+FY       +F  + +P
Sbjct  5    PDTLKVLEDTYVFPPPGSVPTTSLPLTFFDIHWLGSSPMQRLLFYDFPYPTFYFTQSTLP  64

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPE---FVYGDGDGVPLVFAVSDDNSGRFDCL  426
            +LK SLS+ LQ++  LA  L  P     PP+    +Y +GD VP    ++ +++  F  L
Sbjct  65   NLKRSLSLTLQHFFPLAGNLVFP----PPPQKPYILYKEGDSVPF---IAKESTADFSHL  117

Query  427  SSNHARNSKEFYPLIPTLP-------------SVRRGMFAVKVTLFPEAGICVGIAYHHV  567
              +HAR+ +EF  L+P L               +++ + A++VTLFP+AGICVG  ++HV
Sbjct  118  IGDHARHVQEFQALLPKLKPASTYSHSTTSTACMQKPLMAIQVTLFPKAGICVGATFNHV  177

Query  568  VGDGSSIFGFMKAWTA  615
              DG +   FMK+W +
Sbjct  178  AADGKAFTHFMKSWAS  193



>gb|AAQ63616.1| anthocyanidin 3-O-glucoside-3'',6''-O-dimalonyltransferase [Chrysanthemum 
x morifolium]
Length=460

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 113/197 (57%), Gaps = 14/197 (7%)
 Frame = +1

Query  88   AVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
             ++E S ++ PPG +   SLPL FFD+ WL   PVH + FY    S++HF +T++P+LK 
Sbjct  8    TILEHSRISSPPGTIGERSLPLTFFDITWLAFPPVHHVFFYAFQHSKSHFLETVVPNLKH  67

Query  268  SLSIALQYYPLLAAKLAV---PTDYST--PPEFVYGDGDGVPLVFAVSDDNSGRFDCLSS  432
            SLS+ LQ++   A  L V     DY     PE  + +GD V L FA  +  +  F+ L+ 
Sbjct  68   SLSLTLQHFFPFAGNLFVFPNADDYGVIRKPEIRHVEGDYVALTFA--ECPTLDFNDLTG  125

Query  433  NHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
            NH R  + F+PL+P L  + +        + +V+VT F ++GI +G+  HH V D S+  
Sbjct  126  NHPRECENFHPLVPPLGDLVKMYDYVTIPLLSVQVTYFKDSGISIGMTNHHTVADASTRL  185

Query  592  GFMKAWTALSLLGHKSS  642
            GF+KAWT+++  G   S
Sbjct  186  GFLKAWTSIAKSGRDQS  202



>gb|AAO12207.1| putative malonyl CoA:anthocyanidin 3-O-glucoside-6''-O-malonyltransferase 
[Dahlia pinnata]
Length=467

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 110/189 (58%), Gaps = 12/189 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E+  ++ PP  V   +LPL  FDL WL   P+H+L FY     ++HF DTIIP LK S
Sbjct  12   VLEKCHISAPPNTVGERTLPLTLFDLVWLIFHPIHQLFFYDFPYPKSHFIDTIIPKLKHS  71

Query  271  LSIALQYYPLLAAKLAV--PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
            LS+ LQ++   A  L V    ++S  PE  + +GD V L FA SD +   F+ L  NH R
Sbjct  72   LSVTLQHFFPFAGNLIVFPSANHSGKPEIRHVEGDSVALTFAESDLD---FNYLKQNHPR  128

Query  445  NSKEFYPLIPTLPS-------VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            +  +F+ L+P L +       V+  +F+++VT FP +GI +G+  HH + D  + + F+ 
Sbjct  129  DCNKFHALVPLLETPFKVSGLVKIPVFSIQVTFFPNSGITIGLTNHHSLCDARTRYDFLM  188

Query  604  AWTALSLLG  630
            AWT+++  G
Sbjct  189  AWTSIAKHG  197



>ref|XP_006361062.1| PREDICTED: LOW QUALITY PROTEIN: malonyl-coenzyme:anthocyanin 
5-O-glucoside-6'''-O-malonyltransferase-like [Solanum tuberosum]
Length=471

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 106/189 (56%), Gaps = 12/189 (6%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKW-LHGSPVHRLIFYQ-HAVSRTHFKDTIIPH  258
            A+++EQ  VAPP       +LPL  FD  W LH   + R++FY+ H + +  F   IIP 
Sbjct  2    ASIIEQCQVAPPTCATDKLTLPLTCFDTLWILHNHHIPRILFYKLHNIDKNSFIQNIIPT  61

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN-  435
            LK SLS+ L++Y  LA  L  P + +  PE  Y  GD V + F+ S D    FD L SN 
Sbjct  62   LKHSLSLTLKHYLPLAGNLVCPWNSTGYPELRYVKGDSVSVTFSESTDMD--FDYLVSND  119

Query  436  HARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFG  594
            H  N+K+F+P +P +   +         + A++VTLFP  GI +    HHVVGD S+I G
Sbjct  120  HTHNAKDFHPFVPKIAEPKDASGVQFAPVLAIQVTLFPNHGISISFLSHHVVGDESTIVG  179

Query  595  FMKAWTALS  621
            F+K+W  L+
Sbjct  180  FIKSWALLN  188



>dbj|BAF99691.1| putative anthocyanin acyltransferase [Lobelia erinus]
Length=471

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 108/203 (53%), Gaps = 17/203 (8%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRT-HFKDTII  252
            P    V+E S V+PP G VA  S  L F D+ WL   P+H+L FY +  S T HF  T++
Sbjct  4    PKDFTVLEHSRVSPPAGSVAEKSFTLNFLDMPWLLLHPIHQLCFYDYPHSDTSHFTQTVV  63

Query  253  PHLKTSLSIALQYYPLLAAKLAV------PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            P LK SLSI LQ++   A  L V      P      PE  Y +GD V L      + +  
Sbjct  64   PKLKDSLSITLQHFFPFAGNLIVFPYGADPNVVPPKPEIRYMEGDSVCLTIC---ECTKD  120

Query  415  FDCLSSNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVG  573
            F+ L+ N+AR + E+YPL+P L  + +G       + A+++TLFP  G C+G+  HH   
Sbjct  121  FNYLTGNYARKADEYYPLVPKLGDIVKGSDYIKIPVLAIQLTLFPNRGFCIGVTNHHSAA  180

Query  574  DGSSIFGFMKAWTALSLLGHKSS  642
            DG++   F+K W  ++  G+  S
Sbjct  181  DGNARINFLKFWAKITKSGNGDS  203



>gb|KJB25033.1| hypothetical protein B456_004G173600 [Gossypium raimondii]
Length=466

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 100/181 (55%), Gaps = 8/181 (4%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            +V +  V+PPP  V   SLPL FFD+ WL  SP   L FY +    +HF  T +P L  S
Sbjct  10   IVGRYRVSPPPNTVPPTSLPLTFFDIPWLFFSPTQPLFFYDYPYPTSHFLSTALPPLIHS  69

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L+++  LAA L  P   S PP  VY   + V LV A S   +  F  L SNH R  
Sbjct  70   LSLTLRHFFALAATLVCPPHSSNPPFIVYDRSNFVSLVVAHS---TADFHHLCSNHQRCV  126

Query  451  KEFYPLIPTLPS-----VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTA  615
             +FYPL+P LPS      +  + A ++T+F   G+C+G AYH+V  DG S   F+K W +
Sbjct  127  NDFYPLLPPLPSGEQEETQTPLLAAQITIFSNVGVCIGFAYHNVAADGRSFNSFIKTWAS  186

Query  616  L  618
            L
Sbjct  187  L  187



>dbj|BAF93857.1| anthocyanin acyltransferase [Torenia hybrid cultivar]
Length=479

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 112/210 (53%), Gaps = 22/210 (10%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA  +P T  AV+E S + P        +L L FFD+KW+H  P+  L+ Y    S++HF
Sbjct  1    MAVEAPKTICAVLENSLITPQSTDTEQ-TLSLTFFDIKWVHFHPMQCLVLYNFPCSKSHF  59

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPT-------DYSTPPEFVYGDGDGVPLV----  384
             +  +P  K+SLS  L++Y  L+  L  P        D S  PE  Y  GD V L     
Sbjct  60   LEATVPSFKSSLSKTLRHYLPLSGNLYYPNPTHDMDDDESNMPEIRYKPGDSVSLTVAEY  119

Query  385  FAVSDDNSGR---FDCLSSNHARNSKEFYPLIPTL--PSVRRG-----MFAVKVTLFPEA  534
            F+  +DN+     F+ L+ N  R+  +FY L+P    P          + AV++TLFP A
Sbjct  120  FSGHEDNTTTEEYFNYLTGNFQRDCDQFYDLLPDFRDPETESNCTVIPLIAVQITLFPGA  179

Query  535  GICVGIAYHHVVGDGSSIFGFMKAWTALSL  624
            GIC+G+   HVVGD SSI GF+KAW+ +++
Sbjct  180  GICLGVINSHVVGDASSIVGFIKAWSKVAM  209



>gb|EPS62795.1| hypothetical protein M569_11994 [Genlisea aurea]
Length=455

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 99/182 (54%), Gaps = 10/182 (5%)
 Frame = +1

Query  106  SVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIAL  285
             + P P  V   SLPL  FDL + +  PV RL+F+    SR HF D+++P LK SL   L
Sbjct  13   QIYPSPETVTELSLPLIHFDLAFFYFHPVQRLLFFDFRCSRPHFVDSVLPRLKDSLRRTL  72

Query  286  QYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYP  465
            +++  LA KL  P + S  P   + DGD V L  A  D +   F  L+ NH R + EFY 
Sbjct  73   RHFLPLAGKLVQPAEASRRPFLRFLDGDSVSLTVAECDKD---FRHLTGNHPRLADEFYA  129

Query  466  LIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSL  624
             +P LP            + A++VTLFP+ G+C+G   HH VGD S+I  F+K+W  ++ 
Sbjct  130  CVPDLPPAEDSPEGRLLPVIALQVTLFPQQGVCLGFTNHHAVGDASAIVRFIKSWATVNF  189

Query  625  LG  630
             G
Sbjct  190  SG  191



>gb|EYU32009.1| hypothetical protein MIMGU_mgv1a006060mg [Erythranthe guttata]
Length=459

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 108/194 (56%), Gaps = 12/194 (6%)
 Frame = +1

Query  94   VEQSSVAPPPGKVAGF-SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            +++  V+P     A   SLPL FFD++W++  P+ R+ FY    S THF DTIIP +  S
Sbjct  8    LQRCRVSPAEEPTATMTSLPLTFFDMEWINFHPLRRVFFYGFPCSHTHFVDTIIPQMTKS  67

Query  271  LSIALQYYPLLAAKLAVPTDYSTP-PEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ L++Y  LA  L  P + S   P   Y  GD VPL F+ S   S  FD LS + +R 
Sbjct  68   LSLTLKHYFPLAGNLIYPLNSSDALPVLRYRPGDSVPLTFSESVRVSD-FDYLSGHQSRE  126

Query  448  SKEFYPLIPTL---------PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            + +FY   P L           +   + +++VTLFPE GIC+GIA +HV  D  S F FM
Sbjct  127  ADDFYAYAPHLLDKITEPDSDDIIIPLLSLQVTLFPETGICIGIACNHVATDARSTFDFM  186

Query  601  KAWTALSLLGHKSS  642
            KAW +++ LG   S
Sbjct  187  KAWASITKLGGSDS  200



>gb|EPS62076.1| hypothetical protein M569_12721 [Genlisea aurea]
Length=453

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 98/183 (54%), Gaps = 17/183 (9%)
 Frame = +1

Query  109  VAPPPGKVAGFS--LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIA  282
            V+PPPG VA     LP  +FD+ WL   P+ RL FY+       + D ++  L+ SLS A
Sbjct  8    VSPPPGAVADEIQILPFTYFDIIWLTFHPIRRLFFYE-----IPYTDDVVGRLRNSLSRA  62

Query  283  LQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFY  462
            L++Y  LA K+  P +    P   Y  GD VP     SD   G FD L  N  R+S +FY
Sbjct  63   LKHYFPLAGKILFPVNSEEKPFLRYAPGDSVPFTIFESD---GDFDALVENSPRDSDQFY  119

Query  463  PLIPTLPSV-------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
              IP LP          R + AV+VTLFP  GIC+G+  HH  GD ++I GF+  W ++S
Sbjct  120  DFIPELPPEGEESGFRTRQVLAVQVTLFPNRGICIGVTNHHTAGDATTIVGFLNFWASIS  179

Query  622  LLG  630
             LG
Sbjct  180  KLG  182



>ref|XP_010277331.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Nelumbo 
nucifera]
Length=457

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 104/194 (54%), Gaps = 11/194 (6%)
 Frame = +1

Query  70   SPPTYAA-VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDT  246
             PPTY A ++E   +APPP      SLPL FFD+  L   P+  L FY+       F D+
Sbjct  2    EPPTYRANILEHCRIAPPPNSATEMSLPLTFFDMLCLVLPPIQSLYFYELP----QFADS  57

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            ++P++K SLS+ L+++   A  L  P D S  P   Y + D V L  A SD   G F  L
Sbjct  58   LLPNIKHSLSLTLKHFLPFAGNLTWPKD-SEVPLIRYVEKDSVSLTVAESD---GDFYHL  113

Query  427  SSNHARNSKEFYPLIPTLPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            S  H R+  E  PLIP LP   +   + A++VT+FP  GICV    HH V DG +I  FM
Sbjct  114  SGTHCRDITEILPLIPDLPISDKQAPVLALQVTVFPNRGICVATTIHHAVADGRTISLFM  173

Query  601  KAWTALSLLGHKSS  642
            K W ++  LG  SS
Sbjct  174  KTWASICRLGGDSS  187



>ref|XP_006447403.1| hypothetical protein CICLE_v10015168mg [Citrus clementina]
 ref|XP_006469822.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Citrus sinensis]
 gb|ESR60643.1| hypothetical protein CICLE_v10015168mg [Citrus clementina]
Length=463

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 108/191 (57%), Gaps = 19/191 (10%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            VV++S +APPPG V    +PL F D+ WL   P+ R++FY+      H    IIPHLK S
Sbjct  9    VVDESHIAPPPGSVPPTVIPLTFLDVSWLFCCPIERILFYELPFPTRHLMQNIIPHLKHS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L ++  LA  LA     ++ P   + +GD V +  A SD + G    L +NH R++
Sbjct  69   LSLTLHHFFPLAGNLAC----NSKPFIQFNEGDSVRVTVAESDADFGH---LVANHLRDN  121

Query  451  KEFYPLIPTLP--------SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            + F PL+P LP          +  + A++VT+FP +GI +G+ + HV  DGSS   FMK+
Sbjct  122  RAFKPLVPKLPFPFPSVSSDNKTPVMAIQVTVFPNSGISIGVTFIHVAADGSSFNHFMKS  181

Query  607  WTALSLLGHKS  639
            W ++    HKS
Sbjct  182  WASI----HKS  188



>ref|XP_002275913.1| PREDICTED: anthocyanin 5-aromatic acyltransferase [Vitis vinifera]
 emb|CBI18018.3| unnamed protein product [Vitis vinifera]
Length=458

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 108/192 (56%), Gaps = 12/192 (6%)
 Frame = +1

Query  88   AVVEQSSVAPPPGK-VAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
             V+E+  V+PP    V   SLPL FFD+ W+H   V  + FY++   +THF +T IP LK
Sbjct  8    TVLEECRVSPPSSTAVDEKSLPLTFFDIPWIHQHLVQSVFFYEYPHPKTHFIETTIPALK  67

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+ L+++   A  L  P +    P+  Y DGD V L F  S D+   F  L++NH R
Sbjct  68   HSLSLTLKHFYPFAGNLLFPPNLGK-PQIHYADGDSVSLTFVESSDD---FSYLTANHQR  123

Query  445  NSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            +    +PLIP +P V          + A++VTLFP +GI  G   +HVV DG++   F++
Sbjct  124  DVARLHPLIPQMPPVSVSNDTLVAPLVAIQVTLFPNSGISFGFTTNHVVADGNTFIRFVR  183

Query  604  AWTALSLLGHKS  639
             W +++ LG +S
Sbjct  184  LWASINKLGEES  195



>gb|EYU24852.1| hypothetical protein MIMGU_mgv1a006230mg [Erythranthe guttata]
Length=452

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 99/170 (58%), Gaps = 11/170 (6%)
 Frame = +1

Query  154  AFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDY  333
            +FFD+ WLH  P+ RL+FY+++ S +HF +T+IP LK SLS+ L++Y  +A  L  P + 
Sbjct  28   SFFDVLWLHFHPIRRLLFYEYSCSESHFSETLIPKLKESLSLTLKHYLPVAGNLLYPLNT  87

Query  334  ST-PPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRRG----  498
            +   P   Y  GD V L  A+S    G FD L  NH R++ +FY  +P +P         
Sbjct  88   AAHKPLLRYISGDSVSLKIAIS---GGNFDELVGNHPRDADKFYDFVPEIPPATEDSDYK  144

Query  499  ---MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLLGHKS  639
               +FA++VTLFP  GIC+G +  H +GD  SI GFM AW +   L  +S
Sbjct  145  IVPVFALQVTLFPGRGICIGFSNLHSLGDARSIVGFMHAWASTCKLAGES  194



>gb|EYU24853.1| hypothetical protein MIMGU_mgv1a006246mg [Erythranthe guttata]
Length=451

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 100/175 (57%), Gaps = 11/175 (6%)
 Frame = +1

Query  139  FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLA  318
              LPL F D+ W+H   +H L+FY+++ S +HF +T+IP LK SLS+ L++Y  LA  L 
Sbjct  24   LQLPLTFLDIVWIHFQTMHYLLFYEYSCSESHFSETLIPKLKESLSLTLKHYLPLAGNLL  83

Query  319  VPTD-YSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRR  495
             P +     P   Y  GD + +  AVS    G FD L  NH R++ +FY  +P +P    
Sbjct  84   YPLNPDRRKPLIRYVAGDSISVKIAVS---GGNFDELVGNHPRDADQFYDFVPEIPPATE  140

Query  496  G-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLLGHKS  639
                    +FA++VTLFP  GIC+G +  H +GD  SI GF++AW ++  L  +S
Sbjct  141  DSEYKIVPVFALQVTLFPGRGICIGFSNLHCLGDARSIVGFVRAWASMCNLAGES  195



>ref|XP_011100334.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=456

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 108/200 (54%), Gaps = 14/200 (7%)
 Frame = +1

Query  58   MAQSSP-PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTH  234
            MA++   P  AA++E+  +AP P  VA  +LPL  FD+ WL+  PV RL+FY    S+  
Sbjct  1    MAETRENPMAAALIERCEIAPSPDTVAELTLPLLHFDITWLYFHPVKRLLFYGFPCSKHQ  60

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTP-PEFVYGDGDGVPLVFAVSDDNSG  411
            F +TI+P LK SL   L ++  LA  +  P     P   FV   GD V L  A  + +  
Sbjct  61   FLETIVPKLKESLLRTLNHFLPLAGNIVHPIKSGRPFSRFVV--GDSVTLTIAECNKD--  116

Query  412  RFDCLSSNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVV  570
             F  L+ NH R S E Y  +P LP  +         + A++VTLFP  G+C+G   HH +
Sbjct  117  -FKHLTGNHPRVSDELYACVPQLPPAKHSSDAVILRVLALQVTLFPGHGVCLGFTNHHSI  175

Query  571  GDGSSIFGFMKAWTALSLLG  630
            GD S+I  F+KAW +++  G
Sbjct  176  GDASTIVRFIKAWASVNRFG  195



>ref|XP_003633577.1| PREDICTED: anthocyanidin 3-O-glucoside 6''-O-acyltransferase-like 
[Vitis vinifera]
Length=455

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 106/192 (55%), Gaps = 7/192 (4%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTI  249
            +PP    V+++  VAPPPG     SLPL FFD+ WL   P   L F+Q  +  +HF    
Sbjct  2    APPIAVRVLDRYRVAPPPGSAPPTSLPLTFFDIPWLLFPPSQPLFFFQFPIPTSHFTSVT  61

Query  250  IPHLKTSLSIA-LQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            +P LK SLS+  L+Y+P        P   S  P  VY +GD V +  A +D   G FD  
Sbjct  62   LPKLKHSLSLTLLEYFPFSGRLSHYPE--SETPAIVYAEGDSVGMTVAEAD---GDFDNF  116

Query  427  SSNHARNSKEFYPLIPTL-PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
              +H++++ EF+ L+P L  S    M AV++T+F  AGI +G+A HH V DG +   FMK
Sbjct  117  CGHHSKDACEFHQLVPRLSESDEVPMMAVQITVFSNAGISIGLALHHAVSDGRTFTNFMK  176

Query  604  AWTALSLLGHKS  639
             W+++   G KS
Sbjct  177  TWSSIYRNGEKS  188



>dbj|BAF49288.1| hydroxycinnamoyl-CoA:anthocyanin 5-glucoside-6'''-O-hydroxycinnamoyltransferase 
[Eustoma grandiflorum]
Length=465

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 106/197 (54%), Gaps = 13/197 (7%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPG-KVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDT  246
             P     V+++  ++PPP  K    +LP+ F D+ WLH   +  L+ Y     +THF DT
Sbjct  2    DPIQKVKVLQKCQISPPPDTKDEELTLPITFLDIPWLHLYKMQSLLLYDFPHPKTHFLDT  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPP-EFVYGDGDGVPLVFAVSDDNSGRFDC  423
            IIP+LK+SLS+ L++Y  LA  L +P     P   +   DGD  PL+F+ S  +   F  
Sbjct  62   IIPNLKSSLSLTLKHYLPLAGNLLMPIKTGKPKLHYSLADGDTFPLIFSESAQD---FIS  118

Query  424  LSSNHARNSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDG  579
            L  +  RNS + + L+P +P   R         + AV+VT+FP  GI +G+  HH V D 
Sbjct  119  LKGHQPRNSNDLHALLPVMPRNVRTTSDCKVIPLMAVQVTVFPSHGIAIGLTTHHCVADA  178

Query  580  SSIFGFMKAWTALSLLG  630
             SI  FM AW +++ LG
Sbjct  179  KSIVDFMNAWASVNKLG  195



>ref|XP_011079053.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Sesamum 
indicum]
Length=455

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 109/195 (56%), Gaps = 13/195 (7%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA++ P   A V+E+  + P     +  +L L  FD+ WL+  PV RL+F+    S+  F
Sbjct  1    MAENPPA--AGVLERCDIRPSANTASELTLSLLHFDITWLYFHPVQRLLFFDFPCSKAEF  58

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
             +T++P LK SL   L ++  LA  +  P + S  P   + +GD V L  A SD +   F
Sbjct  59   LETVVPKLKESLHQTLNHFLPLAGNIIHPLN-SGRPFSRFEEGDSVTLTIAESDKD---F  114

Query  418  DCLSSNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGD  576
            D L+ NH R + EFY  +P LP  +         + A+++TLFP+ G+C+GI  HH +GD
Sbjct  115  DYLTGNHPRVADEFYACVPQLPPAKHTPDVVILPVLALQITLFPDRGVCLGITNHHAIGD  174

Query  577  GSSIFGFMKAWTALS  621
             SSI  F+KAW +++
Sbjct  175  ASSIVRFIKAWASVN  189



>gb|KDO55796.1| hypothetical protein CISIN_1g012440mg [Citrus sinensis]
Length=463

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 107/191 (56%), Gaps = 19/191 (10%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            VV++S +APPPG V    +PL F D+ WL   P+ R++FY+      H    IIPHLK S
Sbjct  9    VVDESHIAPPPGSVPPTVIPLTFLDVSWLFCCPIERILFYELPFPTRHLMQNIIPHLKHS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L ++  LA  LA     ++ P   + +GD V +    SD + G    L +NH R++
Sbjct  69   LSLTLHHFFPLAGNLAC----NSKPFIQFNEGDSVRVTVTESDADFGH---LVANHLRDN  121

Query  451  KEFYPLIPTLP--------SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            + F PL+P LP          +  + A++VT+FP +GI +G+ + HV  DGSS   FMK+
Sbjct  122  RAFKPLVPKLPFPFPSVSSDNKTPVMAIQVTVFPNSGISIGVTFIHVAADGSSFNHFMKS  181

Query  607  WTALSLLGHKS  639
            W ++    HKS
Sbjct  182  WASI----HKS  188



>ref|XP_002454697.1| hypothetical protein SORBIDRAFT_04g035790 [Sorghum bicolor]
 gb|EES07673.1| hypothetical protein SORBIDRAFT_04g035790 [Sorghum bicolor]
Length=468

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 107/191 (56%), Gaps = 14/191 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGF--SLPLAFFDLKWLHGSPVHRLIFYQHA--VSRTHFKDTIIPH  258
            V+++  V P P   AG   +LPL FFDL +    PV RL FY +A  +  + F    +P 
Sbjct  12   VLDKFQVTPSPAPAAGLPRALPLTFFDLVFWAIPPVQRLFFYDNADLLGVSDFTLGELPR  71

Query  259  LKTSLSIALQYYPLLAAKLAVP--TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSS  432
             + SL+ AL ++  LA KL      +   PPE V+ DGD VPL+ AVS D+   F  L+ 
Sbjct  72   FRNSLAAALHHFYPLAGKLTCELVDEGMAPPEVVFSDGDSVPLIVAVSGDD---FRDLAG  128

Query  433  NHARNSKEFYPLIPTLPS-----VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
            +HAR++    PL+P LP       ++G+ AV++T+FP AGIC+G   HH V DGSS   F
Sbjct  129  DHARDTTRIRPLLPALPKHGASRSQQGVLAVQITVFPRAGICIGTTVHHAVADGSSYAHF  188

Query  598  MKAWTALSLLG  630
            +  W A   LG
Sbjct  189  LSTWAAAHRLG  199



>ref|XP_008457512.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Cucumis 
melo]
Length=456

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 100/181 (55%), Gaps = 8/181 (4%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            +++   V+P P   A  SLPL FFDL WL   P+ RL FY+   +   F DTI+P LK+S
Sbjct  9    LIDVCKVSPSPTAAAPSSLPLTFFDLMWLRFHPIQRLFFYEFPSNEISFHDTIVPKLKSS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTP-PEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ L +Y  LA  L  P+    P  EFV  +GDGV +  A  D   G F+ LS N  R 
Sbjct  69   LSLTLCHYLPLAGNLVWPSQSDVPVVEFV--EGDGVSMTVAEFD---GDFNHLSGNGFRE  123

Query  448  SKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
              EF+PL+P LP    R  + A++VT F   G  +GI  HH + DG S   F+K+W  + 
Sbjct  124  VSEFHPLVPELPVSYDRAAVIAIQVTKFQNKGFSIGITNHHAIIDGRSSTSFIKSWAQIC  183

Query  622  L  624
            +
Sbjct  184  M  184



>gb|EYU42209.1| hypothetical protein MIMGU_mgv1a007129mg [Erythranthe guttata]
Length=418

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 98/168 (58%), Gaps = 9/168 (5%)
 Frame = +1

Query  139  FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLA  318
              LPL F D+ W+H   +H L+FY+++ S +HF +T+IP LK SLS+ L++Y  LA  L 
Sbjct  24   LQLPLTFLDIVWIHFQTMHYLLFYEYSCSESHFSETLIPKLKESLSLTLKHYLPLAGNLL  83

Query  319  VPTD-YSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRR  495
             P +     P   Y  GD + +  AVS    G FD L  NH R++ +FY     +P    
Sbjct  84   YPLNPDRRKPLIRYVAGDSISVKIAVS---GGNFDELVGNHPRDADQFYDFYKIVP----  136

Query  496  GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLLGHKS  639
             +FA++VTLFP  GIC+G +  H +GD  SI GF++AW ++  L  +S
Sbjct  137  -VFALQVTLFPGRGICIGFSNLHSLGDARSIVGFVRAWASMCKLARES  183



>ref|XP_010261004.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Nelumbo nucifera]
Length=463

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 106/185 (57%), Gaps = 10/185 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E   V+ PP   A  +L L FFDL WL+     RL FY+      HF  TI+P LK S
Sbjct  3    VLESCRVSLPPDSAAEKTLTLTFFDLIWLYLPRPSRLFFYEFPHPSNHFTTTILPKLKHS  62

Query  271  LSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ALQ +YP   +    P+  S  P+    DGD V L  A   +++   + LS NHAR 
Sbjct  63   LSLALQIFYPFAGSLTWSPS--SAEPQIRCVDGDSVSLTVA---ESTADVNHLSGNHARY  117

Query  448  SKEFYPLIPTLPSVRRG----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTA  615
            + +F PL+P LPS+       + A++VT+FP +G C+GI   HVV DG S+F F+++W +
Sbjct  118  ANQFSPLVPCLPSLLDSDIAPVLALQVTVFPNSGFCIGITSSHVVADGRSLFHFIRSWAS  177

Query  616  LSLLG  630
            +  LG
Sbjct  178  ICSLG  182



>gb|EYU26095.1| hypothetical protein MIMGU_mgv1a006012mg [Erythranthe guttata]
Length=461

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 105/192 (55%), Gaps = 13/192 (7%)
 Frame = +1

Query  85   AAVVEQSSVAPP-PGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHL  261
            AAV+++  + P      A  +LPL  FD+ WL+  PV RL+FY    S+  F +TI+P L
Sbjct  11   AAVIDRCDIEPSLESAAAEITLPLLHFDITWLYFHPVQRLLFYDFPCSKPLFLETIVPQL  70

Query  262  KTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
            K SLS  L ++  LA  +  P +    P   +  GD V L  AV D +   F+ L+ NHA
Sbjct  71   KQSLSQTLNHFLPLAGNIVHPLNSGGRPFSRFTAGDSVSLTVAVCDKD---FNHLTGNHA  127

Query  442  RNSKEFYPLIPTLPSVRRG---------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFG  594
            R S EFY  +P LP  +           + A+++TLFP+ G+C+G   HH + D SSI  
Sbjct  128  RVSDEFYACVPHLPPPKHSSSDDHVVLPVLALQITLFPDHGVCLGFTNHHAIADASSIVR  187

Query  595  FMKAWTALSLLG  630
            F++AW +++  G
Sbjct  188  FIRAWASVNRFG  199



>ref|XP_011100429.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Sesamum indicum]
Length=450

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 103/189 (54%), Gaps = 9/189 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A ++E   V   P      S+PL F D+ WLH  PV RL+FY +  S+ +F +T+ P LK
Sbjct  2    ATILETCRVLASPCVAPELSIPLTFLDIPWLHFHPVRRLLFYDYPCSKPYFLETVAPKLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS  L++Y L+A  L    +    PE  Y   D   +   +++  SG FD +  NHAR
Sbjct  62   ESLSFTLRHYLLVAGDLIFQLNSEKMPEIRYVARDSA-VSLTIAESASG-FDDIIGNHAR  119

Query  445  NSKEFYPLIPTLPSV-------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
            ++ +FY  +  +  V       R  + A+KVTLFP  G+C+G    H +GD SSI  F+K
Sbjct  120  DADQFYEFVAEIDPVTDESGYQRVPVMALKVTLFPGRGMCIGFTNLHCLGDASSIVRFIK  179

Query  604  AWTALSLLG  630
            AW ++S LG
Sbjct  180  AWASISKLG  188



>dbj|BAF99690.1| putative anthocyanin acyltransferase [Lobelia erinus]
Length=471

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 106/203 (52%), Gaps = 17/203 (8%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRT-HFKDTII  252
            P    V+E S  +PP G VA  S  L F D+ W    P+H+L FY +  S T HF  T++
Sbjct  4    PKDFTVLEHSRASPPAGSVAEKSFTLNFLDMPWPLLHPIHQLCFYDYPHSDTSHFTQTVV  63

Query  253  PHLKTSLSIALQYYPLLAAKLAV------PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            P LK SLSI LQ++   A  L V      P      PE  Y +GD V L      + +  
Sbjct  64   PKLKDSLSITLQHFFPFAGNLIVFPYGADPNVVPPKPEIRYMEGDSVCLTIC---ECTKD  120

Query  415  FDCLSSNHARNSKEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVG  573
            F+ L+ N+AR + E+YPL+P L  + +G       + A+++TLFP  G C+G+  HH   
Sbjct  121  FNYLTGNYARKADEYYPLVPKLGDIVKGSDYIKIPVLAIQLTLFPNRGFCIGVTNHHSAA  180

Query  574  DGSSIFGFMKAWTALSLLGHKSS  642
            DG++   F+K W  ++  G+  S
Sbjct  181  DGNARINFLKFWAKITKSGNGDS  203



>ref|XP_011658008.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Cucumis sativus]
 gb|KGN65689.1| hypothetical protein Csa_1G498810 [Cucumis sativus]
Length=454

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 103/181 (57%), Gaps = 8/181 (4%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E S V+PPP   A  SLPL FFDL WL   P+ RL FY+   ++    D I+  LK+S
Sbjct  9    VIEVSKVSPPPTAAAPISLPLTFFDLFWLRFYPIQRLFFYEFPSNQISSYDVIVSKLKSS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTPP-EFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+AL ++  LA  L  P+    P  EFV  +G+GV +  A SDD+   FD LS N  R 
Sbjct  69   LSLALCHHLPLAGNLVWPSQSDVPVIEFV--EGNGVSMTVAESDDD---FDHLSGNGFRE  123

Query  448  SKEFYPLIP--TLPSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
              +F+PL+P  T+   R  + A++VT F   G  +GI  HH + DG S   F+K+W  + 
Sbjct  124  VSDFHPLVPVLTVSHDRAAVIAIQVTKFQNKGFSIGITNHHAIFDGRSSTSFIKSWAQIC  183

Query  622  L  624
            +
Sbjct  184  M  184



>ref|XP_009391701.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=462

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 99/182 (54%), Gaps = 5/182 (3%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            P   +V E+S V+P  G +   +LPL FFD+ WL+  PV RL FY+      +F   ++P
Sbjct  4    PAAFSVRERSQVSPATGSLLETTLPLTFFDVMWLNRDPVERLFFYRFPDPTCNFMQAVVP  63

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             LK+SLS+ALQ +   A ++          E  Y DGD V    A   ++ G F+ LS +
Sbjct  64   ALKSSLSVALQSFYPFAGRIRRCPGCCDKYEIHYVDGDSVSFALA---EHGGDFEYLSGS  120

Query  436  HARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            HARN  E  PLIP +      R   AV+VTLFP+ G+ V + +HH V DG+    FM +W
Sbjct  121  HARNVSELLPLIPRIAESGDDRLSLAVQVTLFPDRGVAVAVTFHHAVCDGTGFKQFMASW  180

Query  610  TA  615
             +
Sbjct  181  AS  182



>ref|XP_010089644.1| Agmatine coumaroyltransferase [Morus notabilis]
 gb|EXB38115.1| Agmatine coumaroyltransferase [Morus notabilis]
Length=463

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 107/190 (56%), Gaps = 11/190 (6%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPG---KVAG-FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            +PP    V+E   VAP P      AG  SLPL FFD+ WL   PV RL FY  + S+T F
Sbjct  2    TPPCMVKVMEIFRVAPTPDLSDSPAGPKSLPLTFFDILWLRLPPVQRLYFYGISTSKTSF  61

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
             ++IIP LK SLS+ L +Y  LA  L  P + S  P   Y DGDGV L  A SD +   F
Sbjct  62   FNSIIPKLKHSLSLTLHHYLPLAGTLTWPQN-SPKPSIDYSDGDGVLLTIAESDMD---F  117

Query  418  DCLSSNHA-RNSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
              LSSN   R + + +PL+P L     R  + +++VTLFP +G C+GI  HH V DG + 
Sbjct  118  YHLSSNDDFRQATDCHPLVPHLKVSHERAEVISLQVTLFPNSGFCIGITAHHAVLDGKTS  177

Query  589  FGFMKAWTAL  618
              FMK+W  +
Sbjct  178  TSFMKSWAQI  187



>ref|XP_008813246.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Phoenix 
dactylifera]
Length=544

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 112/197 (57%), Gaps = 6/197 (3%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            +A  +P   A V+EQ  ++P PG  A  S+PL FFDL +    PV RL+FY+   S++HF
Sbjct  95   VAAMAPLHKAKVLEQCRISPYPGSAARPSIPLTFFDLVFFRFHPVQRLLFYESPQSKSHF  154

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
              + +P LK SL++ L ++  LA  L         PE +  D D V L  AVS+   G F
Sbjct  155  LHSELPKLKHSLALTLHHFYPLAGSLTRSCG-GQKPEILCSDDDFVWLNAAVSE---GDF  210

Query  418  DCLSSNHARNSKEFYPLIPTLPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
              LS +HA++ + F+ L+P+L S   G  + A++ T+FP AG+ VG   HH V DGS+  
Sbjct  211  YELSGSHAQDVRRFHSLVPSLHSSGDGQAVLAIQATIFPNAGVVVGTTLHHAVADGSTYA  270

Query  592  GFMKAWTALSLLGHKSS  642
             FMK W ++   G +++
Sbjct  271  SFMKTWASIHRFGDQAA  287



>dbj|BAF99693.1| putative anthocyanin acyltransferase [Lobelia erinus]
Length=470

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 109/196 (56%), Gaps = 17/196 (9%)
 Frame = +1

Query  88   AVVEQSSVAPPPGKVAG-FSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTHFKDTIIPHL  261
             V+E S ++P     A   S PL+F D+ WL   P+H+L FY+    S+++F  TI+P+L
Sbjct  8    TVLEHSQISPASAVSATENSFPLSFLDIPWLMLPPIHQLCFYELPECSQSNFIQTIVPNL  67

Query  262  KTSLSIALQYYPLLAAKLAV-----PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            K SLSI LQ++  LA  L V     P      PE  Y +GD V +  A   +++  FD L
Sbjct  68   KQSLSITLQHFFPLAGNLIVFPYTDPNTIPRKPEIRYVEGDSVSVTIA---ESTKDFDYL  124

Query  427  SSNHARNSKEFYPLIPTL-------PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSS  585
            + N AR + EFYPL+P L        S++  + A+++TLF   G C+G+  HH   DG++
Sbjct  125  TGNQARKADEFYPLVPKLGDITKSSDSIKVPLLAIQLTLFAGHGFCIGLTNHHTACDGNA  184

Query  586  IFGFMKAWTALSLLGH  633
               F+K+W  +S  G+
Sbjct  185  RVNFIKSWALISKFGN  200



>ref|XP_008457511.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Cucumis 
melo]
Length=456

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 101/181 (56%), Gaps = 8/181 (4%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            +++   V+PPP   A  SLPL FFDL WL   P+ RL FY+ + +   F D I+P LK++
Sbjct  9    LIDVCKVSPPPTAAAPSSLPLTFFDLIWLRFHPIQRLFFYEFSSNEISFHDVIVPKLKST  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTP-PEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ L++Y  LA  L  P+    P  EFV  +GDGV +  A  D   G F  LS N  + 
Sbjct  69   LSLTLRHYLPLAGNLVWPSQSDIPVVEFV--EGDGVSMTVAEFD---GDFYHLSGNGFQE  123

Query  448  SKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
              EF+PL+P LP    R  + A++VT F   G  +GI  HH + DG S   F+K+W  + 
Sbjct  124  VLEFHPLVPELPVSHDRAAVIAIQVTKFQNKGFSIGITNHHAIIDGRSSTSFIKSWAQIC  183

Query  622  L  624
            +
Sbjct  184  M  184



>ref|XP_010035652.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like isoform X3 [Eucalyptus grandis]
Length=274

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 104/190 (55%), Gaps = 14/190 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++ +  ++PPP  V   +LPL F D+ WL   P+ RL FY    S + F  T +P L  S
Sbjct  16   ILHRYDISPPPDSVPATTLPLPFLDIPWLLCCPMQRLFFYDFPESPSSFAQTTLPLLVRS  75

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L+++   AA+L +P      P  +Y DGD + L  A   +++  F  L S+  R +
Sbjct  76   LSLCLRHFFPFAARLVLPLAPPQKPHILYSDGDSLSLTVA---ESAANFAELISDEPRGA  132

Query  451  KEFYPLIPTL--PSVRRG-----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
               +PL+P L  P    G     + A++VTLFP  GIC+G+ + HVV DGSS   FMK+W
Sbjct  133  TLIHPLVPQLAPPCASDGARIGPVMAIQVTLFPNKGICIGVQFLHVVADGSSFTHFMKSW  192

Query  610  TALSLLGHKS  639
             ++    HKS
Sbjct  193  ASI----HKS  198



>ref|XP_010102960.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
 gb|EXB94478.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
Length=332

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 103/194 (53%), Gaps = 12/194 (6%)
 Frame = +1

Query  73   PPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWL-HGSPVHRLIFYQHAVSRTHFKDTI  249
            P     V+EQ+ V+PPPG V   SLPL FFD+ WL + + + R+ FY+      HF +T+
Sbjct  4    PNMEVKVIEQAKVSPPPGSVPKTSLPLTFFDMPWLLNCNHMQRVYFYEFPHPTNHFLETL  63

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            +P LK SLS+ LQ++  LA  L  P   + P   ++ DGD V L  A S   +  F  LS
Sbjct  64   LPSLKNSLSLTLQHFFPLAGNLVCPPPPAKP-NILFTDGDSVSLTVAQS---TADFHFLS  119

Query  430  SNHARNSKEFYPLIPTLPSVR-------RGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
            +NH    + F P +P     R         + AV+VT+FP  GIC+ +  +H   DG + 
Sbjct  120  ANHLLPVRAFDPFVPKFSPTRLEDGTRVEPLLAVQVTVFPNFGICIAVQRNHAGSDGRAF  179

Query  589  FGFMKAWTALSLLG  630
              FMK+W  LS  G
Sbjct  180  HHFMKSWALLSKTG  193



>gb|EYU26094.1| hypothetical protein MIMGU_mgv1a005927mg [Erythranthe guttata]
Length=464

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 109/196 (56%), Gaps = 12/196 (6%)
 Frame = +1

Query  88   AVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTHFKDTIIPHLK  264
             VVE  +VAPPP  V   SLPL F D+ WL  +P   L FY+   ++  HFK  I+P+L 
Sbjct  8    TVVETCTVAPPPQSVPPTSLPLTFLDIPWLLFTPTQPLFFYEFPTITTAHFKQNILPNLT  67

Query  265  TSLSIALQYYPLLAAKLAVPTDYST--PPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
             +LS+ LQ++   A  L  P+ +ST   P   Y + D + L  A S  ++G F  L++NH
Sbjct  68   KTLSLTLQHFFPFAGNLVTPSPHSTGAAPHLEYTEDDSILLTVAESP-SAGDFKRLAANH  126

Query  439  ARNSKEFYPLIPTLPSV--------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFG  594
             + +++F  L+P L S         R+ + A+++T+FP+AGI +G    HV  D  +   
Sbjct  127  QKTARDFRDLVPALLSAGSGGEAGSRQQLLAIQITVFPQAGISMGFTLRHVAADWRTFNN  186

Query  595  FMKAWTALSLLGHKSS  642
            F+K W++L   G +SS
Sbjct  187  FLKGWSSLCKSGGESS  202



>ref|XP_010257336.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nelumbo 
nucifera]
Length=461

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 108/196 (55%), Gaps = 10/196 (5%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAG----FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            +PP    VVE   VAP  G  +G     SLPL+FFDL WL   P   L FY+   S  +F
Sbjct  2    APPKSVKVVELCKVAPAAGSGSGSVIEASLPLSFFDLFWLPVPPTQLLYFYRFPHSSIYF  61

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
            + +++P +K SLS+ L ++   A  L+ P +    P   Y  GD V L  A SD   G F
Sbjct  62   RQSLLPRIKHSLSLTLFHFYPFAGHLSWPPE-CPKPMIHYAQGDSVSLAIAESD---GNF  117

Query  418  DCLSSNHARNSKEFYPLIPTLPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
              LS N A+++KE +PLIP L   R    M A+++T+FP++GIC+G+   H V D  +I 
Sbjct  118  YHLSGNKAQDAKELHPLIPELRVSRSTVPMLALQITVFPDSGICLGVTMPHAVADARTIM  177

Query  592  GFMKAWTALSLLGHKS  639
             F+ AW++   LG  S
Sbjct  178  NFINAWSSACRLGEIS  193



>ref|XP_008779727.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Phoenix dactylifera]
Length=448

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 97/182 (53%), Gaps = 5/182 (3%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E S V+PPPG VA  SLPL FFD+ WL   PV RL FY       HF D+ +P+LK+S
Sbjct  10   VLENSRVSPPPGSVAPASLPLTFFDVIWLVQHPVERLFFYDFPHPIAHFIDSCLPNLKSS  69

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++  LA  +          E  Y DGD V    A  D   G F   S +H  + 
Sbjct  70   LSVTLQHFFPLAGNIRRSPGSDDRYEIAYVDGDSVSFTVAEHD---GDFHDFSDDHGCDI  126

Query  451  KEFYPLIPTLPSVRRGM--FAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSL  624
             +   L+P LP  +      AV+VT+FP  GI +G++ +H   DGSS   FMK+W +   
Sbjct  127  SKLRQLVPQLPKAQDAQPSLAVQVTVFPNHGIAIGVSINHAACDGSSSMHFMKSWASACK  186

Query  625  LG  630
             G
Sbjct  187  SG  188



>ref|XP_004954208.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Setaria 
italica]
Length=469

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 103/188 (55%), Gaps = 11/188 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAG--FSLPLAFFDLKWLHGSPVHRLIFYQHA--VSRTHFKDTIIPH  258
            V+EQ  V+P P   AG   +LPL FFDL +    PV RL FY +A  +  + F    +P 
Sbjct  11   VLEQCHVSPSPAPAAGQPRALPLTFFDLVFWGFPPVQRLFFYDNADLLDASDFTLRELPK  70

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
             K SL+ AL ++  LA KL         PE ++  GD VPL  AVS D+   F+ L+ +H
Sbjct  71   FKKSLAAALHHFYPLAGKLPCELSEGVAPEVLFSHGDSVPLTVAVSGDD---FEDLAGDH  127

Query  439  ARNSKEFYPLIPTLP----SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            AR++   +PL+P L     S  + + AV+VT+FP AGIC+G   HH V DGSS   F+  
Sbjct  128  ARDTARLHPLLPALRQHGGSRSQDVLAVQVTVFPRAGICIGTTLHHAVADGSSYAHFLDK  187

Query  607  WTALSLLG  630
            W     LG
Sbjct  188  WATTHRLG  195



>gb|AAR28757.1| anthocyanin 3-O-glucoside-6''-O-hydroxycinnamoyltransferase [Salvia 
splendens]
Length=455

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 100/171 (58%), Gaps = 10/171 (6%)
 Frame = +1

Query  88   AVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
             V+E   VAPPPG V   +LPL FFD+ WLH  P+ +LIFY+   S  HF  T++P LK 
Sbjct  4    TVLESCLVAPPPGSVPDQTLPLTFFDINWLHFHPMLQLIFYEFPCSNPHFLQTVVPKLKQ  63

Query  268  SLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            SLS+ L+++  L+A L  P+     P + +  GD VP+  + S ++   F     N+ ++
Sbjct  64   SLSLTLKHFFPLSAHLVYPSSLEDMPFYRFRSGDSVPVTVSESGED---FYDFVGNYNQS  120

Query  448  SKEFYPLIPTLPSV-----RRGM--FAVKVTLFPEAGICVGIAYHHVVGDG  579
            + ++Y  +P LP +     R+ M  FAV++TLFP  G+CVGI  HH V D 
Sbjct  121  ADKYYNYVPQLPPIVEESDRKLMKVFAVQLTLFPGRGVCVGITTHHCVSDA  171



>gb|EYU26102.1| hypothetical protein MIMGU_mgv1a005739mg [Erythranthe guttata]
Length=472

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 105/189 (56%), Gaps = 16/189 (8%)
 Frame = +1

Query  91   VVEQSSVAPPP---GKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTHFKDTIIPH  258
            ++E   + P P    +    SLPL  FD+ +L   P  RLIF+     S++ F +TI+P 
Sbjct  1    MLEHCKIQPSPCSDDQELSLSLPLTHFDIPFLLSDPTVRLIFFNSPTCSKSRFVETIVPQ  60

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            LK SL+  L ++  LA K+ +P   +TP    Y  GD V L  A  D +   F+ L+ NH
Sbjct  61   LKKSLATTLTHFLPLAGKIIIPGAGTTPLS-RYVPGDSVSLTIAQCDKD---FEHLTGNH  116

Query  439  ARNSKEFYPLIPTLPSVRR--------GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFG  594
             R++ EFY  +P LP  RR         + A+++TLFPE GICVG++ +HVV D SSI  
Sbjct  117  QRSANEFYACVPHLPPARRMSDDSLVFSVLALQITLFPEKGICVGLSNYHVVADESSIIS  176

Query  595  FMKAWTALS  621
            F+K W  ++
Sbjct  177  FLKIWAVVN  185



>ref|XP_010035651.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like isoform X2 [Eucalyptus grandis]
Length=322

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 104/190 (55%), Gaps = 14/190 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++ +  ++PPP  V   +LPL F D+ WL   P+ RL FY    S + F  T +P L  S
Sbjct  16   ILHRYDISPPPDSVPATTLPLPFLDIPWLLCCPMQRLFFYDFPESPSSFAQTTLPLLVRS  75

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L+++   AA+L +P      P  +Y DGD + L  A   +++  F  L S+  R +
Sbjct  76   LSLCLRHFFPFAARLVLPLAPPQKPHILYSDGDSLSLTVA---ESAANFAELISDEPRGA  132

Query  451  KEFYPLIPTL--PSVRRG-----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
               +PL+P L  P    G     + A++VTLFP  GIC+G+ + HVV DGSS   FMK+W
Sbjct  133  TLIHPLVPQLAPPCASDGARIGPVMAIQVTLFPNKGICIGVQFLHVVADGSSFTHFMKSW  192

Query  610  TALSLLGHKS  639
             ++    HKS
Sbjct  193  ASI----HKS  198



>gb|KJB50065.1| hypothetical protein B456_008G151700 [Gossypium raimondii]
 gb|KJB50066.1| hypothetical protein B456_008G151700 [Gossypium raimondii]
Length=498

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 112/202 (55%), Gaps = 11/202 (5%)
 Frame = +1

Query  37   IFTSINHMAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH  216
            +F S N  + + P     +++ + V+ P G V   +L L + DL W   +P+  L FY+ 
Sbjct  13   LFCSFNLGSMAGPSYLVNILDSNHVSAPKGSVPSTTLALTYLDLPWFPSAPMQSLFFYEF  72

Query  217  AVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVS  396
                +HF  T +P L  SLS+ LQ++  LAAKL  P      P  +Y DGD VPL+  V+
Sbjct  73   PHPISHFMQTTLPTLTQSLSLTLQHFFPLAAKLICPPP-PLKPFILYSDGDSVPLI--VA  129

Query  397  DDNSGRFDCLSSNHARNSKEFYPLIPTLP--------SVRRGMFAVKVTLFPEAGICVGI  552
            +      D L++N+ R+ K  +P +P LP        ++   + AVKVT+FP  G+C+G+
Sbjct  130  EFTGADVDHLTANYPRDFKLLHPFVPELPPSTMSSDGTLVMPIMAVKVTVFPNTGVCIGM  189

Query  553  AYHHVVGDGSSIFGFMKAWTAL  618
             ++HV  DGS+   FM++W+++
Sbjct  190  VHNHVAADGSAFMHFMRSWSSV  211



>gb|KHN37926.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Glycine soja]
Length=217

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 96/184 (52%), Gaps = 11/184 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++EQ  V PP G V   ++PL+F DL WL+ +PV R+ FY    S  HF  T +P LK S
Sbjct  15   IIEQCEVTPPSGSVPATTIPLSFLDLPWLYCAPVKRIFFYDFPHSTHHFLHTALPSLKHS  74

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++   AAK+A P      P  +Y  GD V   F V++  +  FD L S+  R+ 
Sbjct  75   LSLTLQHFFPFAAKIAFPPKPHQ-PHILYSQGDSV--SFTVAESTTSDFDNLVSDSPRDV  131

Query  451  KEFYPLIPTLPSVR--------RGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
               YP  PTLPS R             V+VT+F   G  V + + H + DG +   FMK 
Sbjct  132  GHVYPFAPTLPSPRVLEDGTLLAPSMTVQVTVFDNKGFSVCVTFRHAIADGRAFHHFMKF  191

Query  607  WTAL  618
            W ++
Sbjct  192  WASV  195



>ref|XP_008457510.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Cucumis 
melo]
Length=456

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 97/181 (54%), Gaps = 8/181 (4%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            +++   V+PPP   A  SLPL FFDL WL   P+ RL FY+  +    F D I+P LK+S
Sbjct  9    LIDVCKVSPPPTAAAPSSLPLTFFDLAWLRFHPIQRLFFYEFPLDEISFHDVIVPKLKSS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTP-PEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ L++Y  L   L  P+    P  EFV GDG     VF    +  G F  LS N  R 
Sbjct  69   LSLTLRHYLPLVGNLVWPSQSDVPIIEFVEGDG-----VFVTIAECDGDFYHLSGNGFRE  123

Query  448  SKEFYPLIP--TLPSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
              +F+PL+P  T+ + R    A++VT F   G  +GI  HH + DG S   F+K+W  + 
Sbjct  124  VSKFHPLVPELTVSNDRAAATAIQVTKFQNKGFSIGITNHHAIIDGRSSTSFIKSWAQIC  183

Query  622  L  624
            +
Sbjct  184  M  184



>gb|EYU17682.1| hypothetical protein MIMGU_mgv1a023077mg [Erythranthe guttata]
Length=448

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 96/168 (57%), Gaps = 10/168 (6%)
 Frame = +1

Query  142  SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAV  321
            +LPL  FD+ WL    +  L FY    S ++F DTIIP+LK SLS+ L+++P  A K+  
Sbjct  23   TLPLQHFDMIWLPYHLMQNLFFYSFPCSESNFSDTIIPNLKKSLSLTLKHFPPFAGKIIF  82

Query  322  P-TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLP-----  483
            P T  +TPP   Y  GD + L  AVS  N+       +N +R+S +F+  +P LP     
Sbjct  83   PLTSPNTPPLSHYISGDAISLTIAVS--NADLIPLTENNLSRDSDQFHHFVPELPPATHS  140

Query  484  --SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
               +R  + AV+VTLFP  GICVG   H  +GDGSS  GF++ W  ++
Sbjct  141  PEQIRFAVAAVQVTLFPNQGICVGFTNHQAIGDGSSTVGFLQTWALIN  188



>ref|XP_010263233.1| PREDICTED: agmatine coumaroyltransferase-like [Nelumbo nucifera]
Length=452

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 103/187 (55%), Gaps = 9/187 (5%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            P    V+E  SVAPPP  V   SLPL FFDL+WL   P+  L F++     THF +T++ 
Sbjct  5    PPKVKVLEMFSVAPPPQSVTEVSLPLTFFDLQWLRHPPLQILYFFR----LTHFTETLLH  60

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
            ++K SLS+ LQ++  LA  L  P + S  P   + D D V L  A    +  RF   + N
Sbjct  61   NIKHSLSLTLQHFYALAGNLTWPRE-SEKPVLRFIDEDSVCLTLAECYSDFHRFS--AKN  117

Query  436  HARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            +  +  E+  L+P LP+        A++VT+FP +G+CVGI  H  V DG++I  FMK W
Sbjct  118  YMWDVNEYQSLLPDLPTSDTLASAMALQVTVFPNSGVCVGITVHQAVADGNTITLFMKEW  177

Query  610  TALSLLG  630
             +   LG
Sbjct  178  ASSCRLG  184



>ref|XP_011047481.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Populus euphratica]
Length=466

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 100/191 (52%), Gaps = 12/191 (6%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTI  249
            +P     V+++  V+PPPG V   SLPL FFD  WL   P+ RL FY+      +F   I
Sbjct  2    APSHSVKVIDRVQVSPPPGSVPTTSLPLTFFDFPWLLCPPMERLFFYELPYPTLYFMHNI  61

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            +P LK SLS+ALQY+  LA+ L  P      P  ++ DGD +P     S  N   FD + 
Sbjct  62   LPSLKNSLSLALQYFFPLASNLMCPLS-PHKPYILFNDGDSIPFTMVESTMN---FDQII  117

Query  430  SNHARNSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSS  585
             + A +  E +  +P  P  R          + A++V +FP +GIC+G  + HVV DG +
Sbjct  118  GDQAGDPTELHAFVPKWPPTRVTSDGKRVAPLLALQVVVFPNSGICIGAKFCHVVADGMA  177

Query  586  IFGFMKAWTAL  618
               FMK+W ++
Sbjct  178  FNHFMKSWASI  188



>ref|XP_010274321.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nelumbo 
nucifera]
Length=460

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 105/181 (58%), Gaps = 14/181 (8%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E+  V+P P K    SL L F D+ WL+  P   + FY+     THF++ I+P+LK S
Sbjct  9    VLEKCQVSPSPKK----SLDLTFLDICWLYTPPPSSIFFYEFPHPVTHFRENILPNLKKS  64

Query  271  LSIALQYYPLLAAKLA-VPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ L+++ +LA  L  +P   ST PE  Y +GD   L  A S+D+   F+ L ++H R+
Sbjct  65   LSLTLRHFYILAGNLTWLPP--STEPEICYVNGDVXSLTIAESNDD---FNYLCAHHPRD  119

Query  448  SKEFYPLIPTLPSVRRG----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTA  615
               F PL+P LPS        + A+++TLFP +G  +GI   HVV DG S F F+ +W +
Sbjct  120  ENRFRPLVPKLPSFSDSKVVQLLALQITLFPNSGFSIGITSSHVVADGKSTFHFISSWAS  179

Query  616  L  618
            +
Sbjct  180  I  180



>ref|XP_008679228.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Zea mays]
 gb|AFW64160.1| hypothetical protein ZEAMMB73_599265 [Zea mays]
Length=482

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 107/199 (54%), Gaps = 18/199 (9%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAG--FSLPLAFFDLKWLHGSPVHRLIFYQHA--VSRTHFKDTIIPH  258
             +E+  V P P   AG   +LPL F+DL +    PV RL FY  A  +  + F    +P 
Sbjct  11   AMEKFDVTPSPAPAAGQPRALPLTFYDLVFWAIPPVQRLFFYDRADLLDVSDFTLGELPR  70

Query  259  LKTSLSIALQYYPLLAAKLA---VPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
             + SL+ AL ++  LA KL    V  + + PPE V+ DGD VPL  AVS D+   F  L+
Sbjct  71   FRDSLAAALHHFYPLAGKLTCELVHEEGAAPPEVVFSDGDSVPLTVAVSGDD---FRDLA  127

Query  430  SNHARNSKEFYPLIPTLPS--------VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSS  585
             +HAR++     L+P LP          ++G+ AV++T+FP AG+C+G   HH V DGSS
Sbjct  128  GDHARDTARLRALLPALPQHGGSSRSHSQQGVLAVQITVFPRAGVCIGTTVHHAVADGSS  187

Query  586  IFGFMKAWTALSLLGHKSS  642
               F++ W     LG + S
Sbjct  188  YAHFLRTWATAHRLGPERS  206



>dbj|BAD44688.1| Hydroxycinnamoyl-CoA:anthocyanin 5-glucoside-6-O-hydroxycinnamoyltransferase 
[Gentiana scabra var. buergeri]
Length=469

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 103/195 (53%), Gaps = 14/195 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKV-AGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
            V+E+  V PP        SLP+ FFD+ WLH + +  L+FY     +THF DT++P+LK 
Sbjct  9    VLEKCQVTPPFDTTDVELSLPVTFFDIPWLHLNKMQSLLFYDFPYPKTHFLDTVVPNLKA  68

Query  268  SLSIALQYYPLLAAKLAVPTDYSTPPEFVYG--DGDGVPLVFAVSDDNSGRFDCLSSNHA  441
            SLS+ L++Y  L+  L +P      P+F Y   +GD + L+FA SD +   FD L  +  
Sbjct  69   SLSLTLKHYVPLSGNLLMPIKSGKMPKFRYSRDEGDSITLIFAESDQD---FDNLKGHQL  125

Query  442  RNSKEFYPLIPTLPSVRRGM--------FAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
             +S + + L   +P V R M         AV+VT+FP  GI V +  HH + D  S   F
Sbjct  126  VDSNDLHALFYVMPRVIRTMQDYKVIPLVAVQVTVFPNRGIAVALTAHHSIADAKSFVMF  185

Query  598  MKAWTALSLLGHKSS  642
            + AW  ++  G  + 
Sbjct  186  INAWAYINKFGKDAD  200



>sp|Q9ZWR8.1|ANTA_GENTR RecName: Full=Anthocyanin 5-aromatic acyltransferase; Short=5AT 
[Gentiana triflora]
 dbj|BAA74428.1| Anthocyanin 5-aromatic acyltransferase [Gentiana triflora]
Length=469

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 102/195 (52%), Gaps = 14/195 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKV-AGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
            V+E+  V PP        SLP+ FFD+ WLH + +  L+FY     RTHF DT+IP+LK 
Sbjct  9    VLEKCQVTPPSDTTDVELSLPVTFFDIPWLHLNKMQSLLFYDFPYPRTHFLDTVIPNLKA  68

Query  268  SLSIALQYYPLLAAKLAVPTDYSTPPEFVYG--DGDGVPLVFAVSDDNSGRFDCLSSNHA  441
            SLS+ L++Y  L+  L +P      P+F Y   +GD + L+ A SD +   FD L  +  
Sbjct  69   SLSLTLKHYVPLSGNLLMPIKSGEMPKFQYSRDEGDSITLIVAESDQD---FDYLKGHQL  125

Query  442  RNSKEFYPLIPTLPSVRRGM--------FAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
             +S + + L   +P V R M         AV+VT+FP  GI V +  HH + D  S   F
Sbjct  126  VDSNDLHGLFYVMPRVIRTMQDYKVIPLVAVQVTVFPNRGIAVALTAHHSIADAKSFVMF  185

Query  598  MKAWTALSLLGHKSS  642
            + AW  ++  G  + 
Sbjct  186  INAWAYINKFGKDAD  200



>ref|XP_010918788.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Elaeis 
guineensis]
Length=447

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 107/193 (55%), Gaps = 6/193 (3%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTI  249
            +P     V+EQ  ++PPPG  A  SLP  FFDL +    PV R++FY+   S++HF    
Sbjct  2    APIHKVKVLEQCRISPPPGSAARPSLPFTFFDLVFFRFHPVQRILFYELPHSKSHFLHFE  61

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            +P LK SLS+ L ++  LA  L  P+     PE +  DGD V L  A   ++   F  L 
Sbjct  62   LPKLKHSLSLTLHHFYPLAGSLTRPSG-GQKPEILCSDGDFVRLNVA---ESGADFYELL  117

Query  430  SNHARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
             +H  +  +F+ L+P+L S   R+ + A++ T+FP AG+ VG   HH V DGS+   FMK
Sbjct  118  GSHVHDVGKFHSLVPSLHSSGDRQAVLAIQATIFPNAGVVVGTTLHHAVADGSTYANFMK  177

Query  604  AWTALSLLGHKSS  642
             W ++   G +++
Sbjct  178  TWASMHKFGDQAA  190



>ref|XP_008454724.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like isoform X1 [Cucumis melo]
Length=495

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 107/192 (56%), Gaps = 19/192 (10%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            VV++  V PP G V   ++PL+F D+ W+   P  R  FY    S  HF D   P L+ S
Sbjct  29   VVKRCYVCPPKGSVPTTNIPLSFLDMYWIICPPARRFFFYNFPHSTQHFIDNFFPTLQQS  88

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVY---GDGDGVP-LVFAVSDDNSGR-----FDC  423
            LS+ LQ++  LA  L +P+  +  P  +Y     GD +P L+ AV++ +S +     FD 
Sbjct  89   LSLTLQHFFPLAGNLILPSQPNDKPYILYTSDDSGDDLPQLIVAVAEPSSNQFEHDYFDI  148

Query  424  LSSNH--ARNSKEFYPLIPTLPSVR------RG--MFAVKVTLFPEAGICVGIAYHHVVG  573
            L +++   R++KEFY L+P LP  R      R   + A++VTLFP  G+C+ + +HH V 
Sbjct  149  LVADYPQTRDAKEFYSLVPNLPKSRVLPDGARAFPLLAIQVTLFPNRGLCICVVFHHAVA  208

Query  574  DGSSIFGFMKAW  609
            DG +   F+K+W
Sbjct  209  DGKAAHHFIKSW  220



>gb|KDO38874.1| hypothetical protein CISIN_1g036678mg [Citrus sinensis]
Length=458

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 98/180 (54%), Gaps = 7/180 (4%)
 Frame = +1

Query  97   EQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHA-VSRTHFKDTIIPHLKTSL  273
            E + + P P     F LPL +FD  W+   PV RL FY+ A ++   F  TI+P LK SL
Sbjct  12   EVTKITPFPNSTTSFHLPLTYFDTFWILTPPVERLFFYEVAHLTSEIFNLTILPKLKHSL  71

Query  274  SIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSK  453
            S+ L +Y  LA  L  P+D +  P   Y   DGV +  AVS+     F+ L+S+  R + 
Sbjct  72   SLTLFHYLPLAGHLTWPSD-AEKPAIYYSPNDGVSVTVAVSN---ADFNILASDGIREAA  127

Query  454  EFYPLIPTL--PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLL  627
            EF PL P L     +    A+++TLFP  G  +GI++HHVV DG S   FMKAW  L  L
Sbjct  128  EFRPLTPQLVISEDKAEAVAIQITLFPNEGFSIGISFHHVVADGKSSTTFMKAWAYLCKL  187



>ref|XP_010035650.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like isoform X1 [Eucalyptus grandis]
 gb|KCW47094.1| hypothetical protein EUGRSUZ_K00900 [Eucalyptus grandis]
Length=494

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 103/190 (54%), Gaps = 14/190 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++ +  ++PPP  V   +LPL F D+ WL   P+ RL FY    S + F  T +P L  S
Sbjct  16   ILHRYDISPPPDSVPATTLPLPFLDIPWLLCCPMQRLFFYDFPESPSSFAQTTLPLLVRS  75

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L+++   AA+L +P      P  +Y DGD + L  A S  N   F  L S+  R +
Sbjct  76   LSLCLRHFFPFAARLVLPLAPPQKPHILYSDGDSLSLTVAESAAN---FAELISDEPRGA  132

Query  451  KEFYPLIPTL--PSVRRG-----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
               +PL+P L  P    G     + A++VTLFP  GIC+G+ + HVV DGSS   FMK+W
Sbjct  133  TLIHPLVPQLAPPCASDGARIGPVMAIQVTLFPNKGICIGVQFLHVVADGSSFTHFMKSW  192

Query  610  TALSLLGHKS  639
             ++    HKS
Sbjct  193  ASI----HKS  198



>ref|XP_006451717.1| hypothetical protein CICLE_v10010154mg [Citrus clementina]
 gb|ESR64957.1| hypothetical protein CICLE_v10010154mg [Citrus clementina]
Length=448

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 98/180 (54%), Gaps = 7/180 (4%)
 Frame = +1

Query  97   EQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHA-VSRTHFKDTIIPHLKTSL  273
            E + + P P     F LPL +FD  W+   PV RL FY+ A ++   F  TI+P LK SL
Sbjct  12   EVTKITPFPNSTTSFHLPLTYFDTFWILTPPVERLFFYEVAHLTSEIFNLTILPKLKHSL  71

Query  274  SIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSK  453
            S+ L +Y  LA  L  P+D +  P   Y   DGV +  AVS+     F+ L+S+  R + 
Sbjct  72   SLTLFHYLPLAGHLTWPSD-AEKPAIYYSPNDGVSVTVAVSN---ADFNILASDGIREAA  127

Query  454  EFYPLIPTL--PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLL  627
            EF PL P L     +    A+++TLFP  G  +GI++HHVV DG S   FMKAW  L  L
Sbjct  128  EFRPLTPQLVISEDKAEAVAIQITLFPNEGFSIGISFHHVVADGKSSTTFMKAWAYLCKL  187



>ref|XP_007043458.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX99289.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=467

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 107/189 (57%), Gaps = 12/189 (6%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            P  A +++   V+ P G V   +LPL +FD+ W   +P+  L FY++    +HF  T +P
Sbjct  4    PYAAKILDNIHVSAPAGSVPTTTLPLTYFDIPWFPCAPMQSLFFYEYPHPTSHFMQTTLP  63

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             LK SLS+ LQ++  LAAKL  P      P  +Y DGD VPL  A   +++   + + +N
Sbjct  64   TLKQSLSLTLQHFFPLAAKLVCPPP-PLEPNILYTDGDSVPLTIA---ESAADVNHIKAN  119

Query  436  HARNSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
            +AR+    +P +  LP             + A+KVT+FP A IC+G+A++HV  DGS+  
Sbjct  120  YARDINLLHPFVSLLPPSTMSSHGIRVLPIMALKVTVFPNAAICIGMAHYHVAADGSAFM  179

Query  592  GFMKAWTAL  618
             F+++W+++
Sbjct  180  HFVRSWSSV  188



>ref|XP_010102963.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
 gb|EXB94481.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
Length=477

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 106/194 (55%), Gaps = 12/194 (6%)
 Frame = +1

Query  73   PPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWL-HGSPVHRLIFYQHAVSRTHFKDTI  249
            P     V+EQ+ V+PPPG V   SLPL FFDL WL + S + R  FY       HF +T+
Sbjct  4    PNVEVIVIEQTKVSPPPGSVPTTSLPLTFFDLPWLLNFSHMQRPYFYDFPHPTNHFLETL  63

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            +P LK SLS+ LQ++  LA  L +P   + P   ++ DGD V L  A   +++  F  LS
Sbjct  64   LPSLKNSLSLTLQHFFPLAGNLRLPPPPAKP-HILFTDGDSVSLTVA---ESTADFHFLS  119

Query  430  SNHARNSKEFYPLIPTLP-------SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
            +NH    + F P +P          +    + A++ T+FP +GIC+GI  +HVV DG + 
Sbjct  120  ANHPLPVRAFDPFVPKFAPALVVDGTRVEPLLALQATVFPNSGICIGIRRNHVVSDGKAF  179

Query  589  FGFMKAWTALSLLG  630
              FMK+W ++   G
Sbjct  180  HHFMKSWASICNTG  193



>emb|CDP11903.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 107/206 (52%), Gaps = 14/206 (7%)
 Frame = +1

Query  40   FTSINHMAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHA  219
            F++ +HM Q +      V++   ++PP G V   ++PL FFD+ WL  +P   L FY   
Sbjct  30   FSTFSHMTQMTSSHTVKVLQCCQISPPQGSVPSTTIPLTFFDIPWLLFTPNQPLFFYDFP  89

Query  220  VSRTH-FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVS  396
               TH F   I+P+L  SLS  LQY+  LA  L +P   S  P   Y +GD V L+ A  
Sbjct  90   NFSTHDFIHNILPNLNHSLSSTLQYFFPLAGNLVIPPQPSK-PHLSYAEGDSVSLIIA--  146

Query  397  DDNSGRFDCLSSNHARNSKEFYPLIPTLP-------SVRRGMFAVKVTLFPEAGICVGIA  555
             + S  F  LSS   RN ++FY L+P L        + R  + AV++T+FP  G+C+G A
Sbjct  147  -EFSCDFAFLSSYQPRNVQDFYQLVPQLALSKPVETTTRLPLLAVQITIFPRFGVCMGFA  205

Query  556  YHHVVGDGSSIFGFMKAWTALSLLGH  633
               V  DG +   F+K W   S+LG 
Sbjct  206  LRQVAADGRTFDNFLKTWA--SILGE  229



>ref|XP_010246275.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nelumbo 
nucifera]
Length=469

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 104/189 (55%), Gaps = 10/189 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E+  V+PP   +   SL L FFD+ +L+     R+ FY+     T F ++IIP+LK S
Sbjct  9    VLEKCQVSPPAASMEKKSLQLTFFDVMYLYYRCPSRIFFYEFPHPITLFMESIIPNLKNS  68

Query  271  LSIALQYYPLLAAKLA-VPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+ LQ++  LA  L  VP   +T PE  +  GD V    A S DN   F  L  +H R+
Sbjct  69   LSLTLQHFYFLAGNLMWVPP--TTEPEIRFVSGDSVSFTIAESTDN---FSDLCGDHPRD  123

Query  448  SKEFYPLIPTLPSVRRG----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTA  615
              +F PLIP LPS+       + A++VT FP +G  +GI   HVV DG S+  F+++W  
Sbjct  124  ESQFDPLIPQLPSLFDSNVVPLLALQVTFFPNSGFSIGITSSHVVSDGRSLCHFIRSWAT  183

Query  616  LSLLGHKSS  642
               LG  SS
Sbjct  184  ACRLGGDSS  192



>ref|XP_004151485.2| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like [Cucumis sativus]
 gb|KGN49675.1| hypothetical protein Csa_5G056630 [Cucumis sativus]
Length=479

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 109/208 (52%), Gaps = 20/208 (10%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            M ++       VV+   V PP G V   ++PL+F D+ W+      R  FY    S  HF
Sbjct  1    MCKNQSMIEVKVVKHCYVCPPKGSVPTTNIPLSFLDMYWITCPTARRFFFYNFPHSTQHF  60

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVY-GDGDGV----PLVFAVSDD  402
             D I P L+ SLS+ LQ++  LA  L +P+  +  P  +Y  D DG      L+ AV++ 
Sbjct  61   IDNIFPTLQQSLSLTLQHFFPLAGNLILPSQPNHKPYLLYTSDDDGRDDLPQLIVAVAES  120

Query  403  NSGR-----FDCLSSNH--ARNSKEFYPLIPTLPSVR------RG--MFAVKVTLFPEAG  537
            +S +     FD L +++   R++K FYPL+P LP  R      R   +  +++TLFP  G
Sbjct  121  SSNQLKHDYFDILVADYPKIRDAKVFYPLVPNLPKSRLLPDGARAFPLLGIQITLFPNRG  180

Query  538  ICVGIAYHHVVGDGSSIFGFMKAWTALS  621
            +CV +A+HH V DG +   F+K+W   S
Sbjct  181  LCVCVAFHHAVADGKAAHHFIKSWATAS  208



>ref|XP_010089639.1| Agmatine coumaroyltransferase [Morus notabilis]
 gb|EXB38110.1| Agmatine coumaroyltransferase [Morus notabilis]
Length=464

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 5/161 (3%)
 Frame = +1

Query  139  FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLA  318
            FSL L FFD  W    PV RL FY     +  F D+ IP LK +LS+ LQ++  LA  L 
Sbjct  23   FSLLLTFFDTCWFKFPPVERLFFYSLPQPKQTFLDSTIPKLKHALSLTLQHFLPLAGNLT  82

Query  319  VPTDYSTPPEFVYGDGDGVPLVFAVSD--DNSGRFDCLSSNHARNSKEFYPLIPTLPSVR  492
             P D S  P  +Y   DGV L  A S+  +    FD LS N AR +  F+PL+P L    
Sbjct  83   WPRD-SPKPIILYTPNDGVSLTVAESNAAEKDEDFDFLSGNQARKAASFHPLVPKLKVSE  141

Query  493  RG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
             G  + ++++TLFP  G C+G+A HH V DG S   FMK+W
Sbjct  142  TGASVISLQITLFPNRGFCIGLACHHAVLDGKSTIMFMKSW  182



>ref|XP_004487342.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Cicer arietinum]
Length=474

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 108/197 (55%), Gaps = 13/197 (7%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKV-AGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTH  234
            M  +   T   V+EQS +APPPG V +  +LPL FFD+ W +  P+ R+ FY       H
Sbjct  1    MNFNQNETIMRVIEQSEIAPPPGSVPSPTTLPLTFFDIPWFYCHPIQRIFFYHFPHPTHH  60

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            F  T +P LK SLSI LQ++   ++ L VP +    P   Y  GD + L  A S   S  
Sbjct  61   FLQTTLPILKHSLSITLQHFFPFSSNLIVPPNSQNTPYIRYLHGDSLSLTVAES---SAN  117

Query  415  FDCLSSNHARNSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVV  570
            F+ L+S+ +++ + ++PL+P LPS R          + A+++T+   +G  + + ++H+ 
Sbjct  118  FNILTSD-SQDIQNWHPLVPNLPSPRTEQNGTRVIPLMAIQITVLSNSGFSICLTFNHLA  176

Query  571  GDGSSIFGFMKAWTALS  621
            GDG S+  FMK W  +S
Sbjct  177  GDGKSLHHFMKFWAFIS  193



>ref|XP_010089640.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
 gb|EXB38111.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
Length=471

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 89/164 (54%), Gaps = 5/164 (3%)
 Frame = +1

Query  130  VAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAA  309
            ++ FSLPL F D  W    PV RL FY     +  F ++ IP LK SLS  LQ++  LA 
Sbjct  20   LSDFSLPLTFCDTLWFKAYPVERLFFYSLPQPKQTFLNSTIPKLKNSLSQTLQHFLPLAG  79

Query  310  KLAVPTDYSTPPEFVYGDGDGVPLVFAVSD--DNSGRFDCLSSNHARNSKEFYPLIPTLP  483
             L  P D S+ P  +Y   DGV L  A S+  +    FD LS   AR    F+PL+P L 
Sbjct  80   NLTWPID-SSKPIILYTPNDGVSLTVAESNAANKDEDFDFLSGKQARKPASFHPLVPKLK  138

Query  484  SVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
                G  + ++++TLFP  GIC+G+  HH V DG S   FMK+W
Sbjct  139  VSETGASVISLQITLFPNRGICIGVTCHHAVLDGKSTTMFMKSW  182



>ref|XP_009397893.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=454

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 107/188 (57%), Gaps = 9/188 (5%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDT  246
            SSPP    V+E   V+PPPG VA  +LPL FFD+ WL+   V R+ FY   VS + F D+
Sbjct  3    SSPPELN-VLEICRVSPPPGAVAESTLPLTFFDIGWLYAGSVERVFFYAFPVSTSQFIDS  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            ++P LK+SLS+ALQ++  LA K+          E  Y DGD V    A  DD+   FD +
Sbjct  62   VVPSLKSSLSLALQHFYPLAGKIRRSPGSVDKYEIHYADGDSVTFTLAEHDDD---FDDI  118

Query  427  SSNHARNSKEFYPLIPTLPS---VRRGM--FAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
            S +H R+     PL+P LP      +GM   A++VT+FP  GI VG+  HH   DGSS  
Sbjct  119  SGSHPRDLIRLLPLVPQLPQPDDDNQGMRLLALQVTVFPGRGIAVGVTVHHAACDGSSSV  178

Query  592  GFMKAWTA  615
             F+ +W +
Sbjct  179  RFLSSWAS  186



>ref|XP_012065542.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like 
[Jatropha curcas]
 gb|KDP43457.1| hypothetical protein JCGZ_16744 [Jatropha curcas]
Length=468

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 108/192 (56%), Gaps = 11/192 (6%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA+SS      V+E   V+PPP      +LPL FFD+ WL  SP   L FY++  S +HF
Sbjct  1    MAKSS---MIKVLENWKVSPPPNSAPSTTLPLTFFDIPWLFFSPSQPLFFYEYPHSTSHF  57

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
                +P+LK SLS+AL+++      L + +  S  P+ +Y  GD V        ++SG F
Sbjct  58   LSFALPNLKLSLSLALKHFFPFLGNLVLSSCDSKKPKILYNAGDYVSFTI---QESSGDF  114

Query  418  DCLSSNHARNSKEFYPLIPTL-----PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGS  582
                SNHAR+  EFYPL+P L       V   +FAVKVT+F + G C+G+AY HV  DG 
Sbjct  115  SYFVSNHARDVHEFYPLVPDLAITSSEPVLIHLFAVKVTIFSQMGFCLGLAYQHVAADGR  174

Query  583  SIFGFMKAWTAL  618
            +   F+KAW +L
Sbjct  175  TFNNFIKAWASL  186



>gb|AGT37413.1| anthocyanin 5-aromatic acyltransferase [Vaccinium dunalianum]
Length=433

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 100/197 (51%), Gaps = 6/197 (3%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MAQS+P     V     +   P   A  SLPL FFD+ WL   P  RL FY+    +   
Sbjct  1    MAQSNPVKAFHVCRVIPMPNSPNSAAQTSLPLTFFDVLWLRFPPTQRLFFYECPYPKETL  60

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
             D I+P LK SLS+ LQ+Y  LA  L  P D S  P   Y +GD V L  A S  N   F
Sbjct  61   TDIILPKLKHSLSVTLQHYLPLAGNLTWPPD-SGKPIIQYNEGDAVSLTVAESAAN---F  116

Query  418  DCLSSNHARNSKEFYPLIPTLPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
              LS N  R ++  +  +P L + + G  + A++VTLFP AG  +G A HH V DG SI 
Sbjct  117  SILSGNSFREAETIHHFLPFLLASKTGVPVLALQVTLFPNAGFSIGYAAHHAVFDGKSIA  176

Query  592  GFMKAWTALSLLGHKSS  642
             FM +W  +   G  S+
Sbjct  177  MFMHSWAFVCRCGGDST  193



>ref|XP_009629767.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Nicotiana 
tomentosiformis]
Length=465

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 101/193 (52%), Gaps = 14/193 (7%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTI  249
            +P     V+E   V+PP G V    LPL F D+ WL  SP   L FY    + +HFK TI
Sbjct  2    APMQQIKVLECCQVSPPSGSVPSTILPLTFLDIPWLLFSPSQPLFFYDFPHTTSHFKQTI  61

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            + + KTSLS  LQY+  LA  L +P   +  P   Y  GD V L  A   +++  F+ LS
Sbjct  62   LSNFKTSLSFTLQYFFPLAGNLTIPPQPAL-PHLSYTSGDSVSLTIA---ESTADFNKLS  117

Query  430  SNHARNSKEFYPLIPTLPSV----------RRGMFAVKVTLFPEAGICVGIAYHHVVGDG  579
              + R+ ++F+ L+P +P +          +  + AV++T+FPE GI +G +  HV  D 
Sbjct  118  GYNQRSVQDFHQLVPQMPKICDLPGVDQESKYSLLAVQITIFPECGISIGFSLRHVAADE  177

Query  580  SSIFGFMKAWTAL  618
             +   F+K W A+
Sbjct  178  RTFNNFLKIWAAI  190



>ref|XP_007042677.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX98508.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=463

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 108/199 (54%), Gaps = 14/199 (7%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MAQ++      V++ S V+PPP  V   SL L FFDL W     + RL FY+      +F
Sbjct  1    MAQANEKL--QVLDCSHVSPPPASVPTTSLRLTFFDLPWFAFPNIQRLFFYEFPYPTLYF  58

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
             DT++P LK SLS+ LQ++   AAKL  P      P   Y DGD V        ++S  F
Sbjct  59   TDTVLPLLKHSLSLTLQHFFPYAAKLMCPPP-PGKPYLRYEDGDFVTFTVV---ESSADF  114

Query  418  DCLSSNHARNSK---EFYPLIPTLPSVRRG-----MFAVKVTLFPEAGICVGIAYHHVVG  573
            + + +N+ R+ K    F P +PT+P    G     + A +VTLFP +GIC+G  Y HVVG
Sbjct  115  NHVIANYPRDVKLLRPFAPQLPTVPVAEDGTRVLPVIAFQVTLFPNSGICIGSNYCHVVG  174

Query  574  DGSSIFGFMKAWTALSLLG  630
            DG +   FM++W+++   G
Sbjct  175  DGKTFMHFMRSWSSVHRAG  193



>ref|XP_006664958.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Oryza brachyantha]
Length=406

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 102/194 (53%), Gaps = 17/194 (9%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAG--FSLPLAFFDLKWLHGSPVHRLIFYQHA--VSRTHFKDTIIPH  258
            V+EQ  V+P P    G   SLPL FFDL +    PV RL FY  A       F  + +P 
Sbjct  12   VLEQYHVSPTPAPAPGQLRSLPLTFFDLVFWDFPPVQRLFFYASADLSDVPDFLHSKLPL  71

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            L  SL+ AL ++  LA +L         PE VY DGD V L  AVS D+   F  L+ +H
Sbjct  72   LNESLAAALHHFYPLAGRLPCRIQECASPEVVYSDGDSVRLTVAVSRDD---FQDLAGDH  128

Query  439  ARNSKEFYPLIPTL--------PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFG  594
             R++    PL+P L        PS  + + AV+VT+FP AG+CVG   HH V DGSS   
Sbjct  129  PRDTARLRPLLPPLAKHGGCHRPS--QDVLAVQVTVFPGAGVCVGTTLHHAVADGSSYVH  186

Query  595  FMKAWTALSLLGHK  636
            F+K W A+  LG +
Sbjct  187  FLKTWAAIHRLGDE  200



>ref|XP_009382788.1| PREDICTED: anthocyanidin 3-O-glucoside 6''-O-acyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=461

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 103/188 (55%), Gaps = 8/188 (4%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDT  246
            +S P+   V+++  V+PPPG     SLPL FFD+ WL   PV R+ FY      +HF   
Sbjct  2    ASLPSSVTVLDRFQVSPPPGSAPNASLPLTFFDVVWLPTGPVERIFFYPFPHPTSHFVSH  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVY--GDGDGVPLVFAVSDDNSGRFD  420
             +P LK+SLS AL+++  LA ++  P   S   +F     DGD V L  A S D+   F 
Sbjct  62   HLPSLKSSLSRALRHFYPLAGRVVPPCGPSPEAKFQIRCSDGDSVSLTLAESSDD---FR  118

Query  421  CLSSNHARNSKEFYPLIPTLPSVRRG---MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
             LS +  R     Y LIP LP    G   + A+++T+FP+ G+ +G+A HHV  D SS  
Sbjct  119  QLSGDQPRGFGRVYGLIPQLPPTGDGSIPLLALQITVFPDQGVSIGVAVHHVACDDSSSI  178

Query  592  GFMKAWTA  615
             F+K+W A
Sbjct  179  HFVKSWAA  186



>gb|EPS62073.1| hypothetical protein M569_12718 [Genlisea aurea]
Length=457

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 107/186 (58%), Gaps = 13/186 (7%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRT--HFKDTIIPH  258
            AAV+++  + P P   A  +LPL  FD+ WL+  PV RL+F++ + S     FK+T++P 
Sbjct  5    AAVLDRLEIQPWPATTAELTLPLVHFDMPWLYFHPVQRLLFFRLSSSSASQQFKETVVPR  64

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            ++ SL+  L+++  LA K+ +P+  S  P   Y  GD VPLV A +D + G F     +H
Sbjct  65   IRESLATTLRHFLPLAGKIVIPSS-SARPFIRYDVGDSVPLVVAQTDKDFGYF---VGDH  120

Query  439  ARNSKEFYPLIPTLP-------SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
             + + +F+  +P L         +   + A+++TLFPE G C+G+   H +GD +S+  F
Sbjct  121  PKVADDFHICVPDLSPAKHFSDGIEYPVLALQITLFPEKGYCLGLTNSHAIGDANSVVRF  180

Query  598  MKAWTA  615
            +KAW +
Sbjct  181  IKAWAS  186



>ref|XP_012084834.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Jatropha 
curcas]
 gb|KDP27255.1| hypothetical protein JCGZ_19954 [Jatropha curcas]
Length=464

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 97/189 (51%), Gaps = 10/189 (5%)
 Frame = +1

Query  91   VVEQSSVAPP---PGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSR-THFKDTIIPH  258
            ++E   + P    P     FSLPL F DL WL   PV RL FYQ   S  + F   I+P 
Sbjct  9    ILENCQIPPASDLPESATEFSLPLTFLDLFWLRFPPVERLFFYQLTDSTPSFFNSVILPK  68

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            LK S S+ L +Y   A  L  P++ S  P  +Y   DGVP   A SD      D LSS+ 
Sbjct  69   LKLSFSLTLVHYLPFAGHLTWPSN-SPKPIILYTPNDGVPFTVAESD---ADMDYLSSDD  124

Query  439  ARNSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWT  612
             R + E +P +P LP    R  + A ++TLFP  G  +G + +H V DG S+  FMKAW 
Sbjct  125  IRVATELHPYVPELPISETRSSIIAFQITLFPNKGFSIGYSINHAVLDGQSVTMFMKAWA  184

Query  613  ALSLLGHKS  639
             +S  G +S
Sbjct  185  YISKHGERS  193



>gb|AIS92513.1| putative anthocyanin acyltransferase [Epimedium sagittatum]
Length=464

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 106/198 (54%), Gaps = 14/198 (7%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MAQSS      V+E+S V+PP G +    L L FFD+KWL   PV  + FY +    THF
Sbjct  1    MAQSSS---MKVIEESLVSPPSGFIPETPLSLTFFDIKWLSLPPVSSINFYSYPHETTHF  57

Query  238  KDTIIPHLKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
              T +  +K SLSI LQ +YP LA KL  P D + P   +      + +  AV + N   
Sbjct  58   MKTTLADIKHSLSITLQPFYP-LAGKLTWPLDSTKP--VIDCSEHNLSVTLAVVESNVD-  113

Query  415  FDCLSSNHARNSKEFYPLIPTLPSVRRGMF------AVKVTLFPEAGICVGIAYHHVVGD  576
            F+ L  +H R+  +FYPL+P L S     F      AV+VT+FP AGI +G    H V D
Sbjct  114  FNHLVGDHPRDVNDFYPLVPQLTSSDTTRFNFVPVMAVQVTVFPNAGISIGTTTMHTVAD  173

Query  577  GSSIFGFMKAWTALSLLG  630
            GS+   FM++W ++   G
Sbjct  174  GSTFGHFMRSWASVCKAG  191



>ref|XP_008231014.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Prunus mume]
Length=467

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 100/188 (53%), Gaps = 14/188 (7%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGFS------LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            P    VVE   VAPPP   A  +      LPL  FDL WL  +PV RL FYQ  +S   F
Sbjct  4    PNSVKVVEVCKVAPPPSSPACSATPPPEALPLTVFDLLWLRFAPVQRLFFYQ--ISSNSF  61

Query  238  KDT-IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
              T ++  LK SLSIALQ +  LA  L  P D S  P   Y  GD V L  + S  ++  
Sbjct  62   DTTTLVSKLKASLSIALQQFLPLAGNLTWPQD-SPKPTLSYVQGDAVSLTISTSQ-SADH  119

Query  415  FDCLSSNHAR-NSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSS  585
            FD +SSN+    +KE++PLIP L     +    A++VT FP  G  +GIA HH + DG +
Sbjct  120  FDHISSNNLDVEAKEYHPLIPQLAFSQEKAAAMALQVTTFPNRGFSIGIATHHAILDGKT  179

Query  586  IFGFMKAW  609
               FMK+W
Sbjct  180  STMFMKSW  187



>ref|XP_008797924.1| PREDICTED: LOW QUALITY PROTEIN: malonyl-coenzyme A:anthocyanin 
3-O-glucoside-6''-O-malonyltransferase-like [Phoenix dactylifera]
Length=447

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 92/172 (53%), Gaps = 5/172 (3%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E S V+PPPG VA  SLPL FFD  WL   PV RL FY       HF D+ +P+LK S
Sbjct  10   VLENSRVSPPPGSVAPASLPLTFFDAIWLVQHPVARLFFYDFRHPIAHFIDSCLPNLKAS  69

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++  LA  +          E  Y DGD +    A  D   G F  LS +H  + 
Sbjct  70   LSVTLQHFFPLAGNIRRSPGSDDRYEIAYVDGDSISFTVAEHD---GDFYDLSDDHGCDI  126

Query  451  KEFYPLIPTLPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
             +   L+P LP  +    + AV+VT+FP  GI +G++ +H   DGSS   FM
Sbjct  127  SKLLQLVPQLPKAQDAQPLLAVQVTVFPNHGIAIGVSINHAACDGSSSMHFM  178



>ref|XP_009397892.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase 
{ECO:0000303|PubMed:11598135}-like [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 102/184 (55%), Gaps = 12/184 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVA-GFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
            V+EQ  V+  P       SLP  FFDL +    PV RL+FY+     T      +P LK 
Sbjct  10   VLEQWRVSSHPSSATLPCSLPSTFFDLVFYCFHPVQRLLFYESTNLETE-----LPKLKH  64

Query  268  SLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            SL++AL YY  LA  L   ++   P E +    D VPL  AVS D+   F  LS +HAR+
Sbjct  65   SLALALSYYYPLAGSLTRDSEVQNP-ELLCSQSDFVPLTVAVSRDD---FYELSGDHARD  120

Query  448  SKEFYPLIP--TLPSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
               F+PL+P  T  S R+ +FAV+VT+F +AG+ +G   HH V DGSS   FMK W+++ 
Sbjct  121  MARFHPLVPPLTASSGRQPVFAVQVTMFADAGVAIGTTVHHAVADGSSYTNFMKLWSSIH  180

Query  622  LLGH  633
             LG 
Sbjct  181  RLGE  184



>gb|KGN65691.1| hypothetical protein Csa_1G499320 [Cucumis sativus]
Length=440

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 90/180 (50%), Gaps = 30/180 (17%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E   V+PPP   A  SLPL FFDL WL   P+ RL FY+   +   F D I+P LK S
Sbjct  9    LIEVCKVSPPPTAAAPSSLPLTFFDLMWLRFHPIQRLFFYEFPSNEVSFHDVIVPKLKNS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ                         GDGV +  A SDDN   F  LS N  R  
Sbjct  69   LSLTLQ-------------------------GDGVSMTVAESDDN---FYHLSGNGFREV  100

Query  451  KEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSL  624
             EF+PL+P LP    R  + A++VT F   G  +GI+ HH + DG S   F+K+W  + +
Sbjct  101  SEFHPLVPQLPVSHNRAAVIAIQVTKFQNKGFSIGISNHHGILDGRSSTSFIKSWAQICI  160



>ref|XP_010107164.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
 gb|EXC13929.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
Length=476

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 107/197 (54%), Gaps = 12/197 (6%)
 Frame = +1

Query  64   QSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKD  243
            Q +      ++EQS V+PPPG V   SLPL+FFD+ WL  + + R  FY+   S  HF +
Sbjct  5    QPNKQELIKIIEQSKVSPPPGTVPTTSLPLSFFDVPWLLFANMQRPYFYEFPHSTHHFLE  64

Query  244  TIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGD-GVPLVFAVSDDNSGRFD  420
            T +P LK SLS+ LQ++   AA L +P   +  P  ++ +GD  V L  A   +++  F 
Sbjct  65   TRLPSLKHSLSLTLQHFFPFAANLILPPPPAK-PHILFAEGDSAVSLTVA---ESAADFH  120

Query  421  CLSSNHARNSKEFYPLIPTLPSVR-------RGMFAVKVTLFPEAGICVGIAYHHVVGDG  579
             LS+NH R  +     +P L   R         + A++ T+FP +GIC+G+  +HV GD 
Sbjct  121  FLSANHPRPVRALDTFVPKLAPARVDGDTRMEPIMALQFTVFPNSGICIGLRCNHVAGDA  180

Query  580  SSIFGFMKAWTALSLLG  630
             S+  FMK+W  +   G
Sbjct  181  RSLHHFMKSWALVCKTG  197



>ref|XP_011079059.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Sesamum 
indicum]
Length=459

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 91/167 (54%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAV  321
            SLPL  FD+ +   +P  RLIF+    S+ HF DTI+P LK SL+  L ++  LA  + V
Sbjct  22   SLPLTHFDIPFFLCNPTQRLIFFDIPCSKRHFLDTIVPDLKKSLARTLTHFLPLAGNVIV  81

Query  322  PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRR--  495
            P D+  P    Y  GD V L     D +   +  L+ NH R + EFY  +P LP   R  
Sbjct  82   PLDFGMPV-IRYVSGDSVSLTIVQCDRD---YQYLTGNHRRVADEFYACVPQLPPASRFP  137

Query  496  -----GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
                     ++VTLFP  GIC+G+  +HVVGD SSI  F+K+W  L+
Sbjct  138  DSFVLPALVLQVTLFPGQGICLGLTNNHVVGDESSIVNFVKSWALLN  184



>ref|XP_003599128.1| Anthocyanin 5-aromatic acyltransferase [Medicago truncatula]
 gb|ADV04047.1| malonyl CoA:flavonoid malonyltransferase 5 [Medicago truncatula]
 gb|AES69379.1| anthocyanin 5-aromatic acyltransferase [Medicago truncatula]
Length=468

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 104/190 (55%), Gaps = 11/190 (6%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGFS-LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKD  243
            S+ P    V+E   + PP       S LPL FFD+ WL  SP   L FY+   S +HF  
Sbjct  2    STIPFILKVIEHCKITPPINTTQTVSSLPLTFFDIPWLLFSPSQPLFFYEFPHSISHFTT  61

Query  244  TIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDC  423
            TI+P LK SLS+ LQ+Y   +    VP+   T P+  +   + V   F V++ NS  F+ 
Sbjct  62   TIVPKLKQSLSLTLQHYFPFSGTF-VPSLDLTEPQLEFTLNNSVS--FTVAESNSD-FEH  117

Query  424  LSSNHARNSKEFYPLIPTLPSV------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSS  585
            L S+++R+  EF+PL+P L  +         + A+++T FP  G  +G+A+HHVV DG +
Sbjct  118  LCSDYSRDVNEFHPLVPKLQQIFSFEVKEFPLLAIQITSFPNYGFSIGLAFHHVVADGRT  177

Query  586  IFGFMKAWTA  615
               F+K W++
Sbjct  178  FHNFIKTWSS  187



>ref|XP_011468648.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=329

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 94/174 (54%), Gaps = 11/174 (6%)
 Frame = +1

Query  94   VEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSL  273
            VE   VAP PG     SLPL  FDL WL   PV RL FYQ     T   D+++  LKTSL
Sbjct  9    VEVCRVAPKPGSPENQSLPLTLFDLFWLRFPPVERLYFYQ-----TSSTDSVLSQLKTSL  63

Query  274  SIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSK  453
            S+ALQ++P LA  L  P D S  P   Y  GD V +  A SD +   FD L ++    +K
Sbjct  64   SLALQHFPPLAGNLIWPQD-SLKPLLSYVQGDAVSVTVAESDAD---FDHLINSVFLAAK  119

Query  454  EFYPLIPT--LPSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            +F  L+P   +   R    A+++T+FP  G  +G A HH V DG +   F+KAW
Sbjct  120  DFSHLVPQVDVTDERAAAMALQITVFPNRGFSIGTAMHHAVLDGKTSTSFVKAW  173



>ref|XP_010105247.1| Agmatine coumaroyltransferase [Morus notabilis]
 gb|EXC04168.1| Agmatine coumaroyltransferase [Morus notabilis]
Length=465

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 87/158 (55%), Gaps = 6/158 (4%)
 Frame = +1

Query  145  LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVP  324
            LPL F D  W    PV RL FY     +  F D+ IP LK SLS+ LQ++  LA  L  P
Sbjct  25   LPLTFCDTCWFKFPPVERLFFYSLPQPKQTFLDSTIPKLKNSLSLTLQHFLPLAGNLNWP  84

Query  325  TDYSTPPEFVYGDGDGVPLVFAVSDDNSGR-FDCLSSNHARNSKEFYPLIPTLPSVRRG-  498
             D S  P  +Y   DGV L   V++ NS + FD  S++H R +  F+P +P L     G 
Sbjct  85   RD-SPKPIILYTPNDGVSLT--VAESNSAKDFDYFSADHPREAASFHPFVPNLKVTETGA  141

Query  499  -MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
             + +V++TLFP  G C+G+  HH V DG S   FMK+W
Sbjct  142  SVISVQITLFPNRGFCIGVTCHHAVLDGKSTAMFMKSW  179



>ref|XP_010089642.1| Agmatine coumaroyltransferase [Morus notabilis]
 gb|EXB38113.1| Agmatine coumaroyltransferase [Morus notabilis]
Length=462

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 95/180 (53%), Gaps = 7/180 (4%)
 Frame = +1

Query  85   AAVVEQSSVAP---PPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            A  +E S V P       ++ FSLP+ F D  W    PV RL FY     +  F ++ IP
Sbjct  2    AKTLEISHVPPYSDSSNSLSDFSLPVTFCDTCWFKFPPVERLFFYSLPQPKQTFLNSTIP  61

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             LK SLS+ LQ++  LA  L  P D S  P  +Y   D V L  A S + +  FD L+ +
Sbjct  62   RLKRSLSLTLQHFLPLAGNLTWPRD-SPKPIILYIPNDSVSLTVAES-NAAEDFDFLAGD  119

Query  436  HARNSKEFYPLIPTLPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            HAR +  F+P IP L     G  + +V++TLFP  G C+G+  HH V DG S   FMK+W
Sbjct  120  HAREAASFHPFIPNLKVSETGASVISVQITLFPNRGFCIGVTCHHAVLDGKSTTMFMKSW  179



>ref|XP_003552578.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Glycine 
max]
 gb|KHN13547.1| Agmatine coumaroyltransferase [Glycine soja]
Length=479

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 97/187 (52%), Gaps = 8/187 (4%)
 Frame = +1

Query  97   EQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAV---SRTHFKDTIIPHLKT  267
            E   V PP      FS+PL FFDL WL   PV R+ FY   +     + F D ++P LKT
Sbjct  12   EHCLVPPPSAAATPFSVPLTFFDLHWLRFHPVERIFFYSLPLPHSDHSSFFDKVVPKLKT  71

Query  268  SLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            SLS  LQ++  LA  +  P+D S  P   +  GDGV LV A  DD    F+ +  N  R 
Sbjct  72   SLSHTLQHFLPLAGNIVWPSD-SPKPIIQFNPGDGVSLVLAQCDD--ALFNHMLDNSPRG  128

Query  448  SKEFYPLIPTLPSVRR--GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
            + E + L+P L S      + ++++TLFP  G C+ I+ HH V DG S   F+KAW    
Sbjct  129  ATESHTLVPHLESSDSLASVMSLQITLFPNKGFCIAISSHHAVLDGKSSTMFIKAWAYAC  188

Query  622  LLGHKSS  642
              G + S
Sbjct  189  KSGEEES  195



>ref|XP_010089643.1| Agmatine coumaroyltransferase [Morus notabilis]
 gb|EXB38114.1| Agmatine coumaroyltransferase [Morus notabilis]
Length=465

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 85/157 (54%), Gaps = 4/157 (3%)
 Frame = +1

Query  145  LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVP  324
            LPL F D  W    PV RL FY     +  F D+ IP LK SLS+ LQ++  LA  L  P
Sbjct  25   LPLTFCDTSWFKFPPVERLFFYSLPQPKQTFLDSTIPKLKNSLSLTLQHFLPLAGNLTWP  84

Query  325  TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRRGMF  504
              +S  P  +Y   DGV L  A S + +  FD LS++H R +  F+P +P L     G  
Sbjct  85   R-HSPKPIILYTPNDGVSLTVAES-NAAQDFDFLSADHPREAASFHPFVPNLKVTETGAS  142

Query  505  A--VKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            A  V++TLFP  G C+G+  HH V DG S   FMK+W
Sbjct  143  AISVQITLFPNRGFCIGVTCHHAVLDGKSTAMFMKSW  179



>ref|XP_011467880.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 101/191 (53%), Gaps = 17/191 (9%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAG-----FSLPLAFFDLKWLHGSPVHRLIFYQHAV  222
            MAQ +  +   VVE   V P P          FSLPL FFD+ WL   P+ R+ FY+   
Sbjct  1    MAQPNSNS-VKVVEVCRVDPQPCSPDSPIPDHFSLPLTFFDIHWLRLKPIQRVFFYE---  56

Query  223  SRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDD  402
              T   DTIIP LKTSLS+ LQ++  LA  L  P D S  P   Y  GD V L  A S+ 
Sbjct  57   --TSSIDTIIPKLKTSLSLTLQHFLPLAGTLTWPKD-SYKPILNYVQGDTVSLTIAESEA  113

Query  403  NSGRFDCLSSNHARNSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGD  576
            +   F  LSSN    +KE++PL+P L   S    +  +++T+FP  GI +G + HH V D
Sbjct  114  D---FHQLSSNEYLQAKEYHPLVPQLAVTSEHAAVLVLQITVFPNHGISIGTSMHHAVVD  170

Query  577  GSSIFGFMKAW  609
            G S   F K+W
Sbjct  171  GKSSTMFFKSW  181



>ref|XP_009774760.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like [Nicotiana sylvestris]
Length=474

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 97/187 (52%), Gaps = 15/187 (8%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+E   V+PP G V    LPL F D+ WL  SP   L FY    + +HFK TI+ + KTS
Sbjct  10   VLECCQVSPPSGSVPSTILPLTFLDIPWLLFSPSQPLFFYDFPHTTSHFKQTILSNFKTS  69

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSS-NHARN  447
            LS  LQY+  LA  L +P   +  P   Y  GD V L  A   +++  F+ LS  N  R 
Sbjct  70   LSFTLQYFFPLAGNLIIPPQPAL-PHLSYTSGDSVSLTIA---ESTADFNQLSGYNQIRG  125

Query  448  SKEFYPLIPTLP----------SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
             ++F+ L+P +P            R  + AV++T+FPE GI +G +  HV  D  +   F
Sbjct  126  VQDFHQLVPQMPKNCDLLGIDQESRYSLLAVQITIFPECGISIGFSLCHVAADERTFNNF  185

Query  598  MKAWTAL  618
            +K W A+
Sbjct  186  LKVWAAI  192



>ref|XP_007217864.1| hypothetical protein PRUPE_ppa021495mg [Prunus persica]
 gb|EMJ19063.1| hypothetical protein PRUPE_ppa021495mg [Prunus persica]
Length=467

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 99/183 (54%), Gaps = 14/183 (8%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFS------LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDT-I  249
            VVE   VA PP   A  +      LPL  FDL WL  +PV RL FYQ  +S   F  T +
Sbjct  9    VVEVCKVAAPPSSSACSATSPPEALPLTVFDLLWLRFAPVQRLFFYQ--ISSNSFDTTTL  66

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            +  LK SLSIALQ +  LA  L  P D S  P   Y  GD V L  A +  ++  FD +S
Sbjct  67   VSKLKASLSIALQQFLPLAGNLTWPQD-SPKPILTYVHGDAVSLTIATAQ-SADHFDHIS  124

Query  430  SNHAR-NSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            SN+    SKE++PLIP L     +    A++VT+FP  G  +GIA HH + DG +   FM
Sbjct  125  SNNLDVESKEYHPLIPQLAFSQEKAAAMALQVTIFPNRGFSIGIATHHAILDGKTSTMFM  184

Query  601  KAW  609
            K+W
Sbjct  185  KSW  187



>ref|XP_010030472.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Eucalyptus grandis]
Length=480

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 97/183 (53%), Gaps = 10/183 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++ + +V+PP   V   +LPL F D+ + H  P+ RL  Y    S   F  T +P L  S
Sbjct  6    ILHRYNVSPPANSVPATALPLTFLDIPFFHCCPMQRLFLYDFPQSPPSFAQTTLPLLVRS  65

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L+++   AA L +P      P  +Y DGD + L+ A   D++  F  L S+   ++
Sbjct  66   LSLCLRHFFPFAANLILPLSPPEKPHILYTDGDSLSLIVA---DSAADFADLVSDEVHDA  122

Query  451  KEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
               +PL+P LP  R         + A++VTLFP  GIC+G+ + HV  DG S   FMK+W
Sbjct  123  TLIHPLVPQLPPPRESDGALMWPLMAIQVTLFPNKGICIGVQFLHVAADGRSFAHFMKSW  182

Query  610  TAL  618
             ++
Sbjct  183  ASI  185



>ref|XP_004308681.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=466

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 103/183 (56%), Gaps = 7/183 (4%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPG-KVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFK-DTI  249
            P+   +VE   VAP PG +V   SLPL +FD  WL   PV RL FY+   S +    D++
Sbjct  4    PSSVKLVEICRVAPKPGAQVDLLSLPLTYFDSLWLRFPPVQRLYFYESTSSSSTTTTDSL  63

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            + +LKTSLS+ L+++  LA  L  P D S  P   Y +GD V L  A S D +  FD LS
Sbjct  64   LAYLKTSLSLTLKHFGPLAGNLTWPQD-SPRPVLSYVEGDAVSLTVAESTD-ADNFDHLS  121

Query  430  SNHA-RNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            SN     S+ ++PL+P L S   R    A+++TLFP  G  +G A HH + DG +   F+
Sbjct  122  SNSVFVESRAYHPLVPQLESSHERAAAIALQITLFPGRGFAIGTAMHHAILDGKTSISFV  181

Query  601  KAW  609
            K+W
Sbjct  182  KSW  184



>ref|XP_007033867.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY04793.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=467

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 106/207 (51%), Gaps = 18/207 (9%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MAQ     +   +E S V+PPPG V   SLPL F D  W+    + RL FY+     +HF
Sbjct  1    MAQHC---FIKFLEASHVSPPPGSVPTTSLPLTFLDTLWISCCHIQRLFFYKFPYPTSHF  57

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
                +P+LKTSLS+ LQ++   A  L +P      P   Y DGD +P  F V +  +   
Sbjct  58   LHNALPNLKTSLSLTLQHFFPFAGNLKMPP-LPQRPYIYYADGDSLP--FVVIESTADFK  114

Query  418  DCLSSNHARNSKEFYPLIPTLP-----------SVRRGMFAVKVTLFPEAGICVGIAYHH  564
              ++ N  R+++E   L+P LP             ++ + A++VT+FP AGI +GI + H
Sbjct  115  HLITGNRPRHAQELEDLVPNLPPPSMSSDGDNICKKQPLMAIQVTVFPNAGISIGITFCH  174

Query  565  VVGDGSSIFGFMKAWTALSL-LGHKSS  642
            V  DG +   F K+W ++   LG  +S
Sbjct  175  VAADGRAFGHFTKSWASICRSLGDSTS  201



>ref|XP_006593287.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like, partial [Glycine max]
Length=193

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 96/184 (52%), Gaps = 11/184 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++EQS VAPP   +    LPL F D+ W       R+ FY+     THF  T +P LK S
Sbjct  8    IIEQSQVAPPQDSLHSTILPLTFLDIPWFLTRHARRIFFYEFPFPTTHFLQTALPTLKHS  67

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++   A+ L +P      P   Y +GD V   F VS+ +   F  L+SN  ++ 
Sbjct  68   LSLTLQHFFPFASNLILPPRLHV-PYIRYLNGDSV--SFTVSEFSPANFTLLTSNSPQDV  124

Query  451  KEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
             ++ PL P  PS R          + A++VT+ P +G  + + ++HV GDG ++  FMK 
Sbjct  125  NDWQPLAPAFPSPRTTHDGTCEFPLMAIQVTVIPNSGFSICVIFNHVAGDGRTLHHFMKF  184

Query  607  WTAL  618
            W ++
Sbjct  185  WASV  188



>ref|XP_004491975.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Cicer arietinum]
Length=512

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 103/190 (54%), Gaps = 13/190 (7%)
 Frame = +1

Query  79   TYAAVVEQSSVAPPPGKV-AGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIP  255
            T   V+EQS +APPPG V +  +LPL F D+ W    P+ R+ FY       HF  T +P
Sbjct  11   TVTRVIEQSEIAPPPGSVPSPTTLPLTFLDIGWFFCPPIQRIFFYHFPHPTHHFLQTTLP  70

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             LK SLSI LQ++   ++ L +P +    P   Y +GD + L    S  N   F+ L S+
Sbjct  71   ILKHSLSITLQHFFPFSSNLIIPPNSQNVPYIRYLNGDFISLTVVESSTN---FNILISD  127

Query  436  HARNSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
             +++++ +YPL+P L + R          + ++++T+ P  G  + + + H+ GDG S+ 
Sbjct  128  -SQDTQNWYPLVPNLCAPRTEQNGTRVIPLMSIQITILPNFGFSICLTFSHIAGDGKSLH  186

Query  592  GFMKAWTALS  621
             FMK W ++S
Sbjct  187  HFMKFWASIS  196



>ref|XP_007216324.1| hypothetical protein PRUPE_ppa019904mg [Prunus persica]
 gb|EMJ17523.1| hypothetical protein PRUPE_ppa019904mg [Prunus persica]
Length=418

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 101/191 (53%), Gaps = 14/191 (7%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGF-----SLPLAFFDLKWLHGSPVHRLIFYQHAVSRT  231
            + P +   VVE   VAPPP   +G      SLPL FFD++WL  +PV RL FY+   S  
Sbjct  2    AEPTSSVKVVEVCRVAPPPPSSSGAFASPSSLPLTFFDIRWLRFAPVQRLYFYEMPTSSA  61

Query  232  H---FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDD  402
                F   ++P LK SLS  LQ++  LA  L  P D S  P   Y  GD V L  A   +
Sbjct  62   TPLFFDSILVPKLKASLSYTLQHFLPLAGNLTWPQD-SQKPVLNYVQGDTVSLTIA---E  117

Query  403  NSGRFDCLSSNHARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGD  576
            +   F  LSS     + E++PL+P L +   +  + A+++T+FP  G  +G + HH V D
Sbjct  118  SGADFYHLSSGDFVEATEYHPLVPRLEASHEQAAVMALQITVFPNCGFSIGTSIHHAVLD  177

Query  577  GSSIFGFMKAW  609
            G SI  F+K+W
Sbjct  178  GKSITFFVKSW  188



>gb|KEH25130.1| malonyl-CoA:isoflavone 7-O-glucoside malonyltransferase [Medicago 
truncatula]
Length=460

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 98/181 (54%), Gaps = 13/181 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGF----SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPH  258
            VV+  ++ P       F    SLPL FFDL WL   PV RL FY+   S T F +T++P+
Sbjct  10   VVQNCNIEPLIDTTKPFPSPTSLPLTFFDLLWLRFPPVERLFFYELTNSTTFFYETLLPN  69

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTP-PEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
            LK SLS+ LQ++  L   +  P+D S P   +V GD     +V     ++   F  LSS+
Sbjct  70   LKHSLSLTLQHFLPLVGNITWPSDSSKPIINYVKGDSISFNVV-----ESKASFKDLSSH  124

Query  436  HARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            H   SK  + LIP L +   +  + A++VTLFP  G C+GI  HH   DG S   FMK+W
Sbjct  125  HCEASKRHH-LIPLLKNSHEKASLLAIQVTLFPNNGFCIGITTHHAALDGKSSTTFMKSW  183

Query  610  T  612
            +
Sbjct  184  S  184



>gb|KJB64646.1| hypothetical protein B456_010G059400 [Gossypium raimondii]
 gb|KJB64647.1| hypothetical protein B456_010G059400 [Gossypium raimondii]
Length=457

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 106/191 (55%), Gaps = 23/191 (12%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            VVE   V+PPP  V   SLPL FFD+++L  SP  RL FY+     ++F  T +P LKTS
Sbjct  11   VVED--VSPPPVSVPTTSLPLTFFDIQFLGSSPFQRLFFYEFPHPTSYFMQTTLPSLKTS  68

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPE---FVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
            LS+ LQ +   A  L  P     PP+    +Y  GD V       ++++  F  L+ +HA
Sbjct  69   LSLTLQRFFPFAGNLVFP----APPQIPYILYTQGDSVSFFV---NESTADFSHLAGDHA  121

Query  442  RNSKEFYPLIPT-LPSV----------RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
            R+ +EF  ++P  LP++          +    A++VTLFP  GI +G+++ HV GDG ++
Sbjct  122  RHFQEFQLILPKLLPAIACKTSSGCIQKMPFMAIQVTLFPNQGISIGVSFCHVAGDGRTL  181

Query  589  FGFMKAWTALS  621
              FMK+W ++ 
Sbjct  182  AHFMKSWASIQ  192



>ref|XP_006421786.1| hypothetical protein CICLE_v10004870mg [Citrus clementina]
 gb|ESR35026.1| hypothetical protein CICLE_v10004870mg [Citrus clementina]
Length=480

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 113/200 (57%), Gaps = 15/200 (8%)
 Frame = +1

Query  58   MAQSSPPTYAA-VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRT  231
            MA ++  +Y   VV++S V PP G V+  ++PL F D+ W+   P+ R+ FY+   +S  
Sbjct  1    MATAAESSYRVRVVDESHVGPPRGSVSPTTIPLTFLDMVWISIGPMQRIFFYEFPDISTP  60

Query  232  HFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSG  411
            HF   I P+LK SLS+ L+++   AA L  P      P   Y +GD V +  A SD +  
Sbjct  61   HFTQNIYPNLKHSLSLTLRHFFPFAANLTCPPP-PNHPYISYKEGDSVLVSVAESDYD--  117

Query  412  RFDCLSSNHARNSKEFYP-LIPTLPSVRR--------GMFAVKVTLFPEAGICVGIAYHH  564
             FD L++N AR++  F+  L+P LP+              AV+ T+FP +G  +GIA++H
Sbjct  118  -FDHLTANQARDNNAFHQSLVPKLPTPSLLSEETHAVPTMAVQFTVFPNSGFSIGIAFNH  176

Query  565  VVGDGSSIFGFMKAWTALSL  624
            V  DG S+  F+K+W ++S+
Sbjct  177  VAADGRSLNHFVKSWASMSV  196



>ref|XP_004304224.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=466

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 100/186 (54%), Gaps = 15/186 (8%)
 Frame = +1

Query  79   TYAAVVEQSSVAPPPGKVA------GFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFK  240
            T   VVE   V P PG +         SLPL +FDL WL   PV RL FY+   S +   
Sbjct  7    TSVKVVEVCRVTPQPGSLDSKAVTPNLSLPLTYFDLFWLRFPPVERLYFYESTSSPS---  63

Query  241  DTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFD  420
            D+++ +LKTSLS+ LQ++  LA  L  P D  TP    Y +GD V L  A SD ++  FD
Sbjct  64   DSVLENLKTSLSLVLQHFLPLAGNLTWPQDSDTPV-LTYVEGDAVSLTIAESDADN--FD  120

Query  421  CLSS-NHARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
             LSS      +++++PL+P L     R    A++VTLFP  G  +G   HH + DG +  
Sbjct  121  NLSSYGDFVEARDYHPLVPKLDVTHSRAAAIALQVTLFPSRGFVIGTTMHHAILDGKTST  180

Query  592  GFMKAW  609
             F+K+W
Sbjct  181  SFVKSW  186



>ref|XP_003560987.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Brachypodium distachyon]
Length=470

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 102/188 (54%), Gaps = 11/188 (6%)
 Frame = +1

Query  94   VEQSSVAP--PPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAV--SRTHFKDTIIPHL  261
            +EQ  V+P   P      +LPL FFDL +    PV RL FY +A       F    +P  
Sbjct  12   LEQRQVSPLPSPSGTKPRALPLTFFDLVFWDIPPVQRLFFYDNADVPGVPEFLLHELPRF  71

Query  262  KTSLSIALQYYPLLAAKLAVP--TDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
            + SL++AL ++  LA KL+    T  S  PE V+ DGD V L  A    +   F  L+ +
Sbjct  72   EKSLAMALHHFYPLAGKLSCGSITPESAAPELVFSDGDSVRLTVAAGAGDE--FHDLAGD  129

Query  436  HARNSKEFYPLIPTLP--SVR-RGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            HAR++    PL+P L    VR + +FAV++T+FP AG+C+G   HH V DGSS   FMK 
Sbjct  130  HARDTARLRPLLPRLTRDGVRLQDVFAVQITVFPHAGMCIGTTLHHAVADGSSYLHFMKT  189

Query  607  WTALSLLG  630
            W A+  LG
Sbjct  190  WAAIHRLG  197



>ref|XP_004507303.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Cicer 
arietinum]
Length=476

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 100/180 (56%), Gaps = 12/180 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGF----SLPLAFFDLKWLHGSPVHRLIFYQHAVSRT-HFKDTIIP  255
            +VE  ++ P       F    SLPL FFDL WL   PV RL FY+   + T  F D+I+P
Sbjct  9    IVEVCNIEPIHETTESFQSPTSLPLTFFDLLWLRFPPVERLFFYEFTKNSTISFYDSILP  68

Query  256  HLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
            +LK SLS+ LQ++  LA  +  P D S+ P   Y  GD V   F V++ NS  F  LSS+
Sbjct  69   NLKHSLSLTLQHFLPLAGNIIWPND-SSKPIINYVVGDSVS--FIVAESNSS-FKDLSSD  124

Query  436  HARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            H   S+  Y LIP L +   +  + +++VTLFP  G C+GI  HH   DG S   FMK+W
Sbjct  125  HCDASQR-YHLIPLLKTSYEKASLISIQVTLFPNFGFCIGITTHHAALDGKSSTTFMKSW  183



>gb|KDO65331.1| hypothetical protein CISIN_1g011670mg [Citrus sinensis]
Length=480

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 113/200 (57%), Gaps = 15/200 (8%)
 Frame = +1

Query  58   MAQSSPPTYAA-VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRT  231
            MA ++  +Y   VV++S V PP G V+  ++PL F D+ W+   P+ R+ FY+   +S  
Sbjct  1    MATAAESSYRVRVVDESHVGPPRGSVSPTTIPLTFLDMVWISIGPMQRIFFYEFPDISTP  60

Query  232  HFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSG  411
            HF   I P+LK SLS+ L+++   AA L  P      P   Y +GD V +  A SD +  
Sbjct  61   HFTQNIYPNLKHSLSLTLRHFFPFAANLTCPPP-PNHPYISYKEGDSVLVSVAESDYD--  117

Query  412  RFDCLSSNHARNSKEFYP-LIPTLPSVRR--------GMFAVKVTLFPEAGICVGIAYHH  564
             FD L++N AR++  F+  L+P LP+              AV+ T+FP +G  +GIA++H
Sbjct  118  -FDHLTANQARDNNAFHQSLVPKLPTPSLLSKETHAVPTMAVQFTVFPNSGFSIGIAFNH  176

Query  565  VVGDGSSIFGFMKAWTALSL  624
            V  DG S+  F+K+W ++S+
Sbjct  177  VAADGRSLNHFVKSWASMSV  196



>ref|XP_006490275.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Citrus sinensis]
Length=480

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 113/200 (57%), Gaps = 15/200 (8%)
 Frame = +1

Query  58   MAQSSPPTYAA-VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRT  231
            MA ++  +Y   VV++S V PP G V+  ++PL F D+ W+   P+ R+ FY+   +S  
Sbjct  1    MATAAESSYRVRVVDESHVGPPRGSVSPTTIPLTFLDMVWISIGPMQRIFFYEFPDISTP  60

Query  232  HFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSG  411
            HF   I P+LK SLS+ L+++   AA L  P      P   Y +GD V +  A SD +  
Sbjct  61   HFTQNIYPNLKHSLSLTLRHFFPFAANLTCPPP-PNHPYISYKEGDSVLVSVAESDYD--  117

Query  412  RFDCLSSNHARNSKEFYP-LIPTLPSVRR--------GMFAVKVTLFPEAGICVGIAYHH  564
             FD L++N AR++  F+  L+P LP+              AV+ T+FP +G  +GIA++H
Sbjct  118  -FDHLTANQARDNNAFHQSLVPKLPTPSLLSEETHAVPTMAVQFTVFPNSGFSIGIAFNH  176

Query  565  VVGDGSSIFGFMKAWTALSL  624
            V  DG S+  F+K+W ++S+
Sbjct  177  VAADGRSLNHFVKSWASMSV  196



>ref|XP_010102962.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
 gb|EXB94480.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Morus notabilis]
Length=475

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 111/191 (58%), Gaps = 11/191 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+EQ+ V PPPG V   SLPL F DL+WL    + R  FY+      HF +T++P LK+S
Sbjct  10   VIEQTKVFPPPGSVPTTSLPLTFLDLQWLLSHHMQRTYFYEFPHPINHFLETLLPSLKSS  69

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++   AA L  P   +  P  ++ DGD V L      +++  F+ L+++H R  
Sbjct  70   LSLTLQHFFPFAANLVCPPPPAR-PHILFTDGDSVSLTVV---ESTADFNFLTAHHPRPV  125

Query  451  KEFYPLIPTLPSVR-------RGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            K  YPL+P L   R         + A+++T+FP++GIC+G+ ++HVV DG ++  F+K+W
Sbjct  126  KALYPLVPKLAPARVEGDKRIEPLMALQLTVFPDSGICIGVRFNHVVADGKTLHHFLKSW  185

Query  610  TALSLLGHKSS  642
              +   G  S+
Sbjct  186  ALICKTGGDST  196



>gb|KJB79463.1| hypothetical protein B456_013G051200 [Gossypium raimondii]
Length=470

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 94/183 (51%), Gaps = 14/183 (8%)
 Frame = +1

Query  94   VEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSL  273
            VE S V+PPPG V   SLPL F DL W     V RL FY+      HF +TI+P LK SL
Sbjct  10   VESSHVSPPPGSVPTTSLPLTFLDLLWFPLPNVQRLFFYEFPYPTLHFMETILPLLKQSL  69

Query  274  SIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSK  453
            S+ LQ +   AA +  P      P   Y DG G  + F V +  S  F C  +++ R+ K
Sbjct  70   SLTLQQFFPFAANVVCPPSPGK-PYIRYEDG-GSSVAFTVVESPSD-FRCAIADYPRDLK  126

Query  454  EFYPLIPTLPS-----------VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
               P  P L +           V     A +VT+FP +G+C+G +Y HV+GDG +   FM
Sbjct  127  SLRPFAPELRTALSEAKDGTRVVLLPALAFQVTVFPNSGVCIGSSYCHVIGDGKAFMHFM  186

Query  601  KAW  609
            K+W
Sbjct  187  KSW  189



>gb|AGT37412.1| anthocyanin 5-aromatic acyltransferase [Vaccinium dunalianum]
Length=472

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 112/196 (57%), Gaps = 16/196 (8%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWL-----HGSPVHRLIFYQHAVSRTH  234
            +P     V+EQ  ++PPPG +   SLPL FFD+ WL       +P         + +  H
Sbjct  2    APSCKFKVLEQCKISPPPGTLPTTSLPLTFFDIPWLLFPPSQVNPFSFSSSQTTSSTTHH  61

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            F ++I+P+LK SLS+ LQ++  L A LA+P   +TP  F+Y   D   + F V++ N+  
Sbjct  62   FTNSILPNLKHSLSLTLQHFFPLTATLAMPPLPATP-HFLYTPADS-SVSFTVAESNAD-  118

Query  415  FDCLSSNHARNSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVV  570
            F  +S +H R+ +EF+ L+PTLP ++ G        + AV+VT+FP  GI VG+A+ HV 
Sbjct  119  FHHISGHHQRDVQEFHHLVPTLPQLKTGSYEHLSCPILAVQVTVFPHCGISVGLAFCHVA  178

Query  571  GDGSSIFGFMKAWTAL  618
             DG +   F+K W ++
Sbjct  179  ADGRAFNNFLKCWASI  194



>ref|XP_003541924.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2-like [Glycine max]
Length=468

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 101/195 (52%), Gaps = 11/195 (6%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MAQ        ++EQS VAPP G +    +PL F D+ WL      R+ FY      THF
Sbjct  1    MAQEMNEPAMNIIEQSQVAPPQGSLPSTIIPLTFLDIPWLLSRHARRIFFYDFPFPTTHF  60

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
              T +P LK SLS  LQ++   A+ L +P  +   P   Y +GD   L F V++ +   F
Sbjct  61   LQTALPILKHSLSHTLQHFFPFASNLILPP-HPHVPYIRYLEGDS--LSFTVAESSPADF  117

Query  418  DCLSSNHARNSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVG  573
              L+S+  R+S ++ PL P LPS R          + A++VT+ P +G  + + + HV G
Sbjct  118  TLLTSDSPRDSYDWQPLAPVLPSQRTSHDGTCEFPLMAIQVTMIPNSGFSICVIFDHVAG  177

Query  574  DGSSIFGFMKAWTAL  618
            DG ++  FMK W ++
Sbjct  178  DGRTLHHFMKFWASV  192



>ref|XP_008348091.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=460

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 104/184 (57%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTHFKDT  246
            + P+   VVE   VAP P      SLPL FFD+ WL   P+ R+ F++  + + + F D+
Sbjct  2    AEPSSIKVVEVCKVAPNPSSPDDQSLPLTFFDILWLRFPPIQRVFFFEIPSFNTSLFFDS  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            I+P LKTSLS+ LQ++  LA  L  P D  +PP   Y  G+ V L  A S  N+  +  +
Sbjct  62   ILPKLKTSLSVTLQHFVPLAGNLTWPQD--SPPIINYVKGNAVSLTIAES--NADFYHLV  117

Query  427  SSNH-ARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
            SSN  +  +KE++PLIP L     +  + A+++T FP  G  +G A HH V DG +   F
Sbjct  118  SSNSFSVEAKEYHPLIPHLAVSHDQAEVLALQITAFPTGGFSIGSAVHHAVLDGKTSTMF  177

Query  598  MKAW  609
            MK+W
Sbjct  178  MKSW  181



>ref|XP_002326110.2| anthocyanin acyltransferase family protein [Populus trichocarpa]
 gb|EEF00492.2| anthocyanin acyltransferase family protein [Populus trichocarpa]
Length=466

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 101/195 (52%), Gaps = 15/195 (8%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MAQS       V+++  V+PPPG V   SLPL FFD  W    P+ RL FY+      +F
Sbjct  1    MAQSHS---VKVIDRVQVSPPPGSVPTTSLPLTFFDFPWHLCPPMERLFFYELPYPTLYF  57

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
               I+P LK SLS+ALQ++  LA+ L  P      P  ++ DGD +P       +++  F
Sbjct  58   MHKILPSLKNSLSLALQHFFPLASNLMCPLS-PHKPYILFNDGDSIPFTIV---ESTMDF  113

Query  418  DCLSSNHARNSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVG  573
            D +  + A +    +  +P  P  R          + A++V +FP +GIC+G  + HVV 
Sbjct  114  DQIIGDQAGDVTGLHAFVPKWPPTRVTSDGKRVVPLLALQVVVFPNSGICIGTKFCHVVA  173

Query  574  DGSSIFGFMKAWTAL  618
            DG +   FMK+W ++
Sbjct  174  DGMAFNHFMKSWASI  188



>ref|XP_008357786.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=460

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 103/184 (56%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTHFKDT  246
            + P+   VVE    AP P      SLPL FFD+ WL   P+ R+ F++  + + + F D+
Sbjct  2    AEPSSIKVVEVCKAAPNPSSPDDQSLPLTFFDILWLRFPPIQRVFFFEIPSFNTSXFXDS  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            I+P LKTSLS+ LQ++  LA  L  P D  +PP   Y  G+ V L  A S  N+  +  +
Sbjct  62   ILPKLKTSLSVTLQHFVPLAGNLTWPQD--SPPIINYVKGNAVSLTIAES--NADFYHLV  117

Query  427  SSNH-ARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
            SSN  +  +KE++PLIP L     +  + A+++T FP  G  +G A HH V DG +   F
Sbjct  118  SSNSFSVEAKEYHPLIPHLAVSHDQAEVLALQITAFPTGGFSIGSAVHHAVLDGKTSTMF  177

Query  598  MKAW  609
            MK+W
Sbjct  178  MKSW  181



>ref|XP_007139438.1| hypothetical protein PHAVU_008G029400g [Phaseolus vulgaris]
 gb|AAR13301.1| anthocyanin acyltransferase [Phaseolus vulgaris]
 gb|ESW11432.1| hypothetical protein PHAVU_008G029400g [Phaseolus vulgaris]
Length=467

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 94/184 (51%), Gaps = 12/184 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            V+EQ  V+PPPG V   S+PL FFDL WL   P+ R+ FY    S  HF  T++P LK S
Sbjct  7    VIEQCEVSPPPGSVPSTSIPLTFFDLPWLCCPPLKRIFFYNFPYSTQHFFQTLLPTLKNS  66

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++   ++ L  P     PP  VY     V    A S   S  F  L S+  ++ 
Sbjct  67   LSLTLQHFFPFSSNLVFPPK-PNPPHIVYTQPHSVSFTVAQS---SADFITLVSDSPKDV  122

Query  451  KEFYPLIPTLP---SVRRGMF-----AVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
               +P +P LP   ++  G F     A++VT+ P +G  + I + H   DG +   FMK 
Sbjct  123  TALHPFVPVLPPPQTLEDGTFFIPIMAIQVTVMPHSGFTICITFRHAAADGRAFHHFMKF  182

Query  607  WTAL  618
            W ++
Sbjct  183  WASV  186



>gb|KEH25128.1| malonyl-CoA:isoflavone 7-O-glucoside malonyltransferase [Medicago 
truncatula]
Length=463

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 96/172 (56%), Gaps = 10/172 (6%)
 Frame = +1

Query  142  SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAV  321
            SLPL FFDL WL   PV  L FY+   S T F DT++P+LK SLS+ LQ++  LA  +  
Sbjct  31   SLPLTFFDLLWLRFPPVELLFFYELTNSTTFFYDTLLPNLKHSLSLTLQHFLPLAGNITW  90

Query  322  PTDYSTP-PEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLP--SVR  492
            P+D S P   +V GD     + F V +     F  LSS+H   SK  + LIP L     +
Sbjct  91   PSDSSKPIINYVKGDNS---ISFNVVESKES-FKDLSSHHCEASKRHH-LIPHLKISHEK  145

Query  493  RGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWT--ALSLLGHKSS  642
              + A++VTLFP  G C+GI  HH   DG S+  FMK+W+  A S   H SS
Sbjct  146  ASLLAIQVTLFPNNGFCIGITTHHAALDGKSLSTFMKSWSYVACSNSKHDSS  197



>ref|XP_004507302.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Cicer arietinum]
Length=503

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 102/192 (53%), Gaps = 17/192 (9%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGF----SLPLAFFDLKWLHGSPVHRLIFYQHAVS  225
            MAQ      + +VE  ++ P       F    SLPL FFDL WL   PV RL FY+   +
Sbjct  1    MAQEES---SKIVEVCNIEPIHETTESFQSPTSLPLTFFDLLWLRFPPVERLFFYEFTKN  57

Query  226  RT-HFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPP-EFVYGDGDGVPLVFAVSD  399
             T  F D+I+P+LK SLS+ LQ++  LA  +  P D S P   +V GD     +V     
Sbjct  58   STISFYDSILPNLKHSLSLTLQHFLPLAGNIIWPNDSSKPIINYVLGDSVSFTVV-----  112

Query  400  DNSGRFDCLSSNHARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVG  573
            ++   F  LSSNH   S+  Y LIP L +   +  + +++VTLFP  G C+GI  HH   
Sbjct  113  ESKASFKDLSSNHCDASQR-YHLIPLLKTSHEKASLVSIQVTLFPNFGFCIGITTHHATF  171

Query  574  DGSSIFGFMKAW  609
            DG+S   FMK+W
Sbjct  172  DGNSSTIFMKSW  183



>gb|KCW47095.1| hypothetical protein EUGRSUZ_K00901 [Eucalyptus grandis]
Length=463

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 96/183 (52%), Gaps = 10/183 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++ +  ++PPP  V   +LPLAF D+ WL   P+ RL FY    S + F  T +P L  S
Sbjct  16   ILHRYDISPPPDSVPATTLPLAFLDIPWLLCCPMQRLFFYDFPESPSSFAQTTLPLLVRS  75

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L+++   AA L +P      P  +Y +GD +    A S  N   F  L S+    +
Sbjct  76   LSLCLRHFFPFAASLVLPLAPPQKPHILYSNGDSLSFTVAESAAN---FAELISDELHGA  132

Query  451  KEFYPLIPTL--PSVRRG-----MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
               +PL+P L  P    G     + A++VTLFP  GIC+G+ + HVV DG S   FM +W
Sbjct  133  TLIHPLVPQLAPPCASDGARIGPVMAIQVTLFPNKGICIGVQFLHVVADGRSFTHFMNSW  192

Query  610  TAL  618
             ++
Sbjct  193  ASI  195



>ref|XP_012076156.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Jatropha 
curcas]
 gb|KDP34386.1| hypothetical protein JCGZ_12780 [Jatropha curcas]
Length=459

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 102/197 (52%), Gaps = 7/197 (4%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHA-VSRTH  234
            MA S       V + S     P     FSLPL FFDL WL   PV RL FYQ   ++   
Sbjct  1    MASSHSTKVLDVCQISPTFDSPESATEFSLPLTFFDLFWLRFPPVERLFFYQLTDLTPAF  60

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            F   I+P LK SLS+ L  Y  LA  L  P + S  P  +Y    GV L  A SD ++  
Sbjct  61   FNSVILPKLKHSLSLTLVLYLPLAGHLTWPPN-SPKPIILYTPSTGVLLTVAESDADT--  117

Query  415  FDCLSSNHARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
             D L S+  + + E +P +P LP+   R  + A+++TLFP  G  +G + +H V DG S+
Sbjct  118  -DHLWSDEIQVATELHPYVPKLPASETRSSVIALQITLFPNKGFSIGYSINHAVLDGQSV  176

Query  589  FGFMKAWTALSLLGHKS  639
              FMKAW+ +S  G +S
Sbjct  177  TMFMKAWSYISKHGERS  193



>ref|XP_002518001.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
 gb|EEF44519.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
Length=459

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 100/184 (54%), Gaps = 12/184 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            +V    ++PP   V    LPL FFD+ W    P+ RL F++   S  +F   ++P+L  S
Sbjct  5    IVHHFQISPPLASVPTTCLPLTFFDMPWFLCRPMQRLFFFEFPYSTCYFIHNLLPNLSHS  64

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++  L+A L  P      P F++ DGD +P   A S D+   F  + +N+ ++ 
Sbjct  65   LSLTLQHFFPLSANLICPPP-PLQPYFLFKDGDSIPFTVAESLDD---FIQVITNNPKDV  120

Query  451  KEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            +  +P +P LP  R          + A++VTLFP +GI +G  + HVV DG +I  FMK+
Sbjct  121  RVLHPYVPKLPPSRLTSDGTRSVPLLALQVTLFPNSGISIGFEFCHVVADGMAINHFMKS  180

Query  607  WTAL  618
            W +L
Sbjct  181  WASL  184



>ref|XP_006370740.1| hypothetical protein POPTR_0001s45940g [Populus trichocarpa]
 gb|ERP67309.1| hypothetical protein POPTR_0001s45940g [Populus trichocarpa]
Length=415

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 102/190 (54%), Gaps = 11/190 (6%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPP---PGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHA-VS  225
            MA +SP     V+E   + PP   P      SLPL FFD+ WL   PV R+  Y+ + ++
Sbjct  1    MASTSP---IKVLESCQLTPPSESPDSAVEVSLPLTFFDIFWLKFDPVERIFSYELSDLT  57

Query  226  RTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDN  405
             T F   I+P LK SLS+ L  +  LA  L  P+ ++  P  +Y   DGV L  A S+ N
Sbjct  58   PTMFNTEILPKLKHSLSLTLLRFLPLAGNLTWPS-HAAKPIILYTPKDGVSLTVAESN-N  115

Query  406  SGRFDCLSSNHARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDG  579
            S  FD LSSN   ++   +P +P L +  V+  + A+++TLFP  G  +G   HH V DG
Sbjct  116  SADFDDLSSNEMHDAFLSHPYVPKLSTSDVKVSIIALQITLFPNKGFSIGCTTHHAVLDG  175

Query  580  SSIFGFMKAW  609
             S   FMKAW
Sbjct  176  KSSILFMKAW  185



>gb|EAZ03602.1| hypothetical protein OsI_25739 [Oryza sativa Indica Group]
Length=468

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 103/189 (54%), Gaps = 10/189 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAG--FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRT--HFKDTIIPH  258
            V+EQ  V+P P   AG   SLPL FFDL +L   PV RL FY +A  R    F    +P 
Sbjct  12   VLEQCHVSPSPAPAAGQPRSLPLTFFDLVFLDFPPVQRLFFYDNADLRDAHDFLLRELPL  71

Query  259  LKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             + SL+ AL  +YPL         +  +PPE  Y DGD V L  AVS D+   F  L+ +
Sbjct  72   FRESLAAALHHFYPLAGTLPCGIRERVSPPEVAYSDGDSVRLTVAVSSDD---FQDLAGD  128

Query  436  HARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            H R++    PL+P LP       + AV+VT+FP AGIC+G   HH V DGSS   F+K W
Sbjct  129  HPRDTARLRPLLPPLPKHGSSHDVLAVQVTVFPRAGICIGTTLHHAVADGSSYVHFLKTW  188

Query  610  TALSLLGHK  636
             A+  LG +
Sbjct  189  AAIHRLGDE  197



>gb|KHN36592.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
[Glycine soja]
Length=468

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 100/195 (51%), Gaps = 11/195 (6%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MAQ        ++EQS VAPP G +     PL F D+ WL      R+ FY      THF
Sbjct  1    MAQEMNEPAMNIIEQSQVAPPQGSLPSTITPLTFLDIPWLLSRHARRIFFYDFPFPTTHF  60

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
              T +P LK SLS  LQ++   A+ L +P  +   P   Y +GD   L F V++ +   F
Sbjct  61   LQTALPILKHSLSHTLQHFFPFASNLILPP-HPHVPYIRYLEGDS--LSFTVAESSPADF  117

Query  418  DCLSSNHARNSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVG  573
              L+S+  R+S ++ PL P LPS R          + A++VT+ P +G  + + + HV G
Sbjct  118  TLLTSDSPRDSYDWQPLAPVLPSQRTSHDGTCEFPLMAIQVTMIPNSGFSICVIFDHVAG  177

Query  574  DGSSIFGFMKAWTAL  618
            DG ++  FMK W ++
Sbjct  178  DGRTLHHFMKFWASV  192



>ref|XP_002298991.2| hypothetical protein POPTR_0001s45940g [Populus trichocarpa]
 gb|EEE83796.2| hypothetical protein POPTR_0001s45940g [Populus trichocarpa]
Length=442

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 102/190 (54%), Gaps = 11/190 (6%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPP---PGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHA-VS  225
            MA +SP     V+E   + PP   P      SLPL FFD+ WL   PV R+  Y+ + ++
Sbjct  1    MASTSP---IKVLESCQLTPPSESPDSAVEVSLPLTFFDIFWLKFDPVERIFSYELSDLT  57

Query  226  RTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDN  405
             T F   I+P LK SLS+ L  +  LA  L  P+ ++  P  +Y   DGV L  A S+ N
Sbjct  58   PTMFNTEILPKLKHSLSLTLLRFLPLAGNLTWPS-HAAKPIILYTPKDGVSLTVAESN-N  115

Query  406  SGRFDCLSSNHARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDG  579
            S  FD LSSN   ++   +P +P L +  V+  + A+++TLFP  G  +G   HH V DG
Sbjct  116  SADFDDLSSNEMHDAFLSHPYVPKLSTSDVKVSIIALQITLFPNKGFSIGCTTHHAVLDG  175

Query  580  SSIFGFMKAW  609
             S   FMKAW
Sbjct  176  KSSILFMKAW  185



>ref|XP_008379435.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
 ref|XP_008357918.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=519

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 98/176 (56%), Gaps = 13/176 (7%)
 Frame = +1

Query  139  FSLPLAFFDLKWLHGSPVHRLIFYQH------AVSRTHFKDTIIPHLKTSLSIALQYYPL  300
             SLPL  FDL W+   P HRL+FY+       A +   F  TIIP LKTSLSI LQ++  
Sbjct  59   LSLPLTLFDLLWIRFPPFHRLLFYEILPCSSPADTLLFFHSTIIPKLKTSLSITLQHFLP  118

Query  301  LAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR-NSKEFYPLIPT  477
            LA  +  P + S  P   Y  GD + L  + SD +   F  LSSN  +  SKE+YPL+P 
Sbjct  119  LAGNITWPEN-SHKPTLDYVQGDTLSLTVSESDAD---FHHLSSNDFKIESKEYYPLVPQ  174

Query  478  LP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLLGHKS  639
            L     +  + A+++T+FP  G  +GI+ HH   DG ++F F+K+W  +    H+S
Sbjct  175  LAVSHEKAAVMALQITIFPSGGFSIGISMHHAAIDGKTLFLFLKSWAHICKHVHQS  230



>ref|XP_010035654.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Eucalyptus grandis]
 gb|KCW47097.1| hypothetical protein EUGRSUZ_K00903 [Eucalyptus grandis]
Length=488

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 96/183 (52%), Gaps = 10/183 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++ +  ++PP   V   +LPL FFD+ WL  SP+ RL FY    S   F  T +P L  S
Sbjct  6    ILHRYDISPPANSVPTTTLPLTFFDIPWLLFSPMRRLFFYDFPQSPESFTQTTLPLLVRS  65

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ L  +   A+ L +P      P  +Y DGD + L  A   +++  F  L SN   ++
Sbjct  66   LSLCLCRFFPFASSLVLPLAPPQKPYILYSDGDSLSLTVA---ESAADFTDLVSNEPHDA  122

Query  451  KEFYPLIPTLPSVRRG-------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
               +PL+P LP  R         + A++VT+F   GIC+G+ + HVV DG S   FMK+W
Sbjct  123  TLIHPLVPQLPPPRASDGARVGPLMAIQVTVFRNKGICIGVQFLHVVADGRSFTHFMKSW  182

Query  610  TAL  618
             ++
Sbjct  183  ASI  185



>ref|XP_002892187.1| transferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68446.1| transferase [Arabidopsis lyrata subsp. lyrata]
Length=464

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 103/196 (53%), Gaps = 13/196 (7%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA   PP    ++E   ++P  G V   +LPL FFD  WL       L F+ +  S   F
Sbjct  1    MAHPQPPN---IIETCHISPTTGTVPSTTLPLTFFDAPWLTLPLADSLFFFSYQNSTESF  57

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
                +P+LK SLSI+LQ++   A KL +P+    PP   Y DG+   LVF V++     F
Sbjct  58   LKDFVPNLKQSLSISLQHFFPYAGKLIIPS-RPDPPYLQYNDGED-SLVFTVAESTETDF  115

Query  418  DCLSSNHARNSKEFYPLIPTLPS--------VRRGMFAVKVTLFPEAGICVGIAYHHVVG  573
            + L ++  ++ +  + ++P LP           R + A++VT+FP AGIC+G +  HVV 
Sbjct  116  NQLKTDSPKDIRVLHGVLPKLPPPHVSPEGIQMRPIMAMQVTIFPGAGICIGNSATHVVA  175

Query  574  DGSSIFGFMKAWTALS  621
            DG +   FMK W +L+
Sbjct  176  DGVTFSHFMKYWMSLT  191



>ref|XP_002527623.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
 gb|EEF34762.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
Length=474

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 92/182 (51%), Gaps = 10/182 (5%)
 Frame = +1

Query  85   AAVVEQSSVAPP---PGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHA-VSRTHFKDTII  252
            A + E + V P    P      SLPL FFD+ WL   PV RL FYQH  ++ T F   ++
Sbjct  2    AKIFEVARVTPSTHSPESATELSLPLTFFDVYWLKFHPVERLFFYQHTDLTLTFFNSVLV  61

Query  253  PHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFV-YGDGDGVPLVFAVSDDNSGRFDCLS  429
            P LK SLS AL +Y   A  +  P D   P  F+ Y   DGV +  A S  +   F  LS
Sbjct  62   PKLKQSLSHALLHYLPFAGSITWPEDQHAPKPFILYTPNDGVSVTVAESYQD---FFHLS  118

Query  430  SNHARNSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
             N  R + E    +P LP    +    A ++TLFP  G  +G++ HH + DG S+  FMK
Sbjct  119  GNQIRKTIESSAYVPELPVSDSKAATIAFQITLFPNQGFAIGVSSHHAIFDGKSVTMFMK  178

Query  604  AW  609
            AW
Sbjct  179  AW  180



>ref|XP_011038069.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Populus 
euphratica]
Length=489

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 101/190 (53%), Gaps = 11/190 (6%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPP---PGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHA-VS  225
            MA +SP     V+E   + PP   P      SLPL FFD+ WL   PV R+  Y+   ++
Sbjct  23   MASTSP---IKVLESCQLTPPSESPDSAVEVSLPLTFFDIFWLKFDPVERIFSYELTDLT  79

Query  226  RTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDN  405
             T F   I+P LK SLS+ L  +  LA  L  P+ ++  P  +Y   DGV L  A S+ N
Sbjct  80   LTMFNTEILPKLKHSLSLTLLRFLPLAGNLTWPS-HAAKPIILYTPKDGVSLTVAESN-N  137

Query  406  SGRFDCLSSNHARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDG  579
            S  FD LSSN   ++   +P +P L +  V+  + A+++TLFP  G  +G   HH V DG
Sbjct  138  SADFDDLSSNEMHDAFLSHPYVPKLSTSDVKVSIIALQITLFPNKGFSIGCTAHHAVLDG  197

Query  580  SSIFGFMKAW  609
             S   FMKAW
Sbjct  198  KSSILFMKAW  207



>ref|XP_008361942.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Malus 
domestica]
Length=460

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 103/184 (56%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTHFKDT  246
            + P+   VVE    AP P      SLPL FFD+ WL   P+ R+ F++  + + + F D+
Sbjct  2    AEPSSIKVVEVCKXAPNPSSPDDQSLPLTFFDILWLRFPPIQRVFFFEIPSFNTSLFFDS  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            I+P LKTSLS+ LQ++  LA  L  P D  +PP   Y  G+ V L  A S  N+  +  +
Sbjct  62   ILPKLKTSLSVTLQHFVPLAGNLTWPQD--SPPIINYVKGNAVSLTIAES--NADFYHLV  117

Query  427  SSNH-ARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
            SSN  +  +KE++PLIP L     +  + A+++T FP  G  +G A HH V DG +   F
Sbjct  118  SSNSFSVEAKEYHPLIPHLAVSHDQAEVLALQITAFPTGGFSIGSAVHHAVLDGKTSTMF  177

Query  598  MKAW  609
            MK+W
Sbjct  178  MKSW  181



>ref|XP_009365921.1| PREDICTED: LOW QUALITY PROTEIN: phenolic glucoside malonyltransferase 
2-like [Pyrus x bretschneideri]
Length=474

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 97/190 (51%), Gaps = 14/190 (7%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKVAGF--------SLPLAFFDLKWLHGSPVHRLIFYQ--HAVS  225
            P    VVE   VAP P  +A          SLPL FFDL WL  SPV R  FY+  H  S
Sbjct  4    PNSVKVVEVCKVAPQPRSLADSATPPPPPESLPLTFFDLLWLRFSPVQRHFFYEINHNSS  63

Query  226  RTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDN  405
                   +IP L+ SLSIAL+++  LA  +  P + S  P   Y  GD V L  A SD +
Sbjct  64   NXFSDSVLIPKLRASLSIALRHFLPLAGNVIWPQN-SPKPILSYVQGDTVSLTIAESDAD  122

Query  406  SGRFDCLSSNHARNSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDG  579
                   S+N    ++E++PL P L     R    AV+VT+FP  G C+G + HHV+ DG
Sbjct  123  FCHL-VSSNNFNIKAEEYHPLTPQLAVSHERAAAVAVQVTIFPNRGFCIGTSIHHVILDG  181

Query  580  SSIFGFMKAW  609
            S+   F+K W
Sbjct  182  STSTMFVKLW  191



>ref|XP_003543364.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Glycine max]
Length=469

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 99/184 (54%), Gaps = 11/184 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++EQS V PPP  +   +LPL FFD+ W +  P+ R+ FY       HF  T +P LK S
Sbjct  6    ILEQSEVGPPPCSLPSTTLPLTFFDIPWFYCHPIQRIFFYDFPHPTHHFLQTALPILKHS  65

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++   ++ L VP          Y DGD +    A   +++  F  L+S+  ++ 
Sbjct  66   LSLTLQHFFPFSSNLIVPPQQPHLSHIRYLDGDSLSFTVA---ESTADFTLLTSDSPQDV  122

Query  451  KEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
              ++PL+P  P+ R          + A++VT+FP++G  + + ++H+  DG S+  F+K 
Sbjct  123  PNWHPLVPAFPTPRVDQDGARVFPLMAIQVTIFPKSGFTICLTFNHLASDGKSLHHFIKF  182

Query  607  WTAL  618
            W +L
Sbjct  183  WASL  186



>gb|KJB11558.1| hypothetical protein B456_001G265700 [Gossypium raimondii]
Length=471

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 97/190 (51%), Gaps = 10/190 (5%)
 Frame = +1

Query  91   VVEQSSVAP---PPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTIIPH  258
            ++E + VAP    P     F LPL F D+ W    PV RL FYQ   ++   F   I+P 
Sbjct  14   ILEVTQVAPTSNSPESTTEFRLPLTFSDILWFTSPPVERLFFYQLDELTPACFNSVILPK  73

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            LK SLS+ L +Y  LA  L  P +    P  +Y   DGV L  A SD +   F+ LSS+ 
Sbjct  74   LKRSLSLTLVHYLPLAGNLKWPPN-EPKPIILYTPNDGVSLTVAHSDAD---FNILSSDG  129

Query  439  ARNSKEFYPLIPTL--PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWT  612
              ++ E +PL P L    V     AV+VTLFP  G C+GI  HH V DG +   F+K+W 
Sbjct  130  VYDAAELHPLKPDLVTSDVSASAIAVQVTLFPNKGFCIGITAHHAVLDGQTTTMFIKSWA  189

Query  613  ALSLLGHKSS  642
             +   G+  +
Sbjct  190  HICKQGNDEN  199



>ref|XP_007149905.1| hypothetical protein PHAVU_005G108800g [Phaseolus vulgaris]
 gb|ESW21899.1| hypothetical protein PHAVU_005G108800g [Phaseolus vulgaris]
Length=473

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 107/185 (58%), Gaps = 14/185 (8%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E+  V+PPP  V   +LPL FFD+ W   + + R+ FYQ      HF  T +P LK S
Sbjct  12   IIERCQVSPPPNCVPSTTLPLTFFDIPWFFCNSIQRIFFYQFPHPTHHFLQTALPILKHS  71

Query  271  LSIALQYYPLLAAKLAVPTD-YSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS++LQ++   A+ L VP   + +   +++GD     L F V+ +++  F  L+S+  ++
Sbjct  72   LSLSLQHFFPFASNLIVPPQLHLSHIRYLHGDS----LSFTVA-ESTADFTLLTSHSPQD  126

Query  448  SKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMK  603
             + ++PL+PTLP+ R          + A++VT+FP +G  + + ++H  GDG S+  F+K
Sbjct  127  VRNWHPLLPTLPTPRLEQDGTRVFPLMAIQVTVFPNSGFSICLTFNHFAGDGKSLHHFIK  186

Query  604  AWTAL  618
             W +L
Sbjct  187  FWASL  191



>gb|KGN65692.1| hypothetical protein Csa_1G499330 [Cucumis sativus]
Length=462

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 90/160 (56%), Gaps = 8/160 (5%)
 Frame = +1

Query  154  AFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDY  333
             FFD+ WL   P+ RL FY+ + +   F D I+P LK+SLS+ L +Y  LA  L  P+  
Sbjct  30   TFFDVLWLRVHPIQRLFFYEFSSNEISFYDIIVPKLKSSLSLTLCHYLPLAGNLIWPSQS  89

Query  334  STPP-EFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSV--RRGMF  504
             TP  EFV  +GDGV +  A SDD+   F  LS N  R   +F+PL+P L +   R  + 
Sbjct  90   DTPVIEFV--NGDGVSMTVAESDDD---FYHLSGNGFRKVSKFHPLVPQLSTSHDRAAIV  144

Query  505  AVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSL  624
            A++VT F   G  +GI  HH + DG S   F+K+W  + +
Sbjct  145  AIQVTKFQNKGFSIGITNHHAILDGRSSTSFIKSWAQICI  184



>gb|ACU20547.1| unknown [Glycine max]
Length=199

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 88/158 (56%), Gaps = 7/158 (4%)
 Frame = +1

Query  142  SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAV  321
            SLPL FFDL WL   PV RL FY+       F DTI+P+LK SLS+ LQ++ LLA  +  
Sbjct  31   SLPLTFFDLLWLRSPPVERLFFYEFPNQTISFFDTILPNLKHSLSLTLQHFLLLAGTITW  90

Query  322  PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRR--  495
            P D S  P   Y  G+ V L  A S+++   F+ L SN    S    PLIP L +     
Sbjct  91   PLD-SPHPIINYVPGNVVSLTIAESNND---FNVLCSNTCDASLR-NPLIPHLNTSNEEA  145

Query  496  GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
             + A+++TL P  G C+GI+ HH   DG +   F+KAW
Sbjct  146  SVMALQLTLIPNHGFCLGISTHHAAMDGKASTLFLKAW  183



>ref|XP_007139473.1| hypothetical protein PHAVU_008G032400g [Phaseolus vulgaris]
 gb|ESW11467.1| hypothetical protein PHAVU_008G032400g [Phaseolus vulgaris]
Length=483

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 100/179 (56%), Gaps = 11/179 (6%)
 Frame = +1

Query  97   EQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTH---FKDTIIPHLKT  267
            +Q  VAPP       SLPL FFD+ WL   PV R+ FY   ++ ++   F   ++P LKT
Sbjct  10   QQCRVAPPSAPQT--SLPLVFFDMFWLRFHPVERIFFYTLPITHSNPSIFFTQVVPKLKT  67

Query  268  SLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            SLS  LQ++P LA  + V +D S+ P   Y  GD V +V A S+ +   FD    N  + 
Sbjct  68   SLSHTLQHFPPLAGNV-VWSDSSSKPVVQYTPGDAVSVVLAESEAD---FDHALDNAPKE  123

Query  448  SKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTAL  618
            + E   L+P L S+  R  + A+++TLFP  G  +GI+ HH V DG S   F+KAW +L
Sbjct  124  ASESRCLVPHLESLDSRASVMALQITLFPNRGFAIGISTHHAVLDGKSSTLFLKAWASL  182



>gb|KEH25127.1| malonyl-CoA:isoflavone 7-O-glucoside malonyltransferase [Medicago 
truncatula]
Length=463

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 93/162 (57%), Gaps = 7/162 (4%)
 Frame = +1

Query  142  SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAV  321
            SLPL FFDL WL   PV RL FY+   S T F +T++P+LK SLS+ LQ++  LA  +  
Sbjct  31   SLPLTFFDLLWLRFPPVERLFFYEFTNSPTFFYETLLPNLKHSLSLTLQHFLPLAGNIIW  90

Query  322  PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSV--RR  495
            P+D S+ P   Y  GD V      S ++   F  LSSN     K  + LIP L +   + 
Sbjct  91   PSD-SSKPIINYVKGDFVSFNVVESKES---FKNLSSNQCEALKRHH-LIPLLNTSHEKA  145

Query  496  GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
             + ++++TLFP  G C+GI+ HH   DG S   FMK+W+ ++
Sbjct  146  SLISIQITLFPNNGFCIGISSHHAALDGKSSTTFMKSWSYIA  187



>gb|KEH18149.1| anthocyanin 5-aromatic acyltransferase [Medicago truncatula]
Length=477

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 101/187 (54%), Gaps = 13/187 (7%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFS-LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
            V+E+S VAPPPG V   + LPL F D+ W     + R+ FY       HF  TI+P LK 
Sbjct  5    VIEKSEVAPPPGLVPSPTILPLTFLDIPWFCCRTIKRIFFYHFPHPTHHFLQTILPILKH  64

Query  268  SLSIALQYYPLLAAKLAVPT-DYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
            SLSI L+++   ++ L +P+   + PP   Y +GD +    A S  N   F+ L S+ ++
Sbjct  65   SLSITLEHFFPYSSNLIIPSHSENVPPYIRYLNGDSLSFTIAESLAN---FNLLISDSSQ  121

Query  445  NSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFM  600
            + K  +P  P LPS            + A++VT+ P +G  + + ++H+ GDG S+  FM
Sbjct  122  DVKNLHPFFPNLPSPHTEHNDTRVVPLMAIQVTILPNSGFAICLTFNHIAGDGKSLHQFM  181

Query  601  KAWTALS  621
            K W+ +S
Sbjct  182  KLWSYVS  188



>ref|NP_001059455.1| Os07g0414000 [Oryza sativa Japonica Group]
 dbj|BAC84105.1| anthocyanin 5-aromatic acyltransferase-like protein [Oryza sativa 
Japonica Group]
 dbj|BAF21369.1| Os07g0414000 [Oryza sativa Japonica Group]
Length=468

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 104/189 (55%), Gaps = 10/189 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAG--FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRT--HFKDTIIPH  258
            V+EQ  V+P P   AG   SLPL FFDL +L   PV RL FY +A  R    F    +P 
Sbjct  12   VLEQCHVSPSPAPAAGQPRSLPLTFFDLVFLDFPPVQRLFFYDNADLRDAHDFLLRELPL  71

Query  259  LKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             + SL+ AL  +YPL+        +  +PPE  Y DG  V L  AVS D+   F  L+ +
Sbjct  72   FRESLAAALHHFYPLVGKLPCGIRERMSPPEVAYSDGYSVCLTVAVSSDD---FQDLAGD  128

Query  436  HARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            H R++    PL+P LP     + + AV+VT+FP AGICVG   HH V DGSS   F+K W
Sbjct  129  HPRDTARLRPLLPPLPKHGSSQDVLAVQVTVFPRAGICVGTTLHHAVADGSSYVHFLKTW  188

Query  610  TALSLLGHK  636
             A+  LG +
Sbjct  189  AAIHRLGDE  197



>ref|XP_009365888.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Pyrus 
x bretschneideri]
Length=460

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 103/184 (56%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTHFKDT  246
            + P+   VVE   VAP P      SLPL FFD+ WL   P+ R+ F++  + + + F D+
Sbjct  2    AEPSSIKVVEVCKVAPNPSSPDDQSLPLTFFDILWLRFPPIQRVFFFEIPSFNTSLFFDS  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            I+P LKTSLS+ LQ++  LA  L  P D  +PP   Y  GD V L  A S  N+  +  +
Sbjct  62   ILPKLKTSLSVTLQHFVPLAGNLTWPQD--SPPIINYVKGDAVSLTIAES--NADFYHLV  117

Query  427  SSNH-ARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
            SSN  +  +KE++ LIP L     +  + A+++T FP  G  +G A HH + DG +   F
Sbjct  118  SSNSFSVEAKEYHTLIPHLAVSHDQAEVLALQITAFPTGGFSIGSAVHHAILDGKTSTMF  177

Query  598  MKAW  609
            +K+W
Sbjct  178  IKSW  181



>ref|XP_011047482.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1-like [Populus euphratica]
Length=466

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 101/196 (52%), Gaps = 16/196 (8%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA S P     V++   V+PP G V   SLPL FFD  WL   P+ RL FY+      + 
Sbjct  1    MALSHP---VKVIDHFRVSPPLGSVPTTSLPLTFFDFPWLLCRPMERLFFYEFPYPTLYL  57

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
             + I+P LK SLS+ LQ++  LA+ L  P      P  ++ DGD +P     S  +   F
Sbjct  58   TNNILPILKNSLSLTLQHFFPLASNLMCPPS-PHKPYILFKDGDSIPFTVVESMLD---F  113

Query  418  DCLSSNHAR-NSKEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVV  570
            D +  +HAR + +E    +P  P  R          + A++V +FP +GIC+G  + HVV
Sbjct  114  DQVIGDHARVDLRELQCFVPKWPPTRVTLDGKRVVPLLALQVAVFPNSGICIGAKFCHVV  173

Query  571  GDGSSIFGFMKAWTAL  618
             DG +   FMK+W ++
Sbjct  174  ADGMAFSHFMKSWASV  189



>ref|XP_009111796.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase 
[Brassica rapa]
Length=450

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 102/190 (54%), Gaps = 19/190 (10%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTH  234
            M QSSP     ++E   V+PPP      +LPL FFDL WL   PV RL+FY+   +SR+ 
Sbjct  1    MVQSSP--TVNILEVVRVSPPPSD--SITLPLTFFDLGWLKLHPVDRLLFYRVPELSRS-  55

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLA-VPTDYSTPPEFVYGDGDGVPLVFAVSDDNSG  411
                +I  LK+SLS  L +Y  LA +L   PTD  T P  VY   +   +   V++ N G
Sbjct  56   ---VLISKLKSSLSATLHHYLPLAGRLVWNPTD--TKPSIVYSPDEKDAVYVTVAESN-G  109

Query  412  RFDCLSSNHARNSKEFYPLIPTLP----SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDG  579
                L+ N  R + EF+PL+P LP    S R    AV++T FP  G  +G+  HH V DG
Sbjct  110  DITRLTGNEPRTATEFHPLVPELPVSDESAR--ALAVQITFFPNQGFSLGVTAHHAVLDG  167

Query  580  SSIFGFMKAW  609
             +   F+KAW
Sbjct  168  KTTAMFLKAW  177



>ref|NP_171890.1| coumaroyl-CoA:anthocyanidin 3-O-glucoside-6"-O-coumaroyltransferase 
1 [Arabidopsis thaliana]
 sp|Q9ZWB4.1|3AT1_ARATH RecName: Full=Coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
1 [Arabidopsis thaliana]
 gb|AAD10676.1| Hypothetical protein [Arabidopsis thaliana]
 gb|AEE27636.1| coumaroyl-CoA:anthocyanidin 3-O-glucoside-6'-O-coumaroyltransferase 
1 [Arabidopsis thaliana]
Length=469

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 100/196 (51%), Gaps = 13/196 (7%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            +A   PP    ++E   ++PP G V   +LPL FFD  WL       L F+ +  S   F
Sbjct  2    VAHLQPP---KIIETCHISPPKGTVPSTTLPLTFFDAPWLSLPLADSLFFFSYQNSTESF  58

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
                +P+LK SLSI LQ++   A KL +P     PP   Y DG    LVF V++     F
Sbjct  59   LQDFVPNLKHSLSITLQHFFPYAGKLIIPP-RPDPPYLHYNDGQD-SLVFTVAESTETDF  116

Query  418  DCLSSNHARNSKEFYPLIPTLPS--------VRRGMFAVKVTLFPEAGICVGIAYHHVVG  573
            D L S+  ++    + ++P LP           R + A++VT+FP AGIC+G +  HVV 
Sbjct  117  DQLKSDSPKDISVLHGVLPKLPPPHVSPEGIQMRPIMAMQVTIFPGAGICIGNSATHVVA  176

Query  574  DGSSIFGFMKAWTALS  621
            DG +   FMK W +L+
Sbjct  177  DGVTFSHFMKYWMSLT  192



>ref|XP_007032768.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY03694.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=466

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 92/177 (52%), Gaps = 7/177 (4%)
 Frame = +1

Query  121  PGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTIIPHLKTSLSIALQYYP  297
            P   A  SLPL FFD+ W    PV RL FYQ +  +  +F    +P LK SLS+ L +Y 
Sbjct  22   PKSAAELSLPLTFFDIYWFKLPPVERLFFYQLNNSTPAYFNSVTLPKLKHSLSLTLLHYL  81

Query  298  LLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPT  477
             LA  L  P+  S  P  +Y   DGV L  A   +++  F+ LSSN    + E +PL P 
Sbjct  82   PLAGNLKWPS-TSPKPIILYTPDDGVSLTVA---ESAADFNLLSSNGIYEAVELHPLKPA  137

Query  478  LPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLLGHKSS  642
            L +        A+++TLFP  G C+GI  HH V DG +   FMK+W  L   G+  +
Sbjct  138  LVTSDDSASTIALQITLFPNMGFCIGITAHHAVLDGKTTTSFMKSWAYLCNQGYTEN  194



>ref|XP_008348092.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=465

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 94/179 (53%), Gaps = 11/179 (6%)
 Frame = +1

Query  91   VVEQSSVAP----PPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPH  258
            VVE   VAP    P       SLPL FFD++WL   PV RL FYQ  +S +     +   
Sbjct  9    VVEACRVAPHPTSPDSTALPTSLPLTFFDIRWLRFQPVQRLYFYQ--ISTSFDTKLLFSK  66

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            LKTSLSI LQ++  LA  L  P + S  P   Y +GD V L  A +D +  R    S N 
Sbjct  67   LKTSLSITLQHFLPLAGNLTWPQE-SPKPTLNYVEGDAVSLTVAETDADFYRLS--SDND  123

Query  439  ARNSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
               ++E++PL+P LP    +  + A++VT+FP  G  +G   HH   DG S   F+K+W
Sbjct  124  FLEAQEYHPLVPQLPVSHEKAAIMALQVTIFPNKGFSIGTTMHHAXLDGKSSTTFVKSW  182



>emb|CBI18015.3| unnamed protein product [Vitis vinifera]
Length=499

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 89/155 (57%), Gaps = 12/155 (8%)
 Frame = +1

Query  190  VHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGD  369
            +  L+FY+   S+T+F +TIIP LK SLS+ L+++  L+  L  P D S P E  Y DGD
Sbjct  20   IQDLVFYEFPYSKTYFVETIIPRLKHSLSLTLKHFFPLSGNLIFPLDCSIP-EIRYKDGD  78

Query  370  GVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRRGMF--------AVKVTLF  525
             V L F    + S  FD LS +H RN  +F+PL   +       F        A++VTLF
Sbjct  79   SVSLTFV---EGSFDFDHLSGHHQRNEIDFHPLAVQMSPASTSTFGPLIVPLLAIQVTLF  135

Query  526  PEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLLG  630
            P +GIC+G  +HH+ G+ ++ F   ++W +++ LG
Sbjct  136  PNSGICIGFTFHHIAGNANTFFRLARSWASINKLG  170



>gb|KJB11557.1| hypothetical protein B456_001G265600 [Gossypium raimondii]
Length=472

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 98/190 (52%), Gaps = 10/190 (5%)
 Frame = +1

Query  91   VVEQSSVAP---PPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTIIPH  258
            ++E + VAP    P     F LPL F D+ W    PV RL FYQ   ++   F   I+P 
Sbjct  14   ILEVTQVAPTSNSPESTTEFRLPLTFCDIFWFKLPPVERLFFYQLDELTPACFNSVILPK  73

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            LK SLS+ L +Y  LA  L  P +    P  +Y   DGV L  A SD +   F+ LSS+ 
Sbjct  74   LKRSLSLTLVHYLPLAGNLKWPPN-EPKPIILYTPNDGVSLTVAHSDAD---FNILSSDG  129

Query  439  ARNSKEFYPLIPTL--PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWT  612
              ++ E +PL P L    V     AV++TLFP  G C+GI  HH V DG +   F+K+W 
Sbjct  130  VYDAAELHPLKPDLVTSDVSSSAIAVQLTLFPNKGFCIGITAHHAVLDGQTTTMFIKSWA  189

Query  613  ALSLLGHKSS  642
             +   G++ +
Sbjct  190  YICKQGNEEN  199



>ref|NP_171849.2| coumaroyl-CoA:anthocyanidin 3-O-glucoside-6"-O-coumaroyltransferase 
2 [Arabidopsis thaliana]
 sp|Q9LR73.1|3AT2_ARATH RecName: Full=Coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2 [Arabidopsis thaliana]
 gb|AAF86513.1|AC002560_6 F21B7.12 [Arabidopsis thaliana]
 gb|AEE27579.1| coumaroyl-CoA:anthocyanidin 3-O-glucoside-6'-O-coumaroyltransferase 
2 [Arabidopsis thaliana]
Length=465

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E   ++PP G VA  +LPL FFD  WL       L F+ +  S   F    +P+LK S
Sbjct  10   IIETCHISPPKGTVASTTLPLTFFDAPWLSLPLADSLFFFSYQNSTESFLQDFVPNLKHS  69

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LSI LQ++   A KL +P     PP   Y  G+   LVF V++     FD L S+  ++ 
Sbjct  70   LSITLQHFFPYAGKLIIPP-RPDPPYLHYNAGED-SLVFTVAESTETDFDQLKSDSPKDI  127

Query  451  KEFYPLIPTLPS--------VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
               + ++P LP           R + A++VT+FP AGIC+G +  HVV DG +   FMK 
Sbjct  128  SVLHGVLPKLPPPHVSPEGIQMRPIMAMQVTIFPGAGICIGNSATHVVADGVTFSHFMKY  187

Query  607  WTALS  621
            W +L+
Sbjct  188  WMSLT  192



>ref|XP_008353552.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Malus 
domestica]
Length=474

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 95/187 (51%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKV------AGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTH  234
            P    VVE  SVAP P            SLPL FFDL+WL   P   L FY+  +   +H
Sbjct  4    PGSVKVVEACSVAPKPSSXPDSAHPEDLSLPLTFFDLRWLRFPPSQSLFFYEMPSFDASH  63

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            F D+I+P LKTSLS  LQ++  LA  L  P D S  P   Y  G+ + L  A SD +  R
Sbjct  64   FFDSILPKLKTSLSATLQHFVPLAGNLTWPLD-SPEPLLSYLKGNAIMLTIAESDXDFXR  122

Query  415  FDCLSSNHARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
                S+N    +KE++PL+P L     +  +  +++T+F   G  +G A HH V DG S 
Sbjct  123  LXS-SNNFDIEAKEYHPLVPQLAMSHEKAAVLXLQITVFSNGGFSIGSAMHHAVLDGJSA  181

Query  589  FGFMKAW  609
              F K W
Sbjct  182  LLFFKFW  188



>ref|XP_008342065.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Malus 
domestica]
Length=474

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 95/187 (51%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKV------AGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTH  234
            P    VVE  SVAP P            SLPL FFDL+WL   P   L FY+  +   +H
Sbjct  4    PGSVXVVEACSVAPKPSSXPDSAHPEDLSLPLTFFDLRWLRFPPSQSLFFYEMPSFDASH  63

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            F D+I+P LKTSLS  LQ++  LA  L  P D S  P   Y  G+ + L  A SD +  R
Sbjct  64   FFDSILPKLKTSLSATLQHFVPLAGNLTWPLD-SPEPLLSYLKGNAIMLTIAESDXDFXR  122

Query  415  FDCLSSNHARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
                S+N    +KE++PL+P L     +  +  +++T+F   G  +G A HH V DG S 
Sbjct  123  LXS-SNNFDIEAKEYHPLVPQLAMSHEKAAVLXLQITVFSNGGFSIGSAMHHAVLDGJSA  181

Query  589  FGFMKAW  609
              F K W
Sbjct  182  LLFFKFW  188



>gb|KGN57759.1| hypothetical protein Csa_3G280980 [Cucumis sativus]
Length=253

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 95/189 (50%), Gaps = 10/189 (5%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA +   T   V+E  +VAPPPG     +LPL FFD+ W    PV RL FY+  V     
Sbjct  1    MATNHGSTAIKVLEVCTVAPPPGSTVPVTLPLTFFDILWFRFPPVERLFFYKSPVPFY--  58

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
               I+ +LK SLS+ LQ+Y  LA  +  P + S  P       DG+ L  A S+D+   F
Sbjct  59   --VIVSNLKKSLSLVLQHYLPLAGAIVWPEN-SPKPAVETAVRDGIVLTVAESEDD---F  112

Query  418  DCLSSNHARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
            D L  +  R   +  PL+  L +   R  + AV+VT F   G  +GI  HH V DG S  
Sbjct  113  DHLIGDGLRKEAKLRPLVAELAAEEDRAAVVAVQVTWFGNGGFSIGITSHHAVLDGRSST  172

Query  592  GFMKAWTAL  618
             FMK+W  L
Sbjct  173  SFMKSWAGL  181



>ref|XP_009365966.1| PREDICTED: LOW QUALITY PROTEIN: phenolic glucoside malonyltransferase 
1-like [Pyrus x bretschneideri]
Length=478

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 97/179 (54%), Gaps = 11/179 (6%)
 Frame = +1

Query  91   VVEQSSVAP----PPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPH  258
            VVE   VAP    P    +  SLPL FFD++WL   PV RL FYQ  +S +   + +   
Sbjct  9    VVEACRVAPHPTSPDSTASPTSLPLTFFDIRWLRFQPVQRLYFYQ--ISTSFDTELLFSK  66

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            LKTSLS+ LQ++  LA  L  P + S  P   Y +GD V L  A +D +  R    S + 
Sbjct  67   LKTSLSVTLQHFLPLAGNLTWPQE-SPKPTLNYVEGDAVSLTIAETDADFYRLS--SDDD  123

Query  439  ARNSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
               ++E++PL+P LP    +  + A++VT+FP  G  +G   HH V DG +   F+K+W
Sbjct  124  FLEAQEYHPLVPQLPVSHEKAAVMALQVTIFPYKGFSIGTTMHHAVLDGKTSTTFVKSW  182



>ref|XP_009365919.1| PREDICTED: LOW QUALITY PROTEIN: phenolic glucoside malonyltransferase 
1-like [Pyrus x bretschneideri]
Length=460

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 103/184 (56%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTHFKDT  246
            + P+   VVE   VAP P      SLPL FFD+ WL   P+ R+ F++  + + + F D+
Sbjct  2    AEPSSIKVVEVCKVAPNPSSPDDQSLPLTFFDILWLRFPPIQRVFFFEIPSFNTSLFFDS  61

Query  247  IIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCL  426
            I+P LKTSLS+ LQ++  LA  L  P D  +PP   Y   + V L  A S  N+  +  +
Sbjct  62   ILPKLKTSLSVTLQHFVPLAGNLTWPQD--SPPIINYVKDNAVSLTIAES--NADFYHLV  117

Query  427  SSNH-ARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGF  597
            SSN  +  +KE++PLIP L     +  + A+++T FP  G  +G A HH V DG +   F
Sbjct  118  SSNSFSVEAKEYHPLIPXLAVSHDQAEVLALQITAFPTGGFSIGSAVHHAVLDGKTSTMF  177

Query  598  MKAW  609
            +K+W
Sbjct  178  IKSW  181



>ref|XP_003555054.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Glycine 
max]
Length=478

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 98/192 (51%), Gaps = 13/192 (7%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGFS-LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKD  243
            S  P    V+EQ  +  PP +    S LPL FFD+ WL  SP   L FY+     +HF  
Sbjct  2    SITPFTLKVLEQCKITLPPNETTTTSFLPLTFFDIPWLFFSPSQPLFFYEFPHPTSHFTA  61

Query  244  TIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDC  423
            TI+P LK SLS  LQ+Y          +D + PP  +  D   V L  A   +++G F  
Sbjct  62   TIVPKLKQSLSHTLQHYYHFVGTFFPSSDLTKPP-LICIDDMSVALTIA---ESNGDFFH  117

Query  424  LSSNHARNSKEFYPLIPTLPS--VRRG------MFAVKVTLFPEAGICVGIAYHHVVGDG  579
              SN+ R+ K+F+ L+P L S     G      + A+++TLFP  G+C+G A+HHVV DG
Sbjct  118  FCSNYPRDLKDFHLLVPKLASSFSLEGKEELILVLAIQITLFPNVGLCIGHAFHHVVADG  177

Query  580  SSIFGFMKAWTA  615
             +   F   W +
Sbjct  178  RTFHNFFNTWAS  189



>ref|XP_010095851.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
 gb|EXB62319.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis]
Length=472

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 105/195 (54%), Gaps = 13/195 (7%)
 Frame = +1

Query  73   PPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTII  252
            P     V+EQ  V+PP G V   SLPL +FDL WL    +  L FY+      HF +TI+
Sbjct  4    PKREVKVIEQCKVSPPTGSVPSTSLPLTYFDLPWLFVGHMKSLFFYEFPHPIHHFFETIL  63

Query  253  PHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGD-GVPLVFAVSDDNSGRFDCLS  429
            P LK SLS+ LQ++  LAA L  P   +  P  ++ DGD  V L  A   ++S  F+ L 
Sbjct  64   PTLKHSLSLTLQHFFPLAANLVSPPPPAK-PHMLFTDGDSSVSLTVA---ESSADFNLLL  119

Query  430  SN-HARNSKEFYPLIPTL--PSVRRG-----MFAVKVTLFPEAGICVGIAYHHVVGDGSS  585
            +N + +     +P +P L  PSV  G     + A+++T+FP +GIC+G    HV  DG S
Sbjct  120  ANQYPQPVGTLHPFVPKLAPPSVEAGSRVGPVMALQITVFPNSGICIGFRVCHVASDGRS  179

Query  586  IFGFMKAWTALSLLG  630
               FMK W ++S  G
Sbjct  180  FEHFMKFWASVSKSG  194



>ref|XP_009400675.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase 
{ECO:0000303|PubMed:12481098}-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 108/196 (55%), Gaps = 9/196 (5%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDT  246
            SSPP    +++ S V+PPPG  +   LPL FFD+ WL G  V R+ FY+   S ++F  +
Sbjct  2    SSPPQLR-LLQTSQVSPPPGTASESILPLTFFDILWLRGGAVERVFFYRLPYSTSYFCAS  60

Query  247  IIPHLKTSLSIAL-QYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDC  423
            ++P L++SLS+AL Q+YPL       P       E  Y DGD V    A  D +   FD 
Sbjct  61   VLPDLESSLSLALQQFYPLAGKIRRSPGLDDDKYEIRYVDGDSVSFTVAEYDAD---FDE  117

Query  424  LSSNHARNSKEFYPLIPTLPSVRRG---MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFG  594
            +S +HAR+     PL+P L         + A++VT+FP  G+ VG+A HH   DGSS   
Sbjct  118  VSGDHARDVGSLLPLLPRLSRSDDDGVPVLALQVTVFPNQGVAVGVAVHHAGCDGSSSMR  177

Query  595  FMKAWTALSLLGHKSS  642
            FM +W A +  G +SS
Sbjct  178  FMFSW-ASTCAGPRSS  192



>ref|XP_008379438.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Malus 
domestica]
Length=453

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 99/187 (53%), Gaps = 11/187 (6%)
 Frame = +1

Query  67   SSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQ--HAVSRTHFK  240
            + P     +VE   VAP       FSLPL FFD+ WL   P+ RL FY+   +   T F 
Sbjct  2    ADPNNSVKIVEICRVAPQHAD-QEFSLPLTFFDIIWLKFPPIQRLYFYEILSSSKNTFFF  60

Query  241  DTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFD  420
            D+I+P LKTSLS+ L ++P LA  +  P D S  P   Y  GD V +  A SD     F 
Sbjct  61   DSILPKLKTSLSLTLHHFPPLAGNITWPQD-SPKPILSYLRGDAVSVTVAESD---ADFH  116

Query  421  CLSSNHARN--SKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
             L S+++ N  +KE++PL+P L     +    A+++TLFP  G  +G + HH   DG   
Sbjct  117  HLVSSNSFNIEAKEYHPLVPRLEVCHEKAAALALQITLFPNNGFSIGTSVHHAALDGKMS  176

Query  589  FGFMKAW  609
              F+K+W
Sbjct  177  TMFVKSW  183



>ref|XP_010522645.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 
2 [Tarenaya hassleriana]
Length=478

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 99/192 (52%), Gaps = 13/192 (7%)
 Frame = +1

Query  73   PPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTII  252
            PP    V+E S V+PP G     +LPL FFD+ WL    V  + FY +  S   F    +
Sbjct  2    PPHQLNVIETSHVSPPRGSAPSVTLPLTFFDVPWLTLPLVQSVFFYSYNDSTAQFLSDTL  61

Query  253  PHLKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
            P LK SLS+ LQ +YP   A +  P     PP   + DG    L+F V++     F+ L 
Sbjct  62   PILKHSLSLTLQHFYPFAGALICPP--RPEPPYLRFIDGQD-SLLFTVAESTEHNFEHLK  118

Query  430  SNHARNSKEFYPLIPTLP---------SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGS  582
            +++ ++ +  + L+P LP          ++R + A++VT+FP  GIC+G    HV  DG 
Sbjct  119  ADYPKDVRLLHDLLPKLPPAIEIAPERVLKRPVMAIQVTVFPNTGICIGKTQSHVSSDGV  178

Query  583  SIFGFMKAWTAL  618
            S   F+K WT++
Sbjct  179  SAMHFIKYWTSM  190



>ref|XP_008363917.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Malus 
domestica]
Length=475

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 99/189 (52%), Gaps = 11/189 (6%)
 Frame = +1

Query  70   SPPTYAAVVEQSSVAPPPGKV------AGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSR  228
            + P    VVE   VAP P            SLPL FFDL+WL   P   L FY+  +   
Sbjct  2    AKPGSVKVVEVCRVAPKPSSQPDSAHPDDLSLPLTFFDLRWLRFPPPQILFFYEISSFDT  61

Query  229  THFKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNS  408
            ++F D+I+P+LKTSLS  LQ++  LA  L  P D S+ P   Y  GD   L  A SD + 
Sbjct  62   SYFFDSILPNLKTSLSATLQHFVPLAGNLTWPQD-SSKPLLSYVLGDXXSLTXAESDADF  120

Query  409  GRFDCLSSNHARNSKEFYPLIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGS  582
             R    S+N    +KE++PL+P L     +  + A+++T+FP +   +G A HHVV DG 
Sbjct  121  HRLTS-SNNFDIKAKEYHPLVPQLAVSHEKAAVLALQITVFPNSCFSIGSAMHHVVLDGL  179

Query  583  SIFGFMKAW  609
            S F F   W
Sbjct  180  SAFSFFNLW  188



>gb|EEE67022.1| hypothetical protein OsJ_23954 [Oryza sativa Japonica Group]
Length=562

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 104/189 (55%), Gaps = 10/189 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAG--FSLPLAFFDLKWLHGSPVHRLIFYQHAVSRT--HFKDTIIPH  258
            V+EQ  V+P P   AG   SLPL FFDL +L   PV RL FY +A  R    F    +P 
Sbjct  106  VLEQCHVSPSPAPAAGQPRSLPLTFFDLVFLDFPPVQRLFFYDNADLRDAHDFLLRELPL  165

Query  259  LKTSLSIALQ-YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSN  435
             + SL+ AL  +YPL+        +  +PPE  Y DG  V L  AVS D+   F  L+ +
Sbjct  166  FRESLAAALHHFYPLVGKLPCGIRERMSPPEVAYSDGYSVCLTVAVSSDD---FQDLAGD  222

Query  436  HARNSKEFYPLIPTLPS--VRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
            H R++    PL+P LP     + + AV+VT+FP AGICVG   HH V DGSS   F+K W
Sbjct  223  HPRDTARLRPLLPPLPKHGSSQDVLAVQVTVFPRAGICVGTTLHHAVADGSSYVHFLKTW  282

Query  610  TALSLLGHK  636
             A+  LG +
Sbjct  283  AAIHRLGDE  291



>gb|KHN04295.1| Anthocyanin 5-aromatic acyltransferase [Glycine soja]
Length=472

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 97/184 (53%), Gaps = 11/184 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++EQS VAPP   +    LPL F D+ W       R+ FY+     THF +T +P LK S
Sbjct  8    IIEQSQVAPPQDSLHSTILPLTFLDIPWFLTRHARRIFFYEFPFPTTHFLETALPTLKHS  67

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++   A+ L +P      P   Y +GD V   F VS+ +   F  L+SN  ++ 
Sbjct  68   LSLTLQHFFPFASNLILPPRLHV-PYIRYLNGDSVS--FTVSEFSPANFTLLTSNSPQDV  124

Query  451  KEFYPLIPTLPSVRRG--------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
             ++ PL P  PS R          + A++VT+ P +G  + + ++HV GDG ++  FMK 
Sbjct  125  NDWQPLAPAFPSPRTTHDGTCEFPLMAIQVTVIPNSGFSICVIFNHVAGDGRTLHHFMKF  184

Query  607  WTAL  618
            W ++
Sbjct  185  WASV  188



>ref|XP_007032771.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY03697.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=361

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 97/187 (52%), Gaps = 10/187 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGK---VAGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTIIPH  258
            ++E + + P P      A  SLPL FFD+ W    PV RL FYQ +  +  +F   I+P 
Sbjct  3    ILEFTRIKPSPDSPKSAAELSLPLTFFDIFWFKLPPVERLFFYQINNSTPAYFNSVILPK  62

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            LK SLS+ L +Y  LA  L  P+  S  P  +Y   DGV L  A   +++  F+ LSS  
Sbjct  63   LKHSLSLTLLHYLPLAGNLKWPST-SPKPIILYTPNDGVSLTVA---ESAADFNLLSSKG  118

Query  439  ARNSKEFYPLIPTLPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWT  612
               + E +PL P L +        A+++TLFP  G C+GI  HH V DG +   FMK+W 
Sbjct  119  IYEAVELHPLTPELITSDDSASTIALQITLFPNMGFCIGITAHHAVLDGKATTLFMKSWA  178

Query  613  ALSLLGH  633
             L   G+
Sbjct  179  YLCNQGY  185



>ref|XP_007139467.1| hypothetical protein PHAVU_008G032000g [Phaseolus vulgaris]
 gb|ESW11461.1| hypothetical protein PHAVU_008G032000g [Phaseolus vulgaris]
Length=456

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 98/181 (54%), Gaps = 9/181 (5%)
 Frame = +1

Query  91   VVEQSSVAPPPGKV---AGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHL  261
            VVE SS+AP           S  L FFD+ WL   PV R+ FYQ       F DT++P L
Sbjct  12   VVEVSSIAPSSESQELPTEASFALTFFDILWLRLPPVQRVFFYQFHHPSNVFYDTLLPKL  71

Query  262  KTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
            K SLS+AL ++  LA  L  PT +ST P  VY  GD + L  A S+ +   F+ L+S   
Sbjct  72   KHSLSLALGHFFPLAGHLTWPT-HSTKPTIVYNQGDTLSLTVAESEAD---FNHLASTDL  127

Query  442  RNSKEFYPLIP--TLPSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTA  615
              + E + L+P  T+   +  +FA++VTLFP +G  +G+  HH V DG +   F K+W  
Sbjct  128  SEATEIHHLVPPLTISHEQTTLFALQVTLFPNSGFSIGVTSHHAVLDGKASTTFFKSWAY  187

Query  616  L  618
            L
Sbjct  188  L  188



>gb|KHN48832.1| Agmatine coumaroyltransferase [Glycine soja]
Length=464

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 89/158 (56%), Gaps = 7/158 (4%)
 Frame = +1

Query  142  SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAV  321
            SLPL FFDL WL   PV RL FY+       F DTI+P+LK SLS+ LQ++ LLA  +  
Sbjct  31   SLPLTFFDLLWLRSPPVERLFFYEFPNQTISFFDTILPNLKHSLSLTLQHFLLLAGTITW  90

Query  322  PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRR--  495
            P D S  P   Y  G+ V L  A S+++   F+ L SN    S    PLIP L +     
Sbjct  91   PLD-SPHPIINYVPGNVVSLTIAESNND---FNVLCSNTCDASLR-NPLIPHLNTSNEEA  145

Query  496  GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
             + A+++TLFP  G C+GI+ HH   DG +   F+KAW
Sbjct  146  SVMALQLTLFPNHGFCLGISTHHAAMDGKASTLFLKAW  183



>ref|XP_004304225.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011468649.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 99/185 (54%), Gaps = 15/185 (8%)
 Frame = +1

Query  73   PPTYAAVVEQSSVAPPPGKVAGFS---LPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKD  243
            P +   VVE   VAP PG     +   LPL  FD++WL  +PV RL FY+         D
Sbjct  4    PNSLVNVVEVCRVAPNPGSPDSATPDFLPLTLFDIRWLRFAPVQRLYFYE-----IFSTD  58

Query  244  TIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDC  423
            +I+P LK SLS+ LQ++  LA  L  P D S  P   Y  GD + L  A   +++  F  
Sbjct  59   SIVPKLKASLSLTLQHFLPLAGNLTWPQD-SLKPILRYAKGDTISLTVA---ESAADFGH  114

Query  424  LSSNHAR-NSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFG  594
            LSSN+     +E++PL+P L     +  + A++VT+FP  G  +G + HH V DG +   
Sbjct  115  LSSNYDLLEVQEYHPLVPQLEVSHDQSAVLALQVTVFPNRGFTIGTSMHHAVLDGKTSTS  174

Query  595  FMKAW  609
            F+K+W
Sbjct  175  FLKSW  179



>gb|KHN04293.1| Anthocyanin 5-aromatic acyltransferase [Glycine soja]
Length=474

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 101/184 (55%), Gaps = 11/184 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++EQ  V P PG V   +LPL FFD+ +    P  R+ FY+      +F  T +P LK S
Sbjct  12   ILEQCRVTPKPGSVPSTTLPLTFFDVPFFFSPPFKRIFFYEFPHPTLYFLQTTLPILKHS  71

Query  271  LSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNS  450
            LS+ LQ++   ++ L VP          Y DGD +    A   +++  F  L+S+  +++
Sbjct  72   LSLTLQHFFPFSSNLIVPPQQPHLSHIRYLDGDSLSFTVA---ESTADFTLLTSHSPQDA  128

Query  451  KEFYPLIPTLPS--VRRG------MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKA  606
            + ++PL+PTLPS  V +       + A++VT+FP +G  + + +HH+  DG S+  F+K 
Sbjct  129  QNWHPLVPTLPSPLVEQDGTRVFPLMAIQVTVFPNSGFTMCLTFHHIATDGKSLHHFIKF  188

Query  607  WTAL  618
            W +L
Sbjct  189  WASL  192



>ref|XP_009400673.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=448

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 101/188 (54%), Gaps = 8/188 (4%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTS  270
            ++E+S V+PP G VA  ++PL  FDL WL G  V R+ FY+   S  +F  +++PHLK+S
Sbjct  6    ILERSRVSPPAGAVAETTVPLTAFDLIWLKGGTVERVFFYRLPHSTAYFCASVLPHLKSS  65

Query  271  LSIAL-QYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            LS+AL Q+YPL       P       E  Y DGD V    A  D +   FD +S +HAR 
Sbjct  66   LSLALQQFYPLAGKIRRFPELDDDKYEIRYVDGDSVSFTVAEYDAD---FDEVSGDHARG  122

Query  448  -SKEFYPLIPTLPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTAL  618
                   L     S   G  +  ++VT+FP  G+ VG+A HH   DGSS   FM +W A 
Sbjct  123  VGPLLPLLPQLPRSDDDGVPVLDLQVTVFPNQGVAVGVAVHHAGCDGSSSMRFMFSW-AS  181

Query  619  SLLGHKSS  642
            +  G +SS
Sbjct  182  TCAGPRSS  189



>ref|XP_003554894.2| PREDICTED: phenolic glucoside malonyltransferase 1-like [Glycine 
max]
Length=479

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 89/158 (56%), Gaps = 7/158 (4%)
 Frame = +1

Query  142  SLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIALQYYPLLAAKLAV  321
            SLPL FFDL WL   PV RL FY+       F DTI+P+LK SLS+ LQ++ LLA  +  
Sbjct  46   SLPLTFFDLLWLRSPPVERLFFYEFPNQTISFFDTILPNLKHSLSLTLQHFLLLAGTITW  105

Query  322  PTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSVRR--  495
            P D S  P   Y  G+ V L  A S+++   F+ L SN    S    PLIP L +     
Sbjct  106  PLD-SPHPIINYVPGNVVSLTIAESNND---FNVLCSNTCDASLR-NPLIPHLNTSNEEA  160

Query  496  GMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
             + A+++TLFP  G C+GI+ HH   DG +   F+KAW
Sbjct  161  SVMALQLTLFPNHGFCLGISTHHAAMDGKASTLFLKAW  198



>ref|XP_009360572.1| PREDICTED: phenolic glucoside malonyltransferase 2-like [Pyrus 
x bretschneideri]
Length=513

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 98/177 (55%), Gaps = 14/177 (8%)
 Frame = +1

Query  139  FSLPLAFFDLKWLHGSPVHRLIFYQH------AVSRTHFKDTIIPHLKTSLSIALQYYPL  300
             SLPL F DL WL   P HRL FY        A +   F   IIP LKTSLSIALQ++  
Sbjct  55   LSLPLTFIDLVWLRYPPFHRLFFYDILPCSSPADTLLFFHSIIIPKLKTSLSIALQHFLP  114

Query  301  LAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR-NSKEFYPLIPT  477
            LA  +  P + S  P   Y  GD V L  A SD +   F  LSSN    ++KE++PL+P 
Sbjct  115  LAGNITWP-ESSPKPTLNYVKGDTVSLTVAESDAD---FHHLSSNDFNIDAKEYHPLVPQ  170

Query  478  LPSV--RRGMFAVKVTLFPEAG-ICVGIAYHHVVGDGSSIFGFMKAWTALSLLGHKS  639
            L     +  + A ++T+FP +G   +GI+ HH V DG ++F F+K+WT +    HKS
Sbjct  171  LAKSHEKAAVMAFQITVFPNSGGFSIGISMHHAVVDGKTLFMFLKSWTHICKHVHKS  227



>ref|XP_010553962.1| PREDICTED: phenolic glucoside malonyltransferase 1-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010553963.1| PREDICTED: phenolic glucoside malonyltransferase 1-like isoform 
X2 [Tarenaya hassleriana]
Length=468

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 93/180 (52%), Gaps = 7/180 (4%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTIIPHLKT  267
            ++  + V P        +LPL FFD  WL   PV RLIFY     +R +F   I+P+LK 
Sbjct  7    LIHVARVTPSSDSGESVTLPLTFFDALWLKFPPVERLIFYPLTTATRPYFDSVIVPNLKA  66

Query  268  SLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARN  447
            SLS  L +Y  LA +L + +     P  VY   D V L  A  D +   F  LS +  R 
Sbjct  67   SLSHTLSHYLPLAGRLVLDS-LDANPRLVYSANDAVSLTVAEYDAD---FSHLSGDGPRC  122

Query  448  SKEFYPLIPTLPSVRRGMFAV--KVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALS  621
            + E YPL+P L        AV  +VTLFP+ G C+G++ HH V DG +   F+KAW  +S
Sbjct  123  ATELYPLVPELHISDDSASAVSFQVTLFPDQGFCIGVSAHHAVLDGKTATMFLKAWAHIS  182



>gb|KJB50068.1| hypothetical protein B456_008G151900 [Gossypium raimondii]
Length=416

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 95/175 (54%), Gaps = 12/175 (7%)
 Frame = +1

Query  85   AAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLK  264
            A +V+   V+PPPG V   S+PL +FD+ W+   PV RL FY+     +HF +T +P LK
Sbjct  2    AKLVDSFRVSPPPGSVPTISVPLTYFDIPWVPNPPVQRLFFYEFPHPTSHFIETTLPMLK  61

Query  265  TSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHAR  444
             SLS+ LQ++   AA +  P      P   Y +GD V    A   +++  F+ + +N+ R
Sbjct  62   RSLSLTLQHFFPYAANIMCPQPPGK-PYIHYMEGDFVAFTVA---ESAADFNHVIANYPR  117

Query  445  NSKEFYPLIPTLPS---VRRG-----MFAVKVTLFPEAGICVGIAYHHVVGDGSS  585
              K  +P +P LPS      G     + A +VT+FP  GIC+G  Y H VGDG S
Sbjct  118  PVKLLHPFVPQLPSEHVTEDGSRVLPILAFQVTVFPNFGICIGSTYCHAVGDGKS  172



>ref|XP_006442122.1| hypothetical protein CICLE_v10020021mg [Citrus clementina]
 gb|ESR55362.1| hypothetical protein CICLE_v10020021mg [Citrus clementina]
Length=469

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 92/173 (53%), Gaps = 5/173 (3%)
 Frame = +1

Query  115  PPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTIIPHLKTSLSIALQY  291
            P     A F+LPL + D+ W    PV RL FYQ   ++R  F   I+P LK SLS+ L +
Sbjct  20   PSSTTTAPFTLPLTYLDIYWFKVLPVERLFFYQVTDLTRDFFDSVILPKLKHSLSLTLLH  79

Query  292  YPLLAAKLAVPTDYSTPPEFVYGDGD-GVPLVFAVSD-DNSGRFDCLSSNHARNSKEFYP  465
            Y  LA  +  P     P  + + D D GV +  A S  D++  F  LS N  R + EF+P
Sbjct  80   YLPLAGNIMWPEGTQKPAVYFFPDNDDGVSVTVAESSSDSTDLFSLLSGNGIRKAVEFHP  139

Query  466  LIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTAL  618
            L+P LP    +  + AV++TLF + G  +GI  HH V DG S   F+K+W  L
Sbjct  140  LVPNLPISDDKAEIIAVQITLFLKEGYSIGITSHHAVLDGKSSTLFVKSWAYL  192



>ref|XP_004145869.2| PREDICTED: phenolic glucoside malonyltransferase 1-like [Cucumis 
sativus]
Length=454

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 95/189 (50%), Gaps = 10/189 (5%)
 Frame = +1

Query  58   MAQSSPPTYAAVVEQSSVAPPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHF  237
            MA +   T   V+E  +VAPPPG     +LPL FFD+ W    PV RL FY+  V     
Sbjct  1    MATNHGSTAIKVLEVCTVAPPPGSTVPVTLPLTFFDILWFRFPPVERLFFYKSPVPFY--  58

Query  238  KDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRF  417
               I+ +LK SLS+ LQ+Y  LA  +  P + S  P       DG+ L  A S+D+   F
Sbjct  59   --VIVSNLKKSLSLVLQHYLPLAGAIVWPEN-SPKPAVETAVRDGIVLTVAESEDD---F  112

Query  418  DCLSSNHARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIF  591
            D L  +  R   +  PL+  L +   R  + AV+VT F   G  +GI  HH V DG S  
Sbjct  113  DHLIGDGLRKEAKLRPLVAELAAEEDRAAVVAVQVTWFGNGGFSIGITSHHAVLDGRSST  172

Query  592  GFMKAWTAL  618
             FMK+W  L
Sbjct  173  SFMKSWAGL  181



>ref|XP_004954417.1| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase-like 
[Setaria italica]
Length=455

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 91/173 (53%), Gaps = 15/173 (9%)
 Frame = +1

Query  115  PPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTHFKDTIIPHLKTSLSIAL-QY  291
            P PG V    LPL FFD+ WL   PV R+ FY +  +  HF   ++PHL +SLS AL ++
Sbjct  16   PAPGGV----LPLTFFDVPWLFTGPVERVFFYPYPHTAEHFTAHLLPHLVSSLSAALHRF  71

Query  292  YPLLAAKLAVPTDYSTPPEFVYGDGD---GVPLVFAVSDDNSGRFDCLSSNHARNSKEFY  462
            YPL+      P D     EF    GD   GV L FA S D+   FD LS    R+    Y
Sbjct  72   YPLVGRVRPCP-DGGGGYEFCSAGGDAGEGVELTFAESSDD---FDELSGCGPRDVARLY  127

Query  463  PLIPTLPSVRRGMFAV---KVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWT  612
             L+P LP    G FA+   +VT+F   GI VG++ HHV  D SS   F+K W 
Sbjct  128  ALVPQLPRAEDGTFALAAAQVTVFAGRGIAVGVSIHHVACDDSSYMHFVKTWA  180



>ref|XP_006475382.1| PREDICTED: phenolic glucoside malonyltransferase 1-like [Citrus 
sinensis]
Length=467

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 94/164 (57%), Gaps = 8/164 (5%)
 Frame = +1

Query  139  FSLPLAFFDLKWLHGSPVHRLIFYQHA-VSRTHFKDTIIPHLKTSLSIALQYYPLLAAKL  315
            F+LPL +FD  WL   PV RL FYQ   ++   F   I+P LK SLS+ L +Y  LA  +
Sbjct  25   FTLPLTYFDFFWLKFPPVERLFFYQICDLTWDSFSSVILPKLKHSLSLTLHHYLPLAGHI  84

Query  316  AVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSV--  489
              P +   P  + + + DGV   F V++ N+  F+ LSSN  R + EF PL+P  PS+  
Sbjct  85   MWPLEAPKPAVYFFPN-DGVS--FTVAESNNADFNHLSSNGIRRAVEFRPLVPE-PSISD  140

Query  490  -RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTAL  618
             +  + A+++TLFP  G  +GI+ HH V DG S   F+K+W  L
Sbjct  141  DKAEVIAIQITLFPNQGFSIGISSHHAVLDGKSSTMFVKSWAYL  184



>ref|XP_008357928.1| PREDICTED: BAHD acyltransferase At3g29680-like [Malus domestica]
Length=344

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 95/187 (51%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   PTYAAVVEQSSVAPPPGKV------AGFSLPLAFFDLKWLHGSPVHRLIFYQH-AVSRTH  234
            P    V E   VAP P            SLPL FFDL+WL   P   L FY   +   +H
Sbjct  4    PGSVKVXEVRXVAPKPSLXPNSAHPEDLSLPLTFFDLRWLRFPPPQHLFFYNMPSFDTSH  63

Query  235  FKDTIIPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGR  414
            F D+++P LKTSLS  LQ++  LA  L    D S  P   Y  GD V L  A SD +  R
Sbjct  64   FFDSVLPKLKTSLSATLQHFVPLAGNLIWLLD-SPKPLLSYIKGDAVSLTIAESDADFHR  122

Query  415  FDCLSSNHARNSKEFYPLIPTLPSV--RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSI  588
                S+N    +KE++PL+P L +   +  + A+++T+FP+ G  +G A HH   DG S 
Sbjct  123  LIS-SNNFBIEAKEYHPLVPQLAASXDKAAVLALQITVFPKDGFSIGSAMHHAACDGLSA  181

Query  589  FGFMKAW  609
              F+K W
Sbjct  182  ISFLKFW  188



>ref|XP_006384220.1| transferase family protein [Populus trichocarpa]
 gb|ERP62017.1| transferase family protein [Populus trichocarpa]
Length=471

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 88/169 (52%), Gaps = 7/169 (4%)
 Frame = +1

Query  139  FSLPLAFFDLKWLHGSPVHRLIFYQHAVSR-THFKDTIIPHLKTSLSIALQYYPLLAAKL  315
             SLPL F D+ WL   PV R+ FY+H  S  T F   I+P LK SLS  L ++  LA  L
Sbjct  28   LSLPLTFHDIMWLKFPPVERIFFYKHTESTPTFFNSVILPKLKHSLSHTLLHFLPLAGNL  87

Query  316  AVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPLIPTLPSV--  489
              P   +  P  +Y   DGV L  A   ++S  F  LS N    + +  P IP LP    
Sbjct  88   IWPPQ-AIKPIILYTPDDGVQLTVA---ESSADFHLLSGNEVHEAADSRPYIPELPVTDS  143

Query  490  RRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTALSLLGHK  636
            +  + A+K+TLFP  G C+GI+ HH V DG S   F+KAW     LG +
Sbjct  144  KASVIALKITLFPNNGFCIGISAHHSVLDGKSSIMFIKAWAHFCKLGDE  192



>gb|KJB11559.1| hypothetical protein B456_001G265800 [Gossypium raimondii]
Length=471

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 96/190 (51%), Gaps = 10/190 (5%)
 Frame = +1

Query  91   VVEQSSVAP---PPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTIIPH  258
            ++E + VAP    P     F LPL F D+ W    PV RL FYQ   ++   F   I+P 
Sbjct  14   ILEVTEVAPISNSPESKTKFRLPLTFSDIFWFKLPPVERLFFYQLDDLTPACFNSVILPK  73

Query  259  LKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNH  438
            LK SLS+ L +Y  LA  L  P      P  +Y   DGV L  A SD +   F+ LSS+ 
Sbjct  74   LKRSLSLTLVHYLPLAGNLKWPP-IEPKPIILYTPNDGVSLTVAHSDAD---FNILSSDG  129

Query  439  ARNSKEFYPLIPTL--PSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWT  612
              ++ E +PL P L    V     AV+VTLFP  G C+GI  HH V DG +   F+K+W 
Sbjct  130  VYDAAELHPLKPDLVTSDVSASAIAVQVTLFPNKGFCIGITAHHAVLDGQTTTMFIKSWA  189

Query  613  ALSLLGHKSS  642
             +   G+  +
Sbjct  190  HICKQGNDEN  199



>ref|XP_007217619.1| hypothetical protein PRUPE_ppa016299mg [Prunus persica]
 gb|EMJ18818.1| hypothetical protein PRUPE_ppa016299mg [Prunus persica]
Length=478

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 99/187 (53%), Gaps = 15/187 (8%)
 Frame = +1

Query  91   VVEQSSVAPPPG-KVAGFSLPLAFFDLKWLHGSPVHRLIFYQ------HAVSRTHFKDTI  249
            +VE   VAP P   VA FSLP  FFDL WL     HRL FY+       A ++  F   +
Sbjct  4    LVEVCRVAPQPQPDVAEFSLPQTFFDLLWLRFPHFHRLFFYEILASSASADTKPFFDSLL  63

Query  250  IPHLKTSLSIALQYYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLS  429
               LK SLS+ LQ++  LA  +  P D S  P   Y  GD V L  A SD +   F  LS
Sbjct  64   FQKLKASLSVTLQHFLPLAGNITWPQD-SHKPVLSYVQGDAVSLTTAHSDAD---FHRLS  119

Query  430  SNHAR-NSKEFYPLIPTLPSVRR--GMFAVKVTLFPE-AGICVGIAYHHVVGDGSSIFGF  597
            SN     +KE++PL+P L   R    + A ++TLFP  +G  +GI+ HH   DG ++F F
Sbjct  120  SNDFNIEAKEYHPLVPQLAISREKAAVMAFQITLFPNSSGFSIGISMHHAALDGKTLFMF  179

Query  598  MKAWTAL  618
            +K+W  L
Sbjct  180  LKSWAHL  186



>ref|NP_198724.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 dbj|BAB10830.1| anthocyanin acyltransferase-like protein [Arabidopsis thaliana]
 gb|AAO29960.1| acyltransferase -like protein [Arabidopsis thaliana]
 gb|AAP49522.1| At5g39080 [Arabidopsis thaliana]
 dbj|BAE99014.1| acyltransferase -like protein [Arabidopsis thaliana]
 gb|AED94392.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=463

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 97/178 (54%), Gaps = 10/178 (6%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVA-GFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTIIPHLK  264
            ++E + V P     A   SLPL +FDL +     V R+IFY+   V+R  F   I+P+LK
Sbjct  7    IIEVARVTPSNSDSAESLSLPLTYFDLIYYKLRAVERVIFYRITNVTRPFFDSVIVPNLK  66

Query  265  TSLSIALQYYPLLAAKLA-VPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHA  441
            TSLS  L +Y  LA KL   P D+   P  VY   D V   F+V++ N+  F  LS N  
Sbjct  67   TSLSSCLSHYLPLAGKLIWEPLDHK--PTIVYSQNDDVS--FSVAETNAD-FSSLSGNEP  121

Query  442  RNSKEFYPLIPTLPSVRRG--MFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAW  609
              S E YPL+P L S      + + +VTLFP  G C+G++ HH V DG +   F+K+W
Sbjct  122  FPSTELYPLVPALQSSDDSASIVSFQVTLFPNQGFCIGVSAHHAVLDGKTTTMFLKSW  179



>ref|XP_003621462.1| Isoflavonoid malonyl transferase [Medicago truncatula]
 gb|AES77680.1| anthocyanin 5-aromatic acyltransferase [Medicago truncatula]
Length=472

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 94/170 (55%), Gaps = 4/170 (2%)
 Frame = +1

Query  118  PPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTH---FKDTIIPHLKTSLSIALQ  288
            PP      S+PL FFD+ WL   PV R+ FY    S++H   F  TI+P+LK+SLS+ LQ
Sbjct  19   PPSSTKTTSIPLTFFDIFWLRFHPVERVFFYTLPNSQSHPSFFFQTIVPNLKSSLSLTLQ  78

Query  289  YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPL  468
            ++  LA  +  P+D S P      + DGV L+ A SD +       S + A  S+ F P 
Sbjct  79   HFLPLAGNIVWPSDSSKPIIQFDPNDDGVSLIIAESDSDFNHVVENSPHEASLSRSFIPH  138

Query  469  IPTLPSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTAL  618
            + +  S    M ++++TLFP +G  +GI+ HH V DG S   F+KAW  L
Sbjct  139  LESSDSFASIM-SLQITLFPNSGFSIGISTHHAVLDGKSSTMFVKAWAYL  187



>gb|ABY91220.1| isoflavonoid malonyl transferase 1 [Medicago truncatula]
Length=472

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 94/170 (55%), Gaps = 4/170 (2%)
 Frame = +1

Query  118  PPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQHAVSRTH---FKDTIIPHLKTSLSIALQ  288
            PP      S+PL FFD+ WL   PV R+ FY    S++H   F  TI+P+LK+SLS+ LQ
Sbjct  19   PPSSTKTTSIPLTFFDIFWLRFHPVERVFFYTLPNSQSHPSFFFQTIVPNLKSSLSLTLQ  78

Query  289  YYPLLAAKLAVPTDYSTPPEFVYGDGDGVPLVFAVSDDNSGRFDCLSSNHARNSKEFYPL  468
            ++  LA  +  P+D S P      + DGV L+ A SD +       S + A  S+ F P 
Sbjct  79   HFLPLAGNIVWPSDSSKPIIQFDPNDDGVSLIIAESDSDFNHVVENSPHEASLSRSFIPH  138

Query  469  IPTLPSVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTAL  618
            + +  S    M ++++TLFP +G  +GI+ HH V DG S   F+KAW  L
Sbjct  139  LESSDSFASIM-SLQITLFPNSGFSIGISTHHAVLDGKSSTMFVKAWAYL  187



>ref|XP_006478553.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Citrus sinensis]
Length=469

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 92/173 (53%), Gaps = 5/173 (3%)
 Frame = +1

Query  115  PPPGKVAGFSLPLAFFDLKWLHGSPVHRLIFYQ-HAVSRTHFKDTIIPHLKTSLSIALQY  291
            P   K A F+LPL + D+ W    PV RL FYQ   ++R  F   I+P LK SLS+ L +
Sbjct  20   PSSTKTALFTLPLTYLDIYWFKVLPVERLFFYQVTDLTRDFFDSVILPKLKHSLSLTLLH  79

Query  292  YPLLAAKLAVPTDYSTPPEFVYGDGD-GVPLVFAVSD-DNSGRFDCLSSNHARNSKEFYP  465
            Y  LA  +  P     P  + + D D GV +  A S  D++  F  LS N  R + EF+P
Sbjct  80   YLPLAGNIMWPEGTQKPAVYFFPDNDDGVSVTVAESSSDSTDLFSLLSGNGIRKAVEFHP  139

Query  466  LIPTLP--SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWTAL  618
            L+P L     +  + AV++TLF + G  +GI  HH V DG S   F+K+W  L
Sbjct  140  LVPNLSISDDKAEIIAVQITLFLKEGYSIGITSHHAVLDGKSSTLFVKSWAYL  192



>ref|XP_010243532.1| PREDICTED: malonyl-CoA:anthocyanidin 5-O-glucoside-6''-O-malonyltransferase-like 
[Nelumbo nucifera]
Length=433

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 95/182 (52%), Gaps = 7/182 (4%)
 Frame = +1

Query  91   VVEQSSVAPPPGKVAGFSLPLAFFDLKWL-HGSPVHRLIFYQHAVSRTHFKDTIIPHLKT  267
            V+EQ  VAPPPG V+  SL L FFDL WL        L F+ +  S THF + ++P +K 
Sbjct  10   VLEQCRVAPPPGSVSSKSLTLTFFDLYWLPFPGASECLFFFDYPHSTTHFMECLLPSIKH  69

Query  268  SLSIAL-QYYPLLAAKLAVPTDYSTPPEFVYGDGD-GVPLVFAVSDDNSGRFDCLSSNHA  441
            SLS+ L  +YPL  +    P D   P    Y DG+  V L  A  ++    F  LS    
Sbjct  70   SLSLTLVHFYPLAGSLSWQPLDSCKPAMINYVDGESAVSLTIAEFNNGGDHFHHLSGKLV  129

Query  442  RNSKEFYPLIPTLP---SVRRGMFAVKVTLFPEAGICVGIAYHHVVGDGSSIFGFMKAWT  612
            R     + L P L    SV   M A+++TLFP  GIC+GI  HH V DG S   F+K+W 
Sbjct  130  REVNASHLLAPPLSPSGSVVPTM-ALQITLFPNTGICLGITIHHAVADGRSASHFIKSWA  188

Query  613  AL  618
            ++
Sbjct  189  SI  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 998120974048