BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2179

Length=1157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               333   3e-109   Solanum lycopersicum
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          332   2e-108   Solanum tuberosum [potatoes]
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               332   2e-108   Nicotiana sylvestris
emb|CDP12094.1|  unnamed protein product                                319   8e-104   Coffea canephora [robusta coffee]
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          317   5e-103   Citrus sinensis [apfelsine]
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               317   6e-103   Vitis vinifera
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             317   6e-103   Citrus clementina [clementine]
ref|XP_002509881.1|  conserved hypothetical protein                     317   8e-103   Ricinus communis
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               316   1e-102   Elaeis guineensis
gb|KHG24129.1|  Reticulon-like protein B3                               313   1e-101   Gossypium arboreum [tree cotton]
ref|XP_012086804.1|  PREDICTED: reticulon-like protein B2               313   2e-101   Jatropha curcas
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               313   3e-101   Phoenix dactylifera
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               312   3e-101   Vitis vinifera
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               311   8e-101   Elaeis guineensis
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          311   9e-101   Solanum tuberosum [potatoes]
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               311   1e-100   Nelumbo nucifera [Indian lotus]
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    309   6e-100   Nicotiana sylvestris
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               310   6e-100   Nicotiana tomentosiformis
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               309   9e-100   
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               308   1e-99    Nicotiana sylvestris
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               307   3e-99    Populus euphratica
ref|NP_001239711.1|  uncharacterized protein LOC100811024               306   6e-99    Glycine max [soybeans]
ref|XP_002299504.1|  reticulon family protein                           306   1e-98    Populus trichocarpa [western balsam poplar]
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    305   2e-98    Nicotiana tomentosiformis
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             304   4e-98    Phaseolus vulgaris [French bean]
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          304   5e-98    Solanum tuberosum [potatoes]
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               304   7e-98    Nicotiana sylvestris
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    303   1e-97    Glycine max [soybeans]
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               303   1e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB19087.1|  hypothetical protein B456_003G084400                    303   1e-97    Gossypium raimondii
ref|XP_002511930.1|  conserved hypothetical protein                     303   1e-97    Ricinus communis
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    303   2e-97    Nicotiana sylvestris
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               302   3e-97    Phoenix dactylifera
gb|KJB24634.1|  hypothetical protein B456_004G154600                    301   5e-97    Gossypium raimondii
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               302   5e-97    Tarenaya hassleriana [spider flower]
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               302   5e-97    Sesamum indicum [beniseed]
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               302   5e-97    Nicotiana tomentosiformis
gb|ACJ84486.1|  unknown                                                 301   9e-97    Medicago truncatula
gb|AFK41983.1|  unknown                                                 300   9e-97    Medicago truncatula
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    300   2e-96    Sesamum indicum [beniseed]
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               300   2e-96    Tarenaya hassleriana [spider flower]
gb|KHG04885.1|  Reticulon-like protein B5                               300   2e-96    Gossypium arboreum [tree cotton]
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               300   4e-96    Tarenaya hassleriana [spider flower]
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               300   4e-96    Eucalyptus grandis [rose gum]
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               299   4e-96    Solanum lycopersicum
gb|KJB06451.1|  hypothetical protein B456_001G157900                    299   5e-96    Gossypium raimondii
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               299   5e-96    Phoenix dactylifera
gb|ACU23452.1|  unknown                                                 299   7e-96    Glycine max [soybeans]
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     299   7e-96    Eucalyptus grandis [rose gum]
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               299   7e-96    Tarenaya hassleriana [spider flower]
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               298   7e-96    Populus euphratica
ref|XP_007051689.1|  Reticulon family protein                           298   8e-96    
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     300   9e-96    Eucalyptus grandis [rose gum]
gb|KHG15548.1|  Reticulon-like protein B3                               298   1e-95    Gossypium arboreum [tree cotton]
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 298   1e-95    Elaeis guineensis
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               298   2e-95    Elaeis guineensis
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               298   2e-95    Solanum lycopersicum
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    297   2e-95    
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                297   3e-95    Erythranthe guttata [common monkey flower]
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          297   3e-95    Cicer arietinum [garbanzo]
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               297   3e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   297   4e-95    Citrus sinensis [apfelsine]
ref|NP_001056102.1|  Os05g0526400                                       296   4e-95    
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             296   5e-95    Citrus clementina [clementine]
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               294   5e-95    
ref|XP_007038874.1|  VIRB2-interacting protein 2                        296   7e-95    Theobroma cacao [chocolate]
ref|XP_012083295.1|  PREDICTED: reticulon-like protein B5               295   2e-94    Jatropha curcas
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          297   2e-94    Glycine max [soybeans]
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               297   2e-94    Elaeis guineensis
gb|KHG29253.1|  Reticulon-like protein B5                               293   6e-94    Gossypium arboreum [tree cotton]
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               293   8e-94    Sesamum indicum [beniseed]
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    293   8e-94    Solanum tuberosum [potatoes]
gb|KJB52210.1|  hypothetical protein B456_008G250900                    293   9e-94    Gossypium raimondii
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                293   1e-93    Erythranthe guttata [common monkey flower]
ref|NP_001149653.1|  LOC100283279                                       293   1e-93    Zea mays [maize]
gb|KHG20258.1|  Reticulon-like protein B3                               292   2e-93    Gossypium arboreum [tree cotton]
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               292   2e-93    Cucumis melo [Oriental melon]
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               291   8e-93    Eucalyptus grandis [rose gum]
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               291   8e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2               291   9e-93    Cucumis sativus [cucumbers]
gb|EAY98759.1|  hypothetical protein OsI_20691                          290   2e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_002303615.1|  reticulon family protein                           290   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               290   2e-92    Nelumbo nucifera [Indian lotus]
gb|KHG09260.1|  Reticulon-like protein B3                               289   3e-92    Gossypium arboreum [tree cotton]
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          289   3e-92    Oryza brachyantha
emb|CDP08746.1|  unnamed protein product                                289   4e-92    Coffea canephora [robusta coffee]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               289   4e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             289   4e-92    
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    293   7e-92    
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             289   9e-92    Capsella rubella
gb|EAY75742.1|  hypothetical protein OsI_03655                          288   1e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             288   2e-91    
ref|XP_002874678.1|  VIRB2-interacting protein 2                        288   2e-91    Arabidopsis lyrata subsp. lyrata
gb|EMS62606.1|  Reticulon-like protein B1                               287   2e-91    Triticum urartu
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               287   3e-91    Prunus mume [ume]
ref|XP_011624344.1|  PREDICTED: reticulon-like protein B1               286   3e-91    Amborella trichopoda
ref|XP_010112604.1|  Reticulon-like protein                             286   4e-91    Morus notabilis
emb|CDP05124.1|  unnamed protein product                                286   6e-91    Coffea canephora [robusta coffee]
gb|ERN08636.1|  hypothetical protein AMTR_s00017p00194840               287   7e-91    Amborella trichopoda
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               287   7e-91    Brachypodium distachyon [annual false brome]
ref|NP_001130478.1|  Seed maturation protein                            285   9e-91    Zea mays [maize]
gb|KHN15986.1|  Reticulon-like protein B5                               285   1e-90    Glycine soja [wild soybean]
gb|EAY73097.1|  hypothetical protein OsI_00974                          286   1e-90    Oryza sativa Indica Group [Indian rice]
gb|KJB24285.1|  hypothetical protein B456_004G137000                    285   1e-90    Gossypium raimondii
ref|NP_001241367.1|  uncharacterized protein LOC100796111               285   2e-90    Glycine max [soybeans]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               285   2e-90    Tarenaya hassleriana [spider flower]
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               285   2e-90    Camelina sativa [gold-of-pleasure]
ref|NP_001150474.1|  seed maturation protein                            285   3e-90    
tpg|DAA52789.1|  TPA: seed maturation protein                           285   3e-90    
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               285   3e-90    Nicotiana sylvestris
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             284   3e-90    Eutrema salsugineum [saltwater cress]
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          285   3e-90    Setaria italica
dbj|BAJ89699.1|  predicted protein                                      284   4e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               284   4e-90    Prunus mume [ume]
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          283   4e-90    Oryza brachyantha
ref|XP_002320163.1|  reticulon family protein                           283   5e-90    Populus trichocarpa [western balsam poplar]
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             286   9e-90    
dbj|BAB32723.1|  unknown protein                                        284   9e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    283   1e-89    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK94480.1|  unknown                                                 283   1e-89    Populus trichocarpa [western balsam poplar]
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          283   1e-89    Solanum tuberosum [potatoes]
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               282   2e-89    Solanum lycopersicum
gb|KJB06453.1|  hypothetical protein B456_001G157900                    283   2e-89    Gossypium raimondii
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               281   2e-89    Brachypodium distachyon [annual false brome]
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                282   2e-89    Erythranthe guttata [common monkey flower]
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               283   3e-89    
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               283   3e-89    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT19773.1|  Reticulon-like protein B1                               282   4e-89    
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               281   4e-89    Malus domestica [apple tree]
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               281   4e-89    Camelina sativa [gold-of-pleasure]
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               281   4e-89    Populus euphratica
ref|XP_010092876.1|  Reticulon-like protein                             281   5e-89    Morus notabilis
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             281   5e-89    Prunus persica
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    282   6e-89    
emb|CDJ26559.1|  unnamed protein product                                282   7e-89    Triticum aestivum [Canadian hard winter wheat]
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               281   8e-89    Sesamum indicum [beniseed]
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               280   1e-88    Pyrus x bretschneideri [bai li]
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               280   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_002870630.1|  VIRB2-interacting protein 3                        280   1e-88    
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               281   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               280   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               280   1e-88    Brassica rapa
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               280   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             280   2e-88    Capsella rubella
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               280   2e-88    Tarenaya hassleriana [spider flower]
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             280   2e-88    Eutrema salsugineum [saltwater cress]
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               280   2e-88    Eucalyptus grandis [rose gum]
emb|CDY25557.1|  BnaC09g11820D                                          280   2e-88    Brassica napus [oilseed rape]
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               280   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               279   3e-88    Camelina sativa [gold-of-pleasure]
ref|NP_001044177.1|  Os01g0736900                                       279   3e-88    
dbj|BAJ98297.1|  predicted protein                                      279   4e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               279   4e-88    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   280   4e-88    Citrus sinensis [apfelsine]
gb|ACF87936.1|  unknown                                                 277   5e-88    Zea mays [maize]
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          278   5e-88    Oryza brachyantha
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               278   6e-88    
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             280   6e-88    
ref|NP_192861.1|  reticulon-like protein B2                             279   7e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          278   8e-88    Setaria italica
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               278   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      278   1e-87    
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               278   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               277   2e-87    Pyrus x bretschneideri [bai li]
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               277   2e-87    Malus domestica [apple tree]
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               278   2e-87    Camelina sativa [gold-of-pleasure]
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   276   2e-87    Citrus sinensis [apfelsine]
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          277   2e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_198975.1|  reticulon-like protein B4                             277   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    277   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               278   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      278   3e-87    
ref|XP_002880222.1|  reticulon family protein                           276   3e-87    Arabidopsis lyrata subsp. lyrata
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    277   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    277   4e-87    Camelina sativa [gold-of-pleasure]
ref|NP_176592.1|  reticulon-like protein B3                             276   4e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             276   5e-87    Eutrema salsugineum [saltwater cress]
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             276   5e-87    
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               275   7e-87    Brassica rapa
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             275   7e-87    Citrus clementina [clementine]
emb|CDY34396.1|  BnaA09g11380D                                          275   1e-86    Brassica napus [oilseed rape]
gb|KHN40449.1|  Reticulon-like protein B5                               275   1e-86    Glycine soja [wild soybean]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                275   2e-86    Erythranthe guttata [common monkey flower]
emb|CDY57657.1|  BnaC01g15350D                                          275   2e-86    Brassica napus [oilseed rape]
ref|NP_194094.1|  VIRB2-interacting protein 1                           275   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             274   3e-86    Capsella rubella
emb|CDY42012.1|  BnaC04g00900D                                          274   3e-86    Brassica napus [oilseed rape]
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               273   6e-86    Populus euphratica
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    273   6e-86    Arabis alpina [alpine rockcress]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               273   6e-86    Glycine max [soybeans]
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               273   7e-86    Brassica rapa
emb|CDY44123.1|  BnaA01g13310D                                          273   9e-86    Brassica napus [oilseed rape]
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    273   9e-86    Arabis alpina [alpine rockcress]
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             273   1e-85    Prunus persica
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               273   1e-85    Brassica rapa
ref|NP_566065.1|  reticulon-like protein B5                             272   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               273   1e-85    Brassica rapa
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               272   2e-85    Pyrus x bretschneideri [bai li]
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               271   2e-85    Fragaria vesca subsp. vesca
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             272   2e-85    Eutrema salsugineum [saltwater cress]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        272   3e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               271   3e-85    Malus domestica [apple tree]
ref|XP_012090159.1|  PREDICTED: reticulon-like protein B5               271   3e-85    Jatropha curcas
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               271   4e-85    Brachypodium distachyon [annual false brome]
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               271   4e-85    Camelina sativa [gold-of-pleasure]
emb|CDY52012.1|  BnaC06g42920D                                          270   8e-85    Brassica napus [oilseed rape]
dbj|BAJ33905.1|  unnamed protein product                                271   9e-85    Eutrema halophilum
gb|ABR17571.1|  unknown                                                 270   9e-85    Picea sitchensis
ref|XP_002887921.1|  reticulon family protein                           270   1e-84    Arabidopsis lyrata subsp. lyrata
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    270   1e-84    Arabis alpina [alpine rockcress]
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1               270   1e-84    Cucumis sativus [cucumbers]
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               270   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY08353.1|  BnaC09g12430D                                          270   1e-84    Brassica napus [oilseed rape]
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               270   2e-84    Brassica rapa
emb|CDY05135.1|  BnaC03g29330D                                          271   2e-84    
emb|CDY10954.1|  BnaA03g46130D                                          270   3e-84    Brassica napus [oilseed rape]
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          269   3e-84    Sorghum bicolor [broomcorn]
gb|ACN40158.1|  unknown                                                 269   3e-84    Picea sitchensis
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               269   4e-84    Malus domestica [apple tree]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             268   4e-84    Phaseolus vulgaris [French bean]
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               268   5e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               268   5e-84    Pyrus x bretschneideri [bai li]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               268   5e-84    
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               268   5e-84    Camelina sativa [gold-of-pleasure]
emb|CDY38194.1|  BnaA09g11950D                                          268   7e-84    Brassica napus [oilseed rape]
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             268   9e-84    Capsella rubella
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               267   2e-83    Fragaria vesca subsp. vesca
ref|NP_001239653.1|  uncharacterized protein LOC100793862               267   2e-83    Glycine max [soybeans]
emb|CDM81762.1|  unnamed protein product                                266   2e-83    Triticum aestivum [Canadian hard winter wheat]
gb|EMS62854.1|  Reticulon-like protein B1                               266   3e-83    Triticum urartu
ref|XP_010105716.1|  Reticulon-like protein                             267   3e-83    
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               266   3e-83    Populus euphratica
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             266   3e-83    Populus trichocarpa [western balsam poplar]
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               266   4e-83    Malus domestica [apple tree]
ref|NP_001185307.1|  reticulon-like protein B3                          266   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               265   9e-83    Pyrus x bretschneideri [bai li]
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          264   2e-82    Setaria italica
emb|CDY24806.1|  BnaA08g15040D                                          265   2e-82    Brassica napus [oilseed rape]
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               263   4e-82    Brassica rapa
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             263   4e-82    Eutrema salsugineum [saltwater cress]
emb|CDX90792.1|  BnaA03g24720D                                          264   4e-82    
dbj|BAH57206.1|  AT1G64090                                              262   7e-82    Arabidopsis thaliana [mouse-ear cress]
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    263   7e-82    Arabis alpina [alpine rockcress]
gb|ACG32549.1|  seed maturation protein                                 262   9e-82    Zea mays [maize]
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             262   1e-81    Phaseolus vulgaris [French bean]
gb|KHN29299.1|  Reticulon-like protein B5                               262   1e-81    Glycine soja [wild soybean]
emb|CDY41666.1|  BnaC03g62180D                                          263   1e-81    Brassica napus [oilseed rape]
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               262   3e-81    Beta vulgaris subsp. vulgaris [field beet]
gb|AFK42059.1|  unknown                                                 261   4e-81    Lotus japonicus
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      261   4e-81    
ref|NP_191715.2|  reticulon-like protein B6                             260   5e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AFK34557.1|  unknown                                                 261   7e-81    Medicago truncatula
gb|EPS71452.1|  hypothetical protein M569_03311                         259   8e-81    Genlisea aurea
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               259   2e-80    Tarenaya hassleriana [spider flower]
ref|NP_001130268.1|  uncharacterized protein LOC100191362               258   3e-80    Zea mays [maize]
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               258   6e-80    Prunus mume [ume]
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B1               258   7e-80    Cucumis sativus [cucumbers]
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               257   9e-80    Cucumis melo [Oriental melon]
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               257   1e-79    Populus euphratica
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          256   3e-79    Cicer arietinum [garbanzo]
gb|EMT06999.1|  Reticulon-like protein B1                               256   3e-79    
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               256   4e-79    Fragaria vesca subsp. vesca
ref|XP_006842617.1|  PREDICTED: reticulon-like protein B5               255   8e-79    Amborella trichopoda
ref|XP_002876621.1|  reticulon family protein                           254   9e-79    
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             254   1e-78    Capsella rubella
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               254   2e-78    Brassica rapa
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               252   6e-78    Camelina sativa [gold-of-pleasure]
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     251   1e-77    Eucalyptus grandis [rose gum]
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               251   1e-77    Camelina sativa [gold-of-pleasure]
gb|EPS73616.1|  hypothetical protein M569_01145                         251   2e-77    Genlisea aurea
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             250   4e-77    
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               248   3e-76    Camelina sativa [gold-of-pleasure]
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          248   4e-76    Setaria italica
gb|EMT18983.1|  Reticulon-like protein B1                               246   8e-76    
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               244   6e-75    Phoenix dactylifera
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               244   7e-75    Elaeis guineensis
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          245   8e-75    Oryza brachyantha
ref|NP_001057713.1|  Os06g0503400                                       244   2e-74    
ref|XP_003592173.1|  Reticulon family protein                           243   2e-74    Medicago truncatula
ref|NP_001046501.1|  Os02g0265900                                       242   3e-74    
gb|KJB52679.1|  hypothetical protein B456_008G272900                    243   3e-74    
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               243   4e-74    
gb|EAY85291.1|  hypothetical protein OsI_06662                          241   5e-74    
dbj|BAJ94514.1|  predicted protein                                      242   8e-74    
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             241   8e-74    
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          241   1e-73    
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          242   1e-73    
gb|ACG36034.1|  reticulon                                               240   4e-73    
gb|KJB24288.1|  hypothetical protein B456_004G137000                    239   5e-73    
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               239   7e-73    
gb|ABK22748.1|  unknown                                                 239   8e-73    
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               239   1e-72    
ref|XP_011656361.1|  PREDICTED: reticulon-like protein B2               238   1e-72    
gb|KHN21799.1|  Reticulon-like protein B1                               238   2e-72    
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          238   2e-72    
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    238   2e-72    
gb|KGN45697.1|  hypothetical protein Csa_6G006830                       238   2e-72    
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               238   2e-72    
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          238   2e-72    
gb|ABB51093.1|  reticulon                                               236   3e-72    
ref|NP_001130603.1|  uncharacterized protein LOC100191702               237   4e-72    
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               236   6e-72    
ref|NP_001130091.1|  uncharacterized protein LOC100191184               237   6e-72    
ref|NP_001042463.1|  Os01g0226300                                       234   7e-72    
gb|EMS49910.1|  Reticulon-like protein B3                               239   8e-72    
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               236   2e-71    
gb|EMT25698.1|  Reticulon-like protein B2                               236   3e-71    
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               234   8e-71    
gb|KHN12926.1|  Reticulon-like protein B1                               234   8e-71    
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          234   9e-71    
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               231   8e-70    
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               229   3e-69    
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          229   4e-69    
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               229   7e-69    
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          228   2e-68    
gb|EPS69502.1|  hypothetical protein M569_05265                         226   5e-68    
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               226   5e-68    
gb|EAY97489.1|  hypothetical protein OsI_19418                          226   9e-68    
ref|NP_001055164.1|  Os05g0312500                                       225   2e-67    
gb|EPS64109.1|  hypothetical protein M569_10676                         224   6e-67    
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               223   2e-66    
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               221   5e-66    
gb|ABC69764.1|  unknown                                                 219   2e-65    
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               220   2e-65    
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               219   3e-65    
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               219   4e-65    
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          219   4e-65    
gb|ABK26525.1|  unknown                                                 219   6e-65    
dbj|BAK06264.1|  predicted protein                                      219   7e-65    
gb|EMS50148.1|  Reticulon-like protein B2                               216   4e-64    
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             217   4e-64    
gb|KJB39437.1|  hypothetical protein B456_007G013600                    216   8e-64    
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                    215   8e-64    
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    216   9e-64    
ref|XP_002521590.1|  conserved hypothetical protein                     216   1e-63    
ref|XP_006836413.1|  PREDICTED: reticulon-like protein B8               215   1e-63    
ref|NP_001150935.1|  seed maturation protein                            215   2e-63    
ref|NP_001149072.1|  LOC100282693                                       215   2e-63    
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     213   3e-63    
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 214   3e-63    
ref|XP_002302126.2|  reticulon family protein                           214   3e-63    
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               214   3e-63    
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               214   4e-63    
ref|XP_011653261.1|  PREDICTED: reticulon-like protein B8               213   7e-63    
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    213   8e-63    
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               213   9e-63    
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    213   1e-62    
gb|EPS67049.1|  hypothetical protein M569_07727                         212   1e-62    
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                212   1e-62    
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     213   3e-62    
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    211   8e-62    
ref|XP_007048924.1|  Reticulon family protein                           210   1e-61    
ref|XP_012074187.1|  PREDICTED: reticulon-like protein B8               210   1e-61    
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               210   2e-61    
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               209   3e-61    
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    210   3e-61    
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    209   3e-61    
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             208   6e-61    
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   208   7e-61    
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    208   7e-61    
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    208   7e-61    
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               208   7e-61    
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               208   8e-61    
gb|ABK23818.1|  unknown                                                 205   9e-61    
ref|XP_002306759.1|  reticulon family protein                           207   1e-60    
gb|EMS52545.1|  Reticulon-like protein B1                               208   1e-60    
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     207   1e-60    
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                    207   2e-60    
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          208   2e-60    
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               207   2e-60    
gb|EEC80692.1|  hypothetical protein OsI_23118                          220   2e-60    
ref|NP_566371.1|  reticulon-like protein B8                             206   5e-60    
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    206   5e-60    
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               206   5e-60    
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               205   5e-60    
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          206   6e-60    
ref|XP_012077732.1|  PREDICTED: reticulon-like protein B5               206   7e-60    
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    206   7e-60    
ref|NP_850552.1|  reticulon-like protein B8                             206   7e-60    
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    206   7e-60    
gb|EEE65781.1|  hypothetical protein OsJ_21474                          216   2e-59    
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               204   2e-59    
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             204   2e-59    
emb|CDY41331.1|  BnaA01g31880D                                          204   2e-59    
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               204   3e-59    
emb|CDP18758.1|  unnamed protein product                                203   5e-59    
gb|KHN11998.1|  Reticulon-like protein B8                               202   9e-59    
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    202   1e-58    
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    202   1e-58    
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               202   1e-58    
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    202   2e-58    
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               201   2e-58    
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    201   3e-58    
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    201   3e-58    
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    201   4e-58    
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               201   6e-58    
gb|EMT10142.1|  Reticulon-like protein B1                               201   7e-58    
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    201   7e-58    
ref|NP_001241930.1|  uncharacterized protein LOC100787981               200   8e-58    
ref|XP_008461104.1|  PREDICTED: reticulon-like protein B9               199   8e-58    
emb|CDY00916.1|  BnaC05g42840D                                          200   8e-58    
emb|CDY56712.1|  BnaC01g38700D                                          203   1e-57    
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             199   2e-57    
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          199   2e-57    
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    199   2e-57    
emb|CDY07184.1|  BnaCnng01990D                                          199   2e-57    
gb|KHG28741.1|  Reticulon-like protein B8                               199   2e-57    
sp|Q9M145.2|RTNLG_ARATH  RecName: Full=Reticulon-like protein B7;...    199   3e-57    
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               199   3e-57    
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               199   3e-57    
ref|NP_001051461.1|  Os03g0781700                                       199   3e-57    
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             198   4e-57    
gb|KJB52212.1|  hypothetical protein B456_008G250900                    197   6e-57    
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               198   7e-57    
gb|EAY92056.1|  hypothetical protein OsI_13754                          198   9e-57    
gb|EAY98925.1|  hypothetical protein OsI_20880                          196   1e-56    
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    197   2e-56    
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          197   2e-56    
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2    196   2e-56    
ref|XP_011096983.1|  PREDICTED: reticulon-like protein B9               196   2e-56    
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    197   2e-56    
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               196   3e-56    
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             195   3e-56    
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1    196   3e-56    
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               196   4e-56    
gb|AFK34561.1|  unknown                                                 196   4e-56    
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               196   5e-56    
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg             195   5e-56    
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like          195   6e-56    
gb|KCW46475.1|  hypothetical protein EUGRSUZ_K00300                     192   7e-56    
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               195   8e-56    
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               195   9e-56    
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          195   1e-55    
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             193   1e-55    
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               194   1e-55    
ref|XP_010906987.1|  PREDICTED: reticulon-like protein B2               193   2e-55    
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          193   2e-55    
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    194   2e-55    
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9               193   3e-55    
gb|KHN28537.1|  Reticulon-like protein B8                               193   4e-55    
gb|KJB71174.1|  hypothetical protein B456_011G126300                    193   4e-55    
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...    193   5e-55    
ref|XP_004137485.1|  PREDICTED: reticulon-like protein B9               192   7e-55    
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    192   7e-55    
gb|ACG31942.1|  seed maturation protein                                 192   7e-55    
ref|XP_002884786.1|  reticulon family protein                           192   8e-55    
ref|XP_010093192.1|  Reticulon-like protein                             192   8e-55    
dbj|BAH20346.1|  AT4G11220                                              189   1e-54    
emb|CDP04019.1|  unnamed protein product                                192   1e-54    
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8               192   1e-54    
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    193   2e-54    
gb|KJB71173.1|  hypothetical protein B456_011G126300                    193   2e-54    
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like          193   3e-54    
ref|NP_001137021.1|  seed maturation protein isoform 1                  191   3e-54    
gb|ACG26944.1|  seed maturation protein                                 191   3e-54    
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    191   3e-54    
tpg|DAA51729.1|  TPA: seed maturation protein                           191   3e-54    
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    191   4e-54    
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8               190   4e-54    
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9               189   5e-54    
ref|XP_009111438.1|  PREDICTED: reticulon-like protein B7 isoform X2    190   7e-54    
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             191   8e-54    
emb|CAN77759.1|  hypothetical protein VITISV_034907                     189   9e-54    
ref|NP_192032.1|  reticulon-like protein B7                             189   9e-54    
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    191   9e-54    
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3    189   1e-53    
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g             189   2e-53    
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1    189   2e-53    
gb|KEH33647.1|  reticulon-like protein B2                               188   2e-53    
ref|XP_009415631.1|  PREDICTED: reticulon-like protein B2               187   2e-53    
ref|XP_008782310.1|  PREDICTED: reticulon-like protein B1               187   3e-53    
ref|XP_006374288.1|  hypothetical protein POPTR_0015s05710g             186   3e-53    
ref|XP_010921233.1|  PREDICTED: reticulon-like protein B1 isoform X2    187   4e-53    
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    191   4e-53    
gb|ABK26009.1|  unknown                                                 187   5e-53    
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    190   5e-53    
ref|XP_007209013.1|  hypothetical protein PRUPE_ppa023407mg             187   5e-53    
ref|XP_010456226.1|  PREDICTED: reticulon-like protein B7 isoform X1    187   7e-53    
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    189   9e-53    
ref|XP_002872901.1|  reticulon family protein                           187   9e-53    
ref|NP_001058867.1|  Os07g0142000                                       186   2e-52    
gb|EYU42855.1|  hypothetical protein MIMGU_mgv1a012522mg                186   2e-52    
gb|AFK48295.1|  unknown                                                 184   2e-52    
ref|XP_012075775.1|  PREDICTED: reticulon-like protein B14              185   3e-52    
ref|XP_010422782.1|  PREDICTED: reticulon-like protein B7 isoform X1    186   3e-52    
ref|XP_010323110.1|  PREDICTED: reticulon-like protein B2               183   4e-52    
ref|XP_010427652.1|  PREDICTED: reticulon-like protein B7 isoform X1    185   4e-52    
ref|XP_006289795.1|  hypothetical protein CARUB_v10003398mg             184   6e-52    
gb|KJB24635.1|  hypothetical protein B456_004G154600                    182   1e-51    
ref|NP_001030913.1|  reticulon-like protein B6                          184   2e-51    
ref|XP_004491277.1|  PREDICTED: reticulon-like protein B8-like is...    183   3e-51    
ref|XP_009347494.1|  PREDICTED: reticulon-like protein B9               182   3e-51    
dbj|BAK05980.1|  predicted protein                                      182   3e-51    
gb|KJB06452.1|  hypothetical protein B456_001G157900                    181   3e-51    
ref|XP_003565315.1|  PREDICTED: reticulon-like protein B4               182   3e-51    
gb|EEE63204.1|  hypothetical protein OsJ_18014                          187   4e-51    
ref|XP_004491276.1|  PREDICTED: reticulon-like protein B8-like is...    183   5e-51    
ref|XP_008792884.1|  PREDICTED: reticulon-like protein B6               181   9e-51    
ref|XP_006396287.1|  hypothetical protein EUTSA_v10029354mg             181   1e-50    
ref|XP_010253410.1|  PREDICTED: reticulon-like protein B9               180   1e-50    



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 188/259 (73%), Positives = 217/259 (84%), Gaps = 10/259 (4%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIH----------RHdsssssdsekeeeekkkttssMDAKVRRLF  290
            E  + +ESL++KI++K+H             SS S D +K+       TSS  +KVRRLF
Sbjct  10   EKEEHDESLMDKISEKLHFSNHSSSPAPASSSSDSDDEKKKPTSPAPATSSFGSKVRRLF  69

Query  291  GRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  470
            GR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++AL
Sbjct  70   GRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMIAL  129

Query  471  AVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMF  650
            A LFLWSNAS+FI KSAPHIPEVHIPE+PVL+FASALRN++N  LAVLR+IASGRDLKMF
Sbjct  130  AGLFLWSNASTFIHKSAPHIPEVHIPEKPVLEFASALRNEINRALAVLREIASGRDLKMF  189

Query  651  LMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYA  830
            L+VI GLW+ SI+G CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+HELKKQYA
Sbjct  190  LLVIGGLWLASILGGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYA  249

Query  831  VFDAKVLSKIPRGPLKDKK  887
            V DAKVLSKIPRGPLKDKK
Sbjct  250  VLDAKVLSKIPRGPLKDKK  268



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 215/255 (84%), Gaps = 10/255 (4%)
 Frame = +3

Query  153  EEESLVEKIADKIH----------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            ++ESL++KI++K+H             SS S D +K+       TSS  +KVRRLFGR++
Sbjct  14   QDESLMDKISEKLHFSNHSSSPAPASSSSDSDDEKKKPTSPAPETSSFGSKVRRLFGRER  73

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++ALA LF
Sbjct  74   PVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMVALAGLF  133

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI KSAPHIPEVHIPE+PVL FASALRN++N  LAVLR+IASGRDLK FL+VI
Sbjct  134  LWSNASTFIHKSAPHIPEVHIPEKPVLAFASALRNEINRALAVLREIASGRDLKTFLLVI  193

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW+ SI+G CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+HELKKQYAVFDA
Sbjct  194  GGLWLASILGGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVFDA  253

Query  843  KVLSKIPRGPLKDKK  887
            KVLSKIPRGPLKDKK
Sbjct  254  KVLSKIPRGPLKDKK  268



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 185/264 (70%), Positives = 218/264 (83%), Gaps = 7/264 (3%)
 Frame = +3

Query  123  ESAMAEEDRKEEESLVEKIADKIH-------RHdsssssdsekeeeekkkttssMDAKVR  281
            E    E+  + EES++EKI + +H          SSS SD +K+       TSS  +KVR
Sbjct  5    EERKVEKSDEHEESVMEKITETLHLSNNNHHSSSSSSDSDDDKKTTSSPPVTSSFKSKVR  64

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CHGLI
Sbjct  65   RLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHGLI  124

Query  462  LALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDL  641
            +ALA LFLWSNAS+FI KSAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+GRDL
Sbjct  125  VALAGLFLWSNASAFIHKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDL  184

Query  642  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  821
            K FLMVI GLWI+S++GSCCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA+HELKK
Sbjct  185  KTFLMVIGGLWILSVLGSCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKALHELKK  244

Query  822  QYAVFDAKVLSKIPRGPLKDKKLA  893
            QYAVFDAKVLSKIPRGPL+DKK A
Sbjct  245  QYAVFDAKVLSKIPRGPLRDKKKA  268



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   319 bits (817),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 204/250 (82%), Gaps = 6/250 (2%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            EED K E SL+EK  DK+H      + DS     + +  TSS+ AKV RLFGR++PVHK+
Sbjct  7    EEDAKAE-SLIEKTRDKVH-----GADDSSSSSSDDEGKTSSLKAKVFRLFGREKPVHKL  60

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK ADVF+WRNK+IS GVLG ATAIW+LFE+LEYHLLT VCHGLI+ LAVLFLWSNA
Sbjct  61   LGGGKPADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLWSNA  120

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            S+FI KS P IPEV +PE+PVLQFAS  R  +N   A+LRD+ASGR+LK FL VI GLWI
Sbjct  121  STFINKSPPRIPEVSVPEKPVLQFASDARVAINQTFALLRDVASGRNLKKFLSVIAGLWI  180

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
             SI+GSCCDFLTL YI+ VLLHTVPV+Y+KYED+VD+FAEKA+ ELKKQYAVFD KVLSK
Sbjct  181  FSILGSCCDFLTLLYISAVLLHTVPVIYDKYEDQVDSFAEKALAELKKQYAVFDKKVLSK  240

Query  858  IPRGPLKDKK  887
            IPRGPLKDKK
Sbjct  241  IPRGPLKDKK  250



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   317 bits (812),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 188/257 (73%), Positives = 217/257 (84%), Gaps = 4/257 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MA+E + EE   ES++EKI +KIH HDSSSSS S   +++KK +TSS+  KV RLFGR++
Sbjct  1    MADEHKHEEPAGESVMEKITEKIHGHDSSSSSSSSDTDDDKKSSTSSLKTKVFRLFGREK  60

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LF++LEYHLLT VCH LI+ALAVLF
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLF  120

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI KS P IPEV+IPEEPVLQ ASALR ++N    +LR+IASGRDLK FL VI
Sbjct  121  LWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDLKKFLSVI  180

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW++SIVGS C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA  E+KKQYAVFDA
Sbjct  181  AGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDA  240

Query  843  KVLSKIPRGPLKDKKLA  893
            KVLSKIPR  LKDKK A
Sbjct  241  KVLSKIPRS-LKDKKKA  256



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   317 bits (811),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 176/245 (72%), Positives = 206/245 (84%), Gaps = 5/245 (2%)
 Frame = +3

Query  159  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES++EKI++KIH HDSSSS    ++            AKV R+FGR++PVHKVLGGGK A
Sbjct  13   ESMMEKISEKIHGHDSSSSDSDNEKSSPSA-----FKAKVYRIFGREKPVHKVLGGGKPA  67

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  518
            DV LWRNKKIS GVLGGATA+WILFE+LEYHLLT VCH  ILALA+LFLWSNA++FI K+
Sbjct  68   DVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLWSNATTFINKA  127

Query  519  AphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSC  698
             PHIPEVHIPE+PVLQFASALR ++N    +LR++ASG+DLK FL VI GLW++SIVGS 
Sbjct  128  PPHIPEVHIPEDPVLQFASALRIEINRGFTLLRNVASGKDLKKFLSVIAGLWVVSIVGSW  187

Query  699  CDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  878
            C+FLTLFYI  VLLHTVPVLYEKYED VD+FAEKAM E+K+QYAVFDAKVLS+IPRGPLK
Sbjct  188  CNFLTLFYIVFVLLHTVPVLYEKYEDPVDSFAEKAMVEIKRQYAVFDAKVLSRIPRGPLK  247

Query  879  DKKLA  893
            DKK+A
Sbjct  248  DKKIA  252



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   317 bits (812),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 188/257 (73%), Positives = 215/257 (84%), Gaps = 4/257 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MA+E + EE   ES+ EKI +KIH HDSSSSS S   +++KK + SS+  KV RLFGR++
Sbjct  1    MADEHKHEEPAGESVKEKITEKIHGHDSSSSSSSSDSDDDKKSSASSLKTKVFRLFGREK  60

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LI+ALAVLF
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLF  120

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI KS P IPEV+IPEEPVLQ ASALR ++N    +LR+IASGRDLK FL VI
Sbjct  121  LWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVI  180

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW++SIVGS C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA  E+KKQYAVFDA
Sbjct  181  AGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDA  240

Query  843  KVLSKIPRGPLKDKKLA  893
            KVLSKIPR  LKDKK A
Sbjct  241  KVLSKIPRS-LKDKKKA  256



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   317 bits (811),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 187/260 (72%), Positives = 220/260 (85%), Gaps = 6/260 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsek---eeeekkkttssMDAKVRRLFG  293
            MA+E   EE   ESL++KI++KIH HDSSSSSDS+     + +   + SS+ +K+ RLFG
Sbjct  1    MADEHHHEESKGESLMDKISEKIHGHDSSSSSDSDNDEKLKPKSPSSPSSIKSKIYRLFG  60

Query  294  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  473
            R++PVH VLGGGK AD+FLWRNKK+S GVLG ATA+W+LFE++EYHLLT +CHG ILALA
Sbjct  61   REKPVHHVLGGGKPADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALA  120

Query  474  VLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFL  653
            +LFLWSNAS+FI KS PHIPEVHIPEEPVLQ A+ALR ++N+  A+LRDIASGRDLK FL
Sbjct  121  ILFLWSNASTFINKSPPHIPEVHIPEEPVLQVAAALRMEINYAFAILRDIASGRDLKKFL  180

Query  654  MVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAV  833
             VI GLW++SIVGS C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKA  E+KKQYAV
Sbjct  181  SVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVFYEKYEDKVDAFAEKAAIEIKKQYAV  240

Query  834  FDAKVLSKIPRGPLKDKKLA  893
            FDAKVLSKIPRGPLKDKK A
Sbjct  241  FDAKVLSKIPRGPLKDKKKA  260



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 208/251 (83%), Gaps = 2/251 (1%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            +EE   + ESL+EKIA+K+H     SSS S+ + E+ + + SS+ AK+ RLFGR++PVHK
Sbjct  5    SEEASSKPESLMEKIAEKLH--GDDSSSSSDSDNEKSESSASSVKAKIYRLFGREEPVHK  62

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+L+YHLLT V H L+L+LA+LFLWSN
Sbjct  63   VLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTLVGHCLVLSLAILFLWSN  122

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS+FI K  PHIPEV IPE+  +  A +LR ++N   AVLRDIASGRDLK FL VI GLW
Sbjct  123  ASTFINKIPPHIPEVSIPEDVAINVALSLRYEINRAFAVLRDIASGRDLKKFLAVIAGLW  182

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            ++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLS
Sbjct  183  VLSILGSCCNFLTLFYILFVTLHTVPVLYEKYEDKVDSFAEKAMAEIKKQYVVFDAKVLS  242

Query  855  KIPRGPLKDKK  887
            KIPRGPLKDKK
Sbjct  243  KIPRGPLKDKK  253



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 199/242 (82%), Gaps = 5/242 (2%)
 Frame = +3

Query  162  SLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  341
            SL+E+IA+KI   DSSSS     +  E       + AKV RLFGR++PVH VLGGGK AD
Sbjct  12   SLMERIAEKIQGRDSSSSDSDNDKPSESS-----IKAKVFRLFGREKPVHHVLGGGKPAD  66

Query  342  VFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSA  521
            +FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALAVLFLWSNA++FI KS 
Sbjct  67   IFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALAVLFLWSNAATFINKSP  126

Query  522  phipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCC  701
            P IPEV IP++PV++FA ALR ++N   AVLRDIASGR+LK FL VI GLW++SIVGS C
Sbjct  127  PRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRELKKFLSVIAGLWVLSIVGSWC  186

Query  702  DFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKD  881
            +FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSKIPRGPLK+
Sbjct  187  NFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPRGPLKE  246

Query  882  KK  887
            KK
Sbjct  247  KK  248



>ref|XP_012086804.1| PREDICTED: reticulon-like protein B2 [Jatropha curcas]
 gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 218/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  132  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsek-eeeekkkttssMDAKVRRLFGRQQ  302
            MAE  ++E   ES++EKI++KIH HDSSSSSDS+  E+ +   + SSM +K+ R+FGR++
Sbjct  1    MAEHHKEESVIESVMEKISEKIHGHDSSSSSDSDNDEKSKSSSSPSSMKSKIYRIFGREK  60

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CHGLIL+LAVLF
Sbjct  61   PVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVLF  120

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI KS P IPEV+IPEEPVLQ A ALR+++N   AVLRDIASGRDLK FL VI
Sbjct  121  LWSNASTFINKSPPRIPEVYIPEEPVLQVADALRSEINWGFAVLRDIASGRDLKKFLSVI  180

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW++SIVGS  +FLTLFYI  VLL+TVPV YEKYED+VD+ AEKA+ ELKKQYAV DA
Sbjct  181  AGLWVLSIVGSWVNFLTLFYIVFVLLYTVPVFYEKYEDKVDSLAEKALIELKKQYAVLDA  240

Query  843  KVLSKIPRGPLKDKK  887
            KVLSKIPRGPLKDKK
Sbjct  241  KVLSKIPRGPLKDKK  255



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 204/241 (85%), Gaps = 2/241 (1%)
 Frame = +3

Query  165  LVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQADV  344
            L+EKIADK+H HDSSSSSDS+ E+ E   ++  + AK+ RLFGR++PVHKVLGGGK ADV
Sbjct  15   LMEKIADKLHGHDSSSSSDSDNEKSEPSASS--VKAKIYRLFGREKPVHKVLGGGKPADV  72

Query  345  FLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAp  524
             LWRNKKIS GVLGGATA+W+LFE+LEYHLLT V H LIL+LA+LFLWSNAS+FI K+ P
Sbjct  73   LLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVGHCLILSLAILFLWSNASTFISKTPP  132

Query  525  hipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCD  704
            HIPEV IPE+  +  A +LR ++N   A+LRDIASGRDLK FL VI GLW++SI+GSCC+
Sbjct  133  HIPEVSIPEDLAVNVALSLRYEINRAFAILRDIASGRDLKKFLAVIAGLWVLSILGSCCN  192

Query  705  FLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  884
            FLTLFYI  V LHTVPVLYEKYED+VD FAEKAM E+KKQY VFDAKVLSKIPRGPLKDK
Sbjct  193  FLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDK  252

Query  885  K  887
            K
Sbjct  253  K  253



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 174/253 (69%), Positives = 204/253 (81%), Gaps = 2/253 (1%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            AE      ESL+EKI DK+  HDSSSS      ++    +   + AKV RLFGR++PVH 
Sbjct  5    AEGSGAASESLLEKITDKLQGHDSSSSGSDSDSDKPASPSP--IKAKVFRLFGREKPVHT  62

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSN
Sbjct  63   VLGGGKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSN  122

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            A++FI KS P IPEVHIPE+P LQ  +ALR ++N   AVLRDIASGRDLK FL++I GLW
Sbjct  123  ATTFINKSPPRIPEVHIPEDPFLQAVNALRIEINCGFAVLRDIASGRDLKKFLIIIAGLW  182

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            ++SI+GSCC+FLTLFYI  VLLHTVPV+YEKYED +D FAEKA  E+KKQYAVFDAKVLS
Sbjct  183  VLSILGSCCNFLTLFYITFVLLHTVPVIYEKYEDRIDPFAEKATIEIKKQYAVFDAKVLS  242

Query  855  KIPRGPLKDKKLA  893
            KIP+ PLK KK+A
Sbjct  243  KIPKVPLKYKKMA  255



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   311 bits (797),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 200/251 (80%), Gaps = 3/251 (1%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            +EE   +  SL+EKI DK+H HD SSS    ++ E    +   + A + RLFGR++PVHK
Sbjct  5    SEESSSKPVSLMEKIVDKLHGHDDSSSDSDNEKSEPSASS---IKANIYRLFGRERPVHK  61

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSN
Sbjct  62   VLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHCLILSLAILFLWSN  121

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS FI K+ P I EV IP++  +  A +LR ++N  +AVLR+I SG+DLK FL VI GLW
Sbjct  122  ASIFINKAPPRILEVSIPKDLAVNVALSLRYEINRAIAVLREITSGQDLKKFLAVIAGLW  181

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            ++ ++GSCC+F+TLFYI VV LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLS
Sbjct  182  VLLVLGSCCNFMTLFYIMVVTLHTVPVLYEKYEDKVDSFAEKAMTEIKKQYKVFDAKVLS  241

Query  855  KIPRGPLKDKK  887
            KIPR PLKDKK
Sbjct  242  KIPREPLKDKK  252



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   311 bits (798),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 176/259 (68%), Positives = 204/259 (79%), Gaps = 8/259 (3%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIH--------RHdsssssdsekeeeekkkttssMDAKVRRLF  290
            AE    + ESL+EKIADK H          D+ +     K E E +    ++  KV RLF
Sbjct  5    AENSDPKGESLMEKIADKFHGDDSSSSSESDTETKKPVVKSEVEAEPEPETLKNKVWRLF  64

Query  291  GRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  470
            GR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI+ L
Sbjct  65   GREKPVHKVFGGGKPADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHILIITL  124

Query  471  AVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMF  650
            AVLFLWSNA++FI K  PHIPEVH+PE P+LQ ASALR ++N  L +LR+IASGR+LK F
Sbjct  125  AVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKF  184

Query  651  LMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYA  830
            L VI GLWI+SIVGS C+FLTLFYI+ VLLHT+PVLYEKYED+VD  AEKAMHE+KKQYA
Sbjct  185  LAVIAGLWILSIVGSWCNFLTLFYISFVLLHTIPVLYEKYEDKVDPLAEKAMHEIKKQYA  244

Query  831  VFDAKVLSKIPRGPLKDKK  887
            VFDAKVLSKIPRGPLKDKK
Sbjct  245  VFDAKVLSKIPRGPLKDKK  263



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + A V RLFGRQ+PVHKV GGGK ADVFLWRNKKIS GVLGGATA W+LFE+LEYHLLT 
Sbjct  45   VTAAVYRLFGRQKPVHKVFGGGKPADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTL  104

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            VCH LI++LAVLFL+SNA +F+ K+ P IPEV+IPE+PVLQFASALR ++N   AVLRDI
Sbjct  105  VCHCLIVSLAVLFLYSNAIAFMHKTPPRIPEVYIPEDPVLQFASALRIEINRAFAVLRDI  164

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYIA VLLHTVPVLYEKYED+VD+FAEKA
Sbjct  165  ASGRDLKKFLAVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVLYEKYEDQVDSFAEKA  224

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  893
            M E+KKQY +FDAKVLSKIP+GPLKDKK A
Sbjct  225  MAEIKKQYVIFDAKVLSKIPKGPLKDKKHA  254



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   309 bits (792),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 204/255 (80%), Gaps = 5/255 (2%)
 Frame = +3

Query  144  DRKEEESLVEKIADKI-----HRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            + KEEESL+EKI DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA++FI K  PHIPE H+ EEP+L+ ASALR ++NH L VLR+IASGRDLK FL VI G
Sbjct  129  SNATTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDLKKFLAVIAG  188

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYAVFDA+V
Sbjct  189  LWVLSMLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAVFDARV  248

Query  849  LSKIPRGPLKDKKLA  893
            LSKIP+GPLKDKK A
Sbjct  249  LSKIPKGPLKDKKKA  263



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 173/261 (66%), Positives = 204/261 (78%), Gaps = 11/261 (4%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIH-----------RHdsssssdsekeeeekkkttssMDAKVRR  284
            E    + ESL+EKIADK H             ++   +  E+     +   SS+  KV R
Sbjct  6    ENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEAEPSSVKDKVWR  65

Query  285  LFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLIL  464
            LFGR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI+
Sbjct  66   LFGREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILII  125

Query  465  ALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLK  644
            +LAVLFLWSNA++FI K  PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASGR+LK
Sbjct  126  SLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELK  185

Query  645  MFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQ  824
             FL V+ GLWIISIVGS C+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKAMHE+KKQ
Sbjct  186  KFLGVVAGLWIISIVGSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQ  245

Query  825  YAVFDAKVLSKIPRGPLKDKK  887
            YAVFD KVLSKIPRGPLKDKK
Sbjct  246  YAVFDKKVLSKIPRGPLKDKK  266



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   309 bits (791),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 172/256 (67%), Positives = 203/256 (79%), Gaps = 6/256 (2%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIH------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  299
            E    + ESL+EKIADK H        +S + +     + E +  T ++  KV RLFGR+
Sbjct  6    ENSDPKGESLLEKIADKFHGDDSSSSSESDTETKKPAVKSEVEPETETLKNKVWRLFGRE  65

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKV GGGK ADVFLWRNKKIS  V+GGATAIW+LFE+LEYHLLT +CH LI+ LAVL
Sbjct  66   KPVHKVFGGGKPADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILIITLAVL  125

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNA++FI K  PHIPEVH+PE P+LQ ASALR ++N  L +LR+IASGR+LK FL V
Sbjct  126  FLWSNATTFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAV  185

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            I GLWI+SIVGS C+FLTLFYI+ VLLHTVPV+YEKYED+VD  AEKAMHE+KKQYAVFD
Sbjct  186  IAGLWILSIVGSWCNFLTLFYISFVLLHTVPVIYEKYEDKVDPLAEKAMHEIKKQYAVFD  245

Query  840  AKVLSKIPRGPLKDKK  887
             KVLSKIPRGPLKDKK
Sbjct  246  EKVLSKIPRGPLKDKK  261



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/259 (68%), Positives = 204/259 (79%), Gaps = 9/259 (3%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIH---------RHdsssssdsekeeeekkkttssMDAKVRRLF  290
            E    + ESL+EKIADK H           D+ +   + KEE       SS+  KV RLF
Sbjct  6    ENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEPSSVKDKVWRLF  65

Query  291  GRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  470
            GR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI++L
Sbjct  66   GREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISL  125

Query  471  AVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMF  650
            AVLFLWSNA++FI K  PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASGR+LK F
Sbjct  126  AVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKF  185

Query  651  LMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYA  830
            L V+ GLWI+SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAMHE+KKQYA
Sbjct  186  LGVVAGLWILSIVGSWCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYA  245

Query  831  VFDAKVLSKIPRGPLKDKK  887
            VFD KVLSKIPRGPLKDKK
Sbjct  246  VFDEKVLSKIPRGPLKDKK  264



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   307 bits (786),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 214/254 (84%), Gaps = 4/254 (2%)
 Frame = +3

Query  132  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  305
            MAE D+ +   ES+ EKI++KIH     SSS S+ + E+ K    S+ +K+ RLFGR++P
Sbjct  1    MAEHDKDDSVVESVTEKISEKIHG--HDSSSGSDSDHEKSKSNPDSLKSKIYRLFGREKP  58

Query  306  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  485
            VHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LILALA+LFL
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLILALALLFL  118

Query  486  WSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVIT  665
            WSNAS+FI KS P IPEVHIPEEPVLQ A+ALR ++N   AVLRDIASGRDLK FL VI 
Sbjct  119  WSNASTFINKSPPRIPEVHIPEEPVLQIAAALRIEINQGFAVLRDIASGRDLKKFLTVIA  178

Query  666  GLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAK  845
            GLW++SIVGS C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAK
Sbjct  179  GLWVLSIVGSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAK  238

Query  846  VLSKIPRGPLKDKK  887
            VLSKIPRGPLKDKK
Sbjct  239  VLSKIPRGPLKDKK  252



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   306 bits (785),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 178/255 (70%), Positives = 202/255 (79%), Gaps = 6/255 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAE    EE   ESL+EKI+ KI       SS S   + EK   + S+ +KV RLFGR++
Sbjct  1    MAEHHEHEEVKGESLLEKISGKI---HDHDSSSSSDSDNEKTSASDSLKSKVFRLFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LIL LAVLF
Sbjct  58   PIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI KS P IP+VHIPE+PVL+FASALR ++N   A+LRDIASGRDLK FL VI
Sbjct  118  LWSNASTFINKSPPKIPQVHIPEKPVLEFASALRVEINRAFALLRDIASGRDLKKFLSVI  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW+ SI+GS  +FLTLFYIA VLLHTVPVLYEKYED VD+F  KA+ E+KKQYAVFDA
Sbjct  178  AGLWVFSILGSWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGGKAIAEIKKQYAVFDA  237

Query  843  KVLSKIPRGPLKDKK  887
            KVLSKIPRGPLKDKK
Sbjct  238  KVLSKIPRGPLKDKK  252



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 185/254 (73%), Positives = 215/254 (85%), Gaps = 4/254 (2%)
 Frame = +3

Query  132  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  305
            MAE D+ +   ES+ EKI++K H HDSSS SDS+ E+ +    +  + +K+ RLFGR++P
Sbjct  1    MAEHDKDDSVVESVTEKISEKTHGHDSSSVSDSDHEKSKSNPDS--LKSKIYRLFGREKP  58

Query  306  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  485
            VHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEY+L+T VCH LILALA+LFL
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTLVCHCLILALALLFL  118

Query  486  WSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVIT  665
            WSNAS+FI KS P IPEV IPEEPVLQ A+ALR ++N   +VLRDIASGRDLK FL VI 
Sbjct  119  WSNASTFINKSPPRIPEVCIPEEPVLQTAAALRIEINQGFSVLRDIASGRDLKNFLTVIA  178

Query  666  GLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAK  845
            GLW++SIVGS C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAK
Sbjct  179  GLWVLSIVGSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAK  238

Query  846  VLSKIPRGPLKDKK  887
            VLSKIPRGPLKDKK
Sbjct  239  VLSKIPRGPLKDKK  252



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 205/252 (81%), Gaps = 3/252 (1%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            A E     ES+++KI DK+H     SSS   ++E+EK     ++ AK+ RLFGR++PVHK
Sbjct  5    AGEHESVVESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGRERPVHK  61

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSN
Sbjct  62   VLGGGKPADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSN  121

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS+FI KS P IPEV +PE+ VL  ASALR ++N  L +LRDIASG++LK FL VI GLW
Sbjct  122  ASTFINKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLW  181

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            ++SI+G+C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA  E+KKQYAVF+ KVLS
Sbjct  182  VLSILGNCWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVFNVKVLS  241

Query  855  KIPRGPLKDKKL  890
            KIPRGPLKDKKL
Sbjct  242  KIPRGPLKDKKL  253



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 203/255 (80%), Gaps = 6/255 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAE    EE   ESL++KI+ KI       SS S   + EK   + S+ +KV RLFGR++
Sbjct  1    MAEHHEHEEAKGESLLDKISGKI---HDHDSSSSSDSDNEKTGPSDSLKSKVFRLFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            P+H VLGGGKQADVFLWRNKKIS   LG AT IWILFE+LEYHLLT VCH +ILALA LF
Sbjct  58   PIHHVLGGGKQADVFLWRNKKISASTLGVATVIWILFELLEYHLLTLVCHFVILALAGLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI K  P IP+VHIPE+P+LQFASALR ++N   +VLRDIASGRDLK FL VI
Sbjct  118  LWSNASTFINKRPPKIPQVHIPEDPILQFASALRIEINRAFSVLRDIASGRDLKKFLSVI  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW+ SI+GS  +FLTLFYIA VLLHTVPVLYEKYED+VD+F EKA+ E+KKQYAVFDA
Sbjct  178  AGLWVFSILGSWANFLTLFYIAFVLLHTVPVLYEKYEDQVDSFGEKAIAEIKKQYAVFDA  237

Query  843  KVLSKIPRGPLKDKK  887
            KVLSKIP+GPLKDKK
Sbjct  238  KVLSKIPKGPLKDKK  252



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/252 (67%), Positives = 200/252 (79%), Gaps = 2/252 (1%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            E    +EESL+EKIADKIH     SSS   + +       SS+ AK+ RLFGR++PVH V
Sbjct  6    EHSEHKEESLMEKIADKIH--FDRSSSSDSEVKPAAAPEASSVKAKIWRLFGREKPVHHV  63

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLWSNA
Sbjct  64   FGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNA  123

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            ++FI K  PHIPEV +PEEP+L+ ASAL  ++N  L++LR+IA+G+DLK FL V+ GLWI
Sbjct  124  TTFINKKRPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKDLKKFLAVVAGLWI  183

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +S+VG+CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAM E+KKQYAVFDA+VLSK
Sbjct  184  LSVVGNCCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMQEIKKQYAVFDARVLSK  243

Query  858  IPRGPLKDKKLA  893
            IP GPLKDKK A
Sbjct  244  IPIGPLKDKKNA  255



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   304 bits (778),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 204/252 (81%), Gaps = 3/252 (1%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            A E     ES+++KI DK+H     SSS   ++E+EK     ++ AK+ RLFGR++PVHK
Sbjct  5    AGEHESVVESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGREKPVHK  61

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK ADVFLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSN
Sbjct  62   VLGGGKPADVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSN  121

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS+FI KS P IPEV +PE+ VL  ASALR ++N  L +LRDIASG++LK FL VI GLW
Sbjct  122  ASTFINKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLW  181

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            ++SI+G+C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA  E+KKQYAVF+ KVLS
Sbjct  182  VLSILGNCWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVFNVKVLS  241

Query  855  KIPRGPLKDKKL  890
            KIPRGPLKDKK 
Sbjct  242  KIPRGPLKDKKF  253



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 179/255 (70%), Positives = 200/255 (78%), Gaps = 6/255 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAE    EE   ESL+EKI+ KI       SS S   + +K   T S  + V RLFGR++
Sbjct  1    MAEHHEHEEVKGESLLEKISGKI---HDHDSSSSSDSDNDKTSATDSFKSNVFRLFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LILALA LF
Sbjct  58   PIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI KS P IP+VHIPEEPVL+FASALR ++N   AVLRDIASGRDLK FL VI
Sbjct  118  LWSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVI  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW+ SI+G   +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E+KKQYAVFDA
Sbjct  178  AGLWVFSILGCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDA  237

Query  843  KVLSKIPRGPLKDKK  887
            KVLSKIPRGPLKDKK
Sbjct  238  KVLSKIPRGPLKDKK  252



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/254 (66%), Positives = 201/254 (79%), Gaps = 6/254 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE +  + ES++EKIADKIH        DS  + ++ K   SS+ +K+ RLFGR +PVH
Sbjct  1    MAEHEAPKAESIMEKIADKIHH------HDSSSDSDDDKPAPSSLKSKIYRLFGRDKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KVLGGGK AD+ LWR+KKIS  VLG  TA+W LFE+ EYHLL+ +CH L+L + VLFLWS
Sbjct  55   KVLGGGKPADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSLICHLLMLTITVLFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NAS+FI K+ P IP+V IPE PVL+ ASAL+ ++N  LA LR+IASG+DLK FL VI GL
Sbjct  115  NASTFINKAPPKIPDVRIPEGPVLEIASALKYEINRGLASLREIASGKDLKKFLAVIAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            WI SI+GSCC+FLTLFYI  V+LHT+PVLYEKYED+VDAFAEKAM E+KKQY VFDAKVL
Sbjct  175  WIFSILGSCCNFLTLFYICFVMLHTLPVLYEKYEDQVDAFAEKAMIEIKKQYIVFDAKVL  234

Query  852  SKIPRGPLKDKKLA  893
            SKIPRGPLKDKK A
Sbjct  235  SKIPRGPLKDKKAA  248



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/253 (72%), Positives = 210/253 (83%), Gaps = 4/253 (2%)
 Frame = +3

Query  132  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA+ FI KS PHIPEV IP+EPVL+F  ALR ++N   AVLRDIA GRDLKMFL VI G
Sbjct  118  SNATQFINKSTPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALGRDLKMFLSVIAG  177

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKV
Sbjct  178  LWVLSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKV  237

Query  849  LSKIPRGPLKDKK  887
            LSKIPRGPLK KK
Sbjct  238  LSKIPRGPLKQKK  250



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 206/253 (81%), Gaps = 0/253 (0%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE      ES++EKI++KIH HDSSSSSDSE + E+K  + SS+ AK+ RLFGR++PVH
Sbjct  1    MAEHPESPIESVMEKISEKIHAHDSSSSSDSESDSEKKPTSPSSVKAKIFRLFGRERPVH  60

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             VLGGGK ADVFLWRNKKIS  VLG ATAIWILFE++EYHLLT VCH  IL LA+LFLWS
Sbjct  61   HVLGGGKPADVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILFLWS  120

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA +FI K+ P IP+VHIPEEPVLQ ASAL  ++NH  AVLR IASG+DLK FL+VI   
Sbjct  121  NAHTFINKTPPRIPQVHIPEEPVLQVASALTMEINHGFAVLRSIASGKDLKKFLVVIAAF  180

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W +SIVG  C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAM E+KKQYA+FDAKVL
Sbjct  181  WALSIVGCWCNFLTLFYITFVLLHTVPVLYEKYEDKVDPFAEKAMIEIKKQYAMFDAKVL  240

Query  852  SKIPRGPLKDKKL  890
            SKIP G LK K++
Sbjct  241  SKIPVGALKAKRV  253



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/259 (65%), Positives = 204/259 (79%), Gaps = 9/259 (3%)
 Frame = +3

Query  144  DRKEEESLVEKIADKI-----HRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            + KEEESL+EKI DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLM----  656
            SNA++FI K  PHIPE H+ EEP+L+ ASALR ++NH L VLR+IASGRDLK FL     
Sbjct  129  SNATTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDLKKFLAVNCS  188

Query  657  VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVF  836
            VI GLW++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYAVF
Sbjct  189  VIAGLWVLSMLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAVF  248

Query  837  DAKVLSKIPRGPLKDKKLA  893
            DA+VLSKIP+GPLKDKK A
Sbjct  249  DARVLSKIPKGPLKDKKKA  267



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++ VH VLGGGK ADVFLWRNKKIS GV+GGATA+W+LFE+LEYHLL+ 
Sbjct  45   IKAKIYRLFGRERSVHNVLGGGKPADVFLWRNKKISAGVIGGATAVWVLFELLEYHLLSL  104

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            VCH LIL+LA+LFLWSNAS+FI K+ P IPE  IPE+  +  A +LR ++N   AVLR+I
Sbjct  105  VCHCLILSLAILFLWSNASTFINKAPPRIPEASIPEDLAVNVALSLRYEINRAFAVLREI  164

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL+VI GLW++SI+GSCC+FLTLFY  +V LHTVPVLYEKYED+VD+FAEKA
Sbjct  165  ASGRDLKKFLVVIAGLWVLSILGSCCNFLTLFYTMLVTLHTVPVLYEKYEDKVDSFAEKA  224

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
            M E+KKQY VFDAKVLSKIPR PLKDKK
Sbjct  225  MAEIKKQYGVFDAKVLSKIPRSPLKDKK  252



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 177/256 (69%), Positives = 208/256 (81%), Gaps = 4/256 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + AK+ RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLF  119

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +FI KS P IPE+H+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FLMVI
Sbjct  120  LWSNAHTFIHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVI  179

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
               W++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDA
Sbjct  180  AAFWVLSIVGSWCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEIKKQYAVFDA  239

Query  843  KVLSKIPRGPLKDKKL  890
            KVLSKIP GPLK KK+
Sbjct  240  KVLSKIPMGPLKAKKV  255



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 176/259 (68%), Positives = 203/259 (78%), Gaps = 8/259 (3%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE + EE   ES++EKIA+KI R     SS S   ++EKK + SS+ AK+ RLFGR+ 
Sbjct  1    MAEEHKHEESAAESIIEKIAEKI-RGYDDGSSSSSDSDDEKKASLSSLKAKIYRLFGREN  59

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH VLGGGK AD+ LWRNKK+S GVLG ATA W+LFE+LEYHLL+ VCH  ILALAVLF
Sbjct  60   PVHNVLGGGKPADIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLF  119

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI K+ P IPEVHIPEE VLQ AS LR ++N   A LRDIASGRDLK FLMVI
Sbjct  120  LWSNASTFIHKTPPRIPEVHIPEEHVLQLASGLRTEINRGFAALRDIASGRDLKKFLMVI  179

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW++SI+GSCC+F+TLFYIA VLL T+PVLYEKYED+VDAF EKAM E+KKQY V D 
Sbjct  180  AGLWVLSILGSCCNFVTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYEVLDE  239

Query  843  KVL----SKIPRGPLKDKK  887
            KVL    SKIPRG L  KK
Sbjct  240  KVLSKIMSKIPRGALSKKK  258



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 210/256 (82%), Gaps = 4/256 (2%)
 Frame = +3

Query  132  MAEEDR---KEEESLVEKIADKIHR-HdsssssdsekeeeekkkttssMDAKVRRLFGRQ  299
            MAE++       +SLV++I++KIH   D+SSSSDS+ + +E     +S+ AK+ RLFGR+
Sbjct  1    MAEQEEISDPRTDSLVDRISEKIHGGDDTSSSSDSDSQVKEAASPPASVKAKIYRLFGRE  60

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKV GGGK AD+FLWRNKKIS  VLGGATA+W+LFE+LEYHLLT VCH  ILAL++L
Sbjct  61   KPVHKVFGGGKPADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLL  120

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNA++FI K  PHIPEV +PE+P L+ AS LR ++N   AVLR+IASGRDLK FLMV
Sbjct  121  FLWSNATTFINKRPPHIPEVRLPEDPFLEVASVLRTEINRGFAVLREIASGRDLKKFLMV  180

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            + GLW +SIVGS C+FLTLFYI  +LLHTVPVLYEKY+D++DAFAEKAM ++KKQYAVFD
Sbjct  181  VVGLWALSIVGSFCNFLTLFYIVFILLHTVPVLYEKYDDKIDAFAEKAMIQIKKQYAVFD  240

Query  840  AKVLSKIPRGPLKDKK  887
            AKVLSKIPRGPL  K+
Sbjct  241  AKVLSKIPRGPLGKKR  256



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 205/255 (80%), Gaps = 5/255 (2%)
 Frame = +3

Query  144  DRKEEESLVEKIADKIHRHdssss-----sdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            +  EEESL+EKI DKIH    SSS     ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYNEEESLIEKIEDKIHFDHFSSSSSDSDTEKKPASAPEAASPSSVKAAIWRLFGREKPV  68

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H+V GGGK ADVFLWRNKK+S  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKVSASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA++FI K  PHIPEVH+PEEP+L+ ASALR ++N+ L VLR+IASGRDL  FL VI G
Sbjct  129  SNATTFINKKRPHIPEVHLPEEPILEIASALRIEINYTLRVLREIASGRDLTKFLSVIAG  188

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD   EKA+ E+KKQYAVFDAKV
Sbjct  189  LWVLSVLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLVEKAVKEIKKQYAVFDAKV  248

Query  849  LSKIPRGPLKDKKLA  893
            LSKIP+GPL+DKK A
Sbjct  249  LSKIPKGPLRDKKKA  263



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 178/258 (69%), Positives = 209/258 (81%), Gaps = 6/258 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsek---eeeekkkttssMDAKVRRLFG  293
            MA+ +  EE   ESL++KI+ KIH H  SSSS S+    ++E+K  + +S+  KV RLFG
Sbjct  1    MADHNEHEEVKSESLLDKISGKIHDHHDSSSSSSDSDNDKKEKKVSSPTSLKNKVFRLFG  60

Query  294  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  473
            R++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H  ILALA
Sbjct  61   REKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALA  120

Query  474  VLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFL  653
            VLFLWSNAS+FI KS P IP+VHIPEEPVLQ ASA+R ++N   A+LRDIASGRDLK FL
Sbjct  121  VLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFL  180

Query  654  MVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAV  833
             VI GLW++SIVGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+HE KKQYAV
Sbjct  181  SVIAGLWVLSIVGSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAV  240

Query  834  FDAKVLSKIPRGPLKDKK  887
            FD KVLSKIP+GPLKDKK
Sbjct  241  FDEKVLSKIPKGPLKDKK  258



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            +  KV RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT 
Sbjct  28   LKNKVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTL  87

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            + H  ILALAVLFLWSNAS+FI KS P IP+VHIPEEPVLQ ASA+R ++N   A+LRDI
Sbjct  88   ISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDI  147

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL VI GLW++SIVGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA
Sbjct  148  ASGRDLKQFLSVIAGLWVLSIVGSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKA  207

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
            +HE KKQYAVFD KVLSKIP+GPLKDKK
Sbjct  208  LHEFKKQYAVFDEKVLSKIPKGPLKDKK  235



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 202/250 (81%), Gaps = 9/250 (4%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            +E+ K++ESL+EKIADK+H HDSSSSS S   +++K  +   + AKV RLFGR++PVH+V
Sbjct  6    KEEEKKDESLIEKIADKVHGHDSSSSSSSSDSDDDKTSS---LKAKVYRLFGREKPVHRV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLWS+ 
Sbjct  63   LGGGKPADIFLWXXXX------GGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSI  116

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
             +FI KS P IPEV IPEEP L+FASALR ++NH  AVLRDIASGRDLK FL V+ GLWI
Sbjct  117  MTFINKSPPRIPEVSIPEEPALKFASALRVEINHGFAVLRDIASGRDLKKFLSVVAGLWI  176

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +S+VG CCDFLTL Y   VLL TVP+ YEKYED+VD+FAEKAM E+KKQY VFDA+VLSK
Sbjct  177  LSVVGGCCDFLTLLYTITVLLFTVPLFYEKYEDQVDSFAEKAMAEVKKQYVVFDARVLSK  236

Query  858  IPRGPLKDKK  887
            IPRGPLKDKK
Sbjct  237  IPRGPLKDKK  246



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 208/258 (81%), Gaps = 4/258 (2%)
 Frame = +3

Query  123  ESAMAEE---DRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  293
            ESA+A E   +  E ESL++KI++KIH H S SSS S+ E+E+K  + SS+ AKV RLFG
Sbjct  9    ESALATEPAVEVVERESLLDKISEKIH-HGSDSSSSSDDEDEKKASSPSSLKAKVYRLFG  67

Query  294  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  473
            R++PVHKVLGGGK AD+F+WRNKK+S  VLGG TA+W+LFE+ EYHLLT +CH LI  +A
Sbjct  68   REKPVHKVLGGGKPADIFMWRNKKMSASVLGGITAVWVLFELAEYHLLTLLCHVLIAVIA  127

Query  474  VLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFL  653
            VLFLWSNAS FI KS P IPEVHIPEEP+LQ AS LR ++N     LRDIASGRDLK FL
Sbjct  128  VLFLWSNASMFIHKSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFL  187

Query  654  MVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAV  833
              I GLW++SI+G CC+FLTL YIA+V+L T+PVLYEKYED+VDA+ EKAM E+KKQYAV
Sbjct  188  SAIAGLWVLSILGGCCNFLTLSYIAMVMLFTIPVLYEKYEDKVDAYGEKAMVEIKKQYAV  247

Query  834  FDAKVLSKIPRGPLKDKK  887
             D KVLSKIPRGPLK KK
Sbjct  248  LDEKVLSKIPRGPLKGKK  265



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 176/256 (69%), Positives = 210/256 (82%), Gaps = 4/256 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MA+E   ++   ES++EKI++KIH +DSSSSSDS+ + E+    +S + AK+ RLFGR++
Sbjct  1    MADESESKQSAVESMMEKISEKIHGNDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLF  119

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +FI KS P IPE+H+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FLMVI
Sbjct  120  LWSNAHTFIHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVI  179

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
               W++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDA
Sbjct  180  AAFWVLSIVGSWCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEVKKQYAVFDA  239

Query  843  KVLSKIPRGPLKDKKL  890
            KVLSKIP GPLK KK+
Sbjct  240  KVLSKIPMGPLKAKKV  255



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 175/259 (68%), Positives = 207/259 (80%), Gaps = 8/259 (3%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE + EE   ES++EKIA+KI  HD  SSS S+ ++E+K   +S + AK+ RLFGR++
Sbjct  1    MAEEHKHEESTAESIMEKIAEKIRGHDDGSSSSSDSDDEKKSSPSS-LKAKIYRLFGREK  59

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH VLGGGK AD+FLWRNKK+S G LG ATA W+LFE+LEYHLLT VCH  I ALAVLF
Sbjct  60   PVHSVLGGGKPADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLF  119

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI K+ P IP VHIPEEPV+Q AS LR +VN     LRDIASGRDLK FL+VI
Sbjct  120  LWSNASTFIHKTPPRIPHVHIPEEPVIQLASGLRFEVNRGFTALRDIASGRDLKKFLVVI  179

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD-  839
            +GLW++SI+GSCC+F+TLFYIA VLL TVPVLYEKYED+VDAF EKAM E+KKQYAV D 
Sbjct  180  SGLWVLSILGSCCNFVTLFYIATVLLFTVPVLYEKYEDQVDAFGEKAMKEIKKQYAVLDE  239

Query  840  ---AKVLSKIPRGPLKDKK  887
               +KV+SKIPRG L  KK
Sbjct  240  KVLSKVMSKIPRGALTKKK  258



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 173/256 (68%), Positives = 198/256 (77%), Gaps = 6/256 (2%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdse------keeeekkkttssMDAKVRRLFGRQ  299
            EE   + ESL+EK A+KIH H    SS S       K+             K+ RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+L
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAIL  124

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNA++FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V
Sbjct  125  FLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLV  184

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            +   W+ SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD
Sbjct  185  VAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFD  244

Query  840  AKVLSKIPRGPLKDKK  887
             KVLSKIPRGPLKDKK
Sbjct  245  EKVLSKIPRGPLKDKK  260



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 205/252 (81%), Gaps = 2/252 (1%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            A E     ES++EKI +K+H H+SSSS   +++E+        + AK+ RLFGR++PVHK
Sbjct  5    AGEHEPVVESVMEKINEKLHDHNSSSSDSEDEKEKISSVDA--VKAKIYRLFGRERPVHK  62

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSN
Sbjct  63   VLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSN  122

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS+FI KS P IP+V +PE+ VL  A+ALR ++N  L V RDIASG++LK FL VI GLW
Sbjct  123  ASTFINKSPPQIPDVILPEDIVLGVAAALRIEINRALEVFRDIASGKELKKFLGVIAGLW  182

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            ++SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  E+KKQYAVF+ KVLS
Sbjct  183  VLSILGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEAEIKKQYAVFNVKVLS  242

Query  855  KIPRGPLKDKKL  890
            KIPRGPLKDKKL
Sbjct  243  KIPRGPLKDKKL  254



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 173/257 (67%), Positives = 211/257 (82%), Gaps = 4/257 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQ  299
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ AK+ RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVL
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSN  +FI K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V
Sbjct  121  FLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNLKKFLVV  180

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            +   W++S+VGS C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFD
Sbjct  181  VAAFWVLSVVGSWCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFD  240

Query  840  AKVLSKIPRGPLKDKKL  890
            A VLSKIP GPLK KK+
Sbjct  241  ANVLSKIPTGPLKSKKV  257



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLG ATAIW+LFE++EYHLLT 
Sbjct  44   VKAKIYRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTL  103

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            VCH LIL+LA+LFLWSNAS+FI KS+PHIPEV IPE+  +  A +LR ++N   AVLRDI
Sbjct  104  VCHCLILSLAILFLWSNASTFINKSSPHIPEVSIPEDVAVDVALSLRYEINRGFAVLRDI  163

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGR+LK FLMVI GLW++SI+G+CC+FLTLFYI  V LHTVPVLYEKYED+VD FAEK 
Sbjct  164  ASGRELKKFLMVIAGLWVLSIIGTCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKV  223

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
            M E+KK YA F AK LSKIPRGPLK+KK
Sbjct  224  MAEIKKHYATFHAKCLSKIPRGPLKEKK  251



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            + V RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VC
Sbjct  46   SNVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVC  105

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            H LILALA LFLWSNAS+FI KS P IP+VHIPEEPVL+FASALR ++N   AVLRDIAS
Sbjct  106  HFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIAS  165

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            GRDLK FL VI GLW+ SI+G   +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ 
Sbjct  166  GRDLKKFLSVIAGLWVFSILGCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIA  225

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  226  EIKKQYAVFDAKVLSKIPRGPLKDKK  251



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 173/256 (68%), Positives = 199/256 (78%), Gaps = 6/256 (2%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeee------kkkttssMDAKVRRLFGRQ  299
            EE   + ESL+EK A+KIH H    SS S   ++E                K+ RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+L
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAIL  124

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNA++FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V
Sbjct  125  FLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLV  184

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            +   W+ SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD
Sbjct  185  VAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFD  244

Query  840  AKVLSKIPRGPLKDKK  887
             KVLSKIPRGPLKDKK
Sbjct  245  EKVLSKIPRGPLKDKK  260



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 173/266 (65%), Positives = 207/266 (78%), Gaps = 15/266 (6%)
 Frame = +3

Query  132  MAEEDRKEE--------------ESLVEKIADKIHRHdsssssdsekeeeekkkttssMD  269
            MAEE + EE              ESL++KI++KIH H   SSS S+ E+E+K  + SS+ 
Sbjct  1    MAEEQKHEETAAAPEPAVEVLERESLLDKISEKIH-HGGDSSSSSDDEDEKKASSLSSLQ  59

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            AKV RLFGR++PVHKVLGGGK AD+F+WRNKK+S GVLGG TA+W+LFE+++YHLLT  C
Sbjct  60   AKVYRLFGREKPVHKVLGGGKPADIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFC  119

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            H LI+ LAVLFLWSNAS FI KS P IPEVHIPEE +LQ AS LR ++N     LRDIAS
Sbjct  120  HILIVVLAVLFLWSNASIFINKSPPKIPEVHIPEEHILQLASGLRIEINRAFTCLRDIAS  179

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            GRDLK FL  I GLW++S++GS C+FLTL YIA+V+L TVPV+YEKYED+VDAF EKAM 
Sbjct  180  GRDLKKFLSAIAGLWVLSVIGSWCNFLTLSYIAMVMLFTVPVMYEKYEDKVDAFGEKAMV  239

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            E+KKQYAV D KV SKIPRGPLKDKK
Sbjct  240  EIKKQYAVLDEKVFSKIPRGPLKDKK  265



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   298 bits (764),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 212/252 (84%), Gaps = 4/252 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE D+  E+S++E + +K+H H++SS SDS+  + + +  +  + +K+ RLFGR++PVH
Sbjct  1    MAEHDK--EDSVIESVMEKVHDHETSSDSDSDHGKPKSESDS--LKSKIYRLFGREKPVH  56

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KVLGGGK AD+FLWRNKKIS G+LGGATAIW+LFE+LE HLLT VC+ LILAL +LFLWS
Sbjct  57   KVLGGGKPADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTLVCYFLILALVLLFLWS  116

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NAS+FI KS PHIPEV IPEEPVLQ A+AL  ++N   +VLRDIASGRDLK FL VI GL
Sbjct  117  NASTFINKSPPHIPEVRIPEEPVLQIAAALTTEINWAFSVLRDIASGRDLKKFLSVIAGL  176

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVGS C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVL
Sbjct  177  WVLSIVGSWCNFLTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVL  236

Query  852  SKIPRGPLKDKK  887
            SKIPRGPLK KK
Sbjct  237  SKIPRGPLKGKK  248



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   298 bits (764),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 175/256 (68%), Positives = 210/256 (82%), Gaps = 4/256 (2%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +  + AK+ RLFGR++
Sbjct  1    MAEESESKQSTVESVMEKISGKIHGHDSSSSSDSDSDHEKPASPSP-VKAKIYRLFGRER  59

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EY+LLT VCH  IL+LA++F
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTLVCHISILSLALMF  119

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +FI KS P IPEVH+PEEP LQ A+AL  ++N  L +LRDIASGR+LK FLMVI
Sbjct  120  LWSNAHTFIHKSPPRIPEVHLPEEPFLQVAAALTFELNQALKLLRDIASGRNLKKFLMVI  179

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
               W++SIVGS C+FLTLFYI+ VLLHTV VLYEKYED+VD  AEKAM E+KKQYAVFDA
Sbjct  180  AAFWVLSIVGSWCNFLTLFYISFVLLHTVLVLYEKYEDKVDPCAEKAMIEIKKQYAVFDA  239

Query  843  KVLSKIPRGPLKDKKL  890
            KVLSKIP+GPLK KK+
Sbjct  240  KVLSKIPKGPLKTKKV  255



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   300 bits (768),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 173/256 (68%), Positives = 198/256 (77%), Gaps = 6/256 (2%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdse------keeeekkkttssMDAKVRRLFGRQ  299
            EE   + ESL+EK A+KIH H    SS S       K+             K+ RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+L
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAIL  124

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNA++FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V
Sbjct  125  FLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLV  184

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            +   W+ SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD
Sbjct  185  VAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFD  244

Query  840  AKVLSKIPRGPLKDKK  887
             KVLSKIPRGPLKDKK
Sbjct  245  EKVLSKIPRGPLKDKK  260



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 198/252 (79%), Gaps = 6/252 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            M E + K E SL+EK+A+KIH HDSSS SD++K  E        + AKV RLFGR++ VH
Sbjct  1    MGEHEEKHEGSLMEKLAEKIHGHDSSSDSDNDKPSESS------IKAKVFRLFGRERSVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             V GGGK AD FLWRNKKIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLWS
Sbjct  55   HVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA +FI KS   IPEVHIP++PV++FA ALR + N    VLRDIA GRDLK FL VI GL
Sbjct  115  NAYAFINKSPLCIPEVHIPKDPVIEFAEALRFESNLAFTVLRDIAPGRDLKKFLYVIAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            WI+SIVGS C+F+TLFY+  VLLH+VPVLYEKYED+VD FAEKAMHE+KKQ AVF+AKVL
Sbjct  175  WILSIVGSWCNFVTLFYLVFVLLHSVPVLYEKYEDKVDPFAEKAMHEIKKQCAVFNAKVL  234

Query  852  SKIPRGPLKDKK  887
            SKIPRGP K+K 
Sbjct  235  SKIPRGPSKEKN  246



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 205/253 (81%), Gaps = 3/253 (1%)
 Frame = +3

Query  132  MAEEDRKE-EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            MAE++ +   ESL+EKI +K H  DSSSSSDS+ E+     ++  + +K+ RLFGR++PV
Sbjct  1    MAEKNEESVGESLMEKITEKFHHEDSSSSSDSDNEKSLPSSSS--VQSKIYRLFGREKPV  58

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H VLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLW
Sbjct  59   HTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLW  118

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA++FI KS PHIPEV IPE+  +  A +LR D+N   AVLRDIASGRDLK FL+VI G
Sbjct  119  SNATTFINKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAG  178

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E+KK YA   AK 
Sbjct  179  LWVLSIIGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKC  238

Query  849  LSKIPRGPLKDKK  887
            LSKIP+G LK+KK
Sbjct  239  LSKIPKGALKEKK  251



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/251 (66%), Positives = 199/251 (79%), Gaps = 6/251 (2%)
 Frame = +3

Query  144  DRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            + KEE   ES++EKI +K H      SS S+ + E+ K ++S + +++ RLFGR++PVH 
Sbjct  3    ENKEESVGESVMEKIMEKFHD---DDSSSSDSDNEKSKPSSSPVKSQIYRLFGREKPVHT  59

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGG  ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  VCH LIL+LA+LFLWSN
Sbjct  60   VLGGGTPADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCHCLILSLAILFLWSN  119

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS+FI KS P IPEV IPE+  +  A +LR ++N    VLRDIASGRDLK FL+VI GLW
Sbjct  120  ASTFIHKSPPRIPEVSIPEDVAVNVALSLRYEINRGFTVLRDIASGRDLKKFLVVIAGLW  179

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            ++SIVGSCC+FLTLFYIA V LHTVPVLYEKYED+VD FAEK M E+KK YA F AK LS
Sbjct  180  VLSIVGSCCNFLTLFYIAFVTLHTVPVLYEKYEDKVDPFAEKVMTEVKKHYATFHAKCLS  239

Query  855  KIPRGPLKDKK  887
            KIPRGPLK+KK
Sbjct  240  KIPRGPLKEKK  250



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 203/263 (77%), Gaps = 9/263 (3%)
 Frame = +3

Query  132  MAEE----DRKEEESLVEKIADKIH-----RHdsssssdsekeeeekkkttssMDAKVRR  284
            MAE+       +EES +EKIADKIH        SS S    K     + + SS+ AK+ R
Sbjct  1    MAEQVEQHSEHKEESFMEKIADKIHFDRSSSSSSSDSDSEVKPAAAPEASPSSVKAKIWR  60

Query  285  LFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLIL  464
            LFGR++PVH V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI 
Sbjct  61   LFGREKPVHHVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIF  120

Query  465  ALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLK  644
             LAVLFLWSNA++FI K  PHIPEV +PEEP+L+ ASAL  ++N  L++LR+IA+G+D K
Sbjct  121  TLAVLFLWSNATTFINKKRPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKDPK  180

Query  645  MFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQ  824
             FL V+TGLWI+S+VG+CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA+ E+KKQ
Sbjct  181  KFLAVVTGLWILSVVGNCCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQ  240

Query  825  YAVFDAKVLSKIPRGPLKDKKLA  893
            YA+FDAKVLSKIP GPLKDKK A
Sbjct  241  YAIFDAKVLSKIPIGPLKDKKNA  263



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = +3

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LI
Sbjct  49   RLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLI  108

Query  462  LALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDL  641
            L+LA+LFLWSNA++FI KS P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDL
Sbjct  109  LSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDL  168

Query  642  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  821
            K FLMVI GLW++SIVGSCC+FLTLFYIA V LHT+PVLYEKYED+VD+FAEKAM ++KK
Sbjct  169  KKFLMVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTLPVLYEKYEDKVDSFAEKAMTKVKK  228

Query  822  QYAVFDAKVLSKIPRGPLKDK  884
             YA F+AK LSKIPRGPLK K
Sbjct  229  NYATFNAKCLSKIPRGPLKKK  249



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 200/250 (80%), Gaps = 3/250 (1%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            +E+ K  ES +EKIA+KIH H SSSSS S   ++EK  +   + +KV RLFGR++PVHKV
Sbjct  6    KEEEKHGESFMEKIAEKIHGHGSSSSSSSSDSDDEKTAS---LKSKVYRLFGREKPVHKV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGG+ AD+ LW++KK+S GVLGG TAIW+LF++LEYHLL  VCHGLIL L  LFL+SNA
Sbjct  63   LGGGQPADLLLWKDKKVSGGVLGGVTAIWVLFDLLEYHLLALVCHGLILGLVGLFLYSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            S+FIKKS P IP V IPEEPVL FASALR  +N   A LRDIASG+DLK FL VI GLW+
Sbjct  123  STFIKKSPPKIPVVSIPEEPVLNFASALRIGINEGFATLRDIASGKDLKKFLSVIAGLWV  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +S  GSCCDFLTL Y   VLL TVP++Y+KYED+VD FAEKAM E+KKQYAVF+ KVLSK
Sbjct  183  LSFFGSCCDFLTLLYSITVLLFTVPLVYDKYEDQVDCFAEKAMVEIKKQYAVFNTKVLSK  242

Query  858  IPRGPLKDKK  887
            IPRGPLK+KK
Sbjct  243  IPRGPLKEKK  252



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 204/250 (82%), Gaps = 2/250 (1%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            E D  + ESL++KI+ KIH     SSS S+ + E+K  + S++ +KV RLFGR++P+H V
Sbjct  6    EHDESKGESLLDKISGKIHD--HDSSSSSDSDNEKKNPSPSTLKSKVFRLFGREKPLHNV  63

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK ADVFLWRNKKIS  VLG ATA WILFE+LEYHLLT VCH  ILALAVLFLWSNA
Sbjct  64   LGGGKPADVFLWRNKKISATVLGVATASWILFELLEYHLLTLVCHLAILALAVLFLWSNA  123

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            S+FI K+ P IP+VHIPEEPVLQ A+ALR ++N   AVLRDIASG+DLK FL VI GLW+
Sbjct  124  STFINKAPPKIPQVHIPEEPVLQIAAALRIEINRVFAVLRDIASGKDLKKFLSVIAGLWV  183

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +SIVGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E KKQYAVFDAKVLSK
Sbjct  184  LSIVGSWANFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALAEFKKQYAVFDAKVLSK  243

Query  858  IPRGPLKDKK  887
            IP+G LK+KK
Sbjct  244  IPKGALKNKK  253



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/257 (63%), Positives = 191/257 (74%), Gaps = 4/257 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekee----eekkkttssMDAKVRRLFGRQ  299
            MAE +    ESL+EKI +K H  DSSSS    ++              + AK+ RLFGR+
Sbjct  1    MAEHEESVAESLLEKITEKFHGGDSSSSDSDGEKSSVVDSSAPSAAEVVKAKIYRLFGRE  60

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWRNKK+S   LGGATAIW+LFE++EYHLLT VCH LIL+LA++
Sbjct  61   KPVHKVLGGGKPADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTFVCHSLILSLAIM  120

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNAS+FI KS P IPEV IPE+  +  A +LR ++N   A LRDIA GRDLK FL V
Sbjct  121  FLWSNASTFINKSPPRIPEVSIPEDMAVNIALSLRYEINWAFAALRDIALGRDLKKFLSV  180

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            I GLW+ SI+G+ C+FLTLFYIA V LHTVP LYEKYED+VDAFAEKA  E KK Y+V  
Sbjct  181  IAGLWVFSIIGNFCNFLTLFYIAFVTLHTVPPLYEKYEDKVDAFAEKAQTEFKKHYSVIH  240

Query  840  AKVLSKIPRGPLKDKKL  890
            AK LSKIP+GPLKDKK 
Sbjct  241  AKYLSKIPKGPLKDKKF  257



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 198/254 (78%), Gaps = 8/254 (3%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            A E    ++SLVEKI DKIH HDSSSS   + +            +KV RLFGR++P+H 
Sbjct  5    APEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW
Sbjct  121  ASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLW  180

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----A  842
            ++SIVG+ C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     
Sbjct  181  LLSIVGNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLK  240

Query  843  KVLSKIPRGPLKDK  884
            KVLS+IP+G LK K
Sbjct  241  KVLSRIPKGALKKK  254



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   296 bits (759),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 195/252 (77%), Gaps = 2/252 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE   KEEESLVE + DKI          S    +   + T+ + AK+ RLFGR++PVH
Sbjct  1    MAE--HKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             VLGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWS
Sbjct  59   SVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+V+ GL
Sbjct  119  NASTFINKSPPNIPEVKIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVVGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++S++GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K L
Sbjct  179  WVLSVLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAMIELKKYYAIFDEKCL  238

Query  852  SKIPRGPLKDKK  887
            SKIP+GPLK+KK
Sbjct  239  SKIPKGPLKNKK  250



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   296 bits (759),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 198/254 (78%), Gaps = 8/254 (3%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            A E    ++SLVEKI DKIH HDSSSS   + +            +KV RLFGR++P+H 
Sbjct  5    APEHESADKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW
Sbjct  121  ASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLW  180

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----A  842
            ++SIVG+ C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     
Sbjct  181  LLSIVGNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLK  240

Query  843  KVLSKIPRGPLKDK  884
            KVLS+IP+G LK K
Sbjct  241  KVLSRIPKGALKKK  254



>ref|XP_009598008.1| PREDICTED: reticulon-like protein B2, partial [Nicotiana tomentosiformis]
Length=197

 Score =   294 bits (753),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +3

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H VL GG  ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CH LI+ALA LFLW
Sbjct  3    HDVLFGGAAADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHCLIVALAGLFLW  62

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNAS+FI KSAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+GRDLKMFLMVI G
Sbjct  63   SNASAFIHKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKMFLMVIGG  122

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LWI+S++GSCCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA HELKKQYAVFDAKV
Sbjct  123  LWILSVLGSCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKAFHELKKQYAVFDAKV  182

Query  849  LSKIPRGPLKDKKLA  893
            LSKIPRGPL+DKK A
Sbjct  183  LSKIPRGPLRDKKKA  197



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 202/246 (82%), Gaps = 3/246 (1%)
 Frame = +3

Query  150  KEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  329
            + EE+LVEK+A++I    SSSSSDS+ ++         + +KV RLFGR++P+H VLG G
Sbjct  3    EHEETLVEKVAEEIQGDASSSSSDSDDDKPFHADA---LKSKVYRLFGREKPIHHVLGAG  59

Query  330  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFI  509
            K ADVFLWR+KKIS GVLGGATA+WILFE+LEYHL+T +CH LIL+LA+LFLWSNAS+FI
Sbjct  60   KPADVFLWRDKKISAGVLGGATALWILFEMLEYHLITLLCHTLILSLAILFLWSNASTFI  119

Query  510  KKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIV  689
             KS P+IPEV +PE+ VL+ ASALR +VN  L V+RDIASG DLK FL VI GLW +S+V
Sbjct  120  NKSPPNIPEVVLPEKCVLEVASALRIEVNRALDVVRDIASGNDLKKFLGVIVGLWALSLV  179

Query  690  GSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRG  869
            G+CC+FLTLFYI  VLLHTVPV YE YED+VD+F+EKA+ E+KKQYA FD KVLSKIP+G
Sbjct  180  GNCCNFLTLFYIVFVLLHTVPVFYEIYEDQVDSFSEKAIIEIKKQYAAFDEKVLSKIPKG  239

Query  870  PLKDKK  887
            PLK+KK
Sbjct  240  PLKEKK  245



>ref|XP_012083295.1| PREDICTED: reticulon-like protein B5 [Jatropha curcas]
 gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 171/254 (67%), Positives = 203/254 (80%), Gaps = 1/254 (0%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQQPV  308
            MAE      ES++EKI++ IH HDSSSSS     +  +K  + SS+ AK+ RLFGR++PV
Sbjct  1    MAEHHENPIESVMEKISETIHAHDSSSSSSDSDSDSEKKPTSPSSVKAKIFRLFGRERPV  60

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H VLGGGK ADV LWRNKKIS  VLG ATAIW+LFE++EYHLLT  CH LIL+LAVLFLW
Sbjct  61   HHVLGGGKPADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVLFLW  120

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA +FI K+ P IP++H+PEEP L  ASAL  ++N  LAVLRDIASG+DLK FL+VI  
Sbjct  121  SNAHTFINKTPPRIPQIHLPEEPFLLVASALTLEINRGLAVLRDIASGKDLKKFLIVIAA  180

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++SIVGS C+FLTLFYI+ VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKV
Sbjct  181  LWVVSIVGSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDAKV  240

Query  849  LSKIPRGPLKDKKL  890
            LSKIP G LK K++
Sbjct  241  LSKIPVGALKAKRV  254



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 172/245 (70%), Positives = 197/245 (80%), Gaps = 3/245 (1%)
 Frame = +3

Query  159  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++KIA+KIH HD SSSS     ++++  +   +  KV RLFGR++PVH VLGGGK A
Sbjct  73   ESLLDKIAEKIHGHDDSSSSSDSDSDKKESSS---IKEKVFRLFGREKPVHSVLGGGKPA  129

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  518
            DV LWRNKKIS GVLG ATAIWI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI K+
Sbjct  130  DVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLFLWSNAHTFIHKA  189

Query  519  AphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSC  698
             P IP VHIPEEP+LQFASAL  ++N   A LR I SGRDLK FL+VI G WIISIVGS 
Sbjct  190  PPRIPVVHIPEEPILQFASALTIEINRGFAALRAIGSGRDLKTFLIVIVGTWIISIVGSW  249

Query  699  CDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  878
            C+FLTLFYIA VLLHTVPVLY+KYED++D  AEKA+ E KKQYAVFD KVLSKIP+GPLK
Sbjct  250  CNFLTLFYIAFVLLHTVPVLYDKYEDKIDPLAEKALVEFKKQYAVFDEKVLSKIPKGPLK  309

Query  879  DKKLA  893
            +KKLA
Sbjct  310  EKKLA  314



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 173/290 (60%), Positives = 218/290 (75%), Gaps = 8/290 (3%)
 Frame = +3

Query  132  MAEEDRKE-EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            MAE++ +   ESL+EKI +K H  DSSSSSDS+ E+ +   ++  + +K+ RLFGR++PV
Sbjct  1    MAEKNEESVGESLMEKITEKFHHEDSSSSSDSDNEKSQPSSSS--VQSKIYRLFGREKPV  58

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H VLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLW
Sbjct  59   HTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLW  118

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA++FI KS PHIPEV IPE+  +  A +LR D+N   AVLRDIASGRDLK FL+VI G
Sbjct  119  SNATTFINKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAG  178

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E+KK YA   AK 
Sbjct  179  LWVLSIIGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKC  238

Query  849  LSKIPRGPLKDKKLA*DCNSVWCHYVRMCN*SLKNLCFSVIYQQTCWICH  998
            LSKIP+G LK +     C   +C +V  C      +  S++ + + W  H
Sbjct  239  LSKIPKGALKRRS---SCR--FCQFVASCGFLCVVVTLSILLRTSTWCMH  283



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 205/253 (81%), Gaps = 2/253 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  + ++S VE + +KIH HDSSSSSDS+ + E+     S + AK+ RLFGR++P+H
Sbjct  1    MAEET-ESKQSAVESVMEKIHGHDSSSSSDSDSDHEKPASPIS-VKAKIYRLFGRERPLH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LAVLFLWS
Sbjct  59   HVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            N  +FI K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   
Sbjct  119  NVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALKLLRDIASGRNLKKFLVVVAAF  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++S+VGS C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFDAKVL
Sbjct  179  WVLSVVGSWCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDAKVL  238

Query  852  SKIPRGPLKDKKL  890
             KIP GPLK KK+
Sbjct  239  GKIPTGPLKTKKV  251



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   293 bits (751),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 200/255 (78%), Gaps = 3/255 (1%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MA+  ++EE   ESL++K+ DK+H HDSSSSS S    +      + +  KV RLFGR++
Sbjct  1    MADHHKEEENKGESLIDKVTDKMHAHDSSSSSSSSSSSDSDDDRKARLKTKVYRLFGREK  60

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHK+LGGG+ ADV LWR+KK+S GVLGGA A+W LF+VLEYH LT +CHGLIL L  +F
Sbjct  61   PVHKILGGGQGADVLLWRDKKVSAGVLGGAAALWFLFDVLEYHFLTLICHGLILGLVAMF  120

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            L SNAS+F+KK+ P IPEV +PEEPVL+FASALR ++N   A LRDIASG+DLK FL VI
Sbjct  121  LLSNASTFVKKAPPRIPEVVLPEEPVLKFASALRIEINRVFADLRDIASGKDLKKFLYVI  180

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW++S+VG  CDF+TL +   +LL TVP LYEK ED+VD +AEKA+ ELKKQYAVFDA
Sbjct  181  GGLWVLSVVGGICDFMTLIFSITLLLFTVPFLYEKNEDQVDCYAEKAIAELKKQYAVFDA  240

Query  843  KVLSKIPRGPLKDKK  887
            KVLSKIPRGPLKDKK
Sbjct  241  KVLSKIPRGPLKDKK  255



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   293 bits (751),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 202/248 (81%), Gaps = 2/248 (1%)
 Frame = +3

Query  153  EEESLVEKIADKIHRHdsssssdsekeeeekkktts--sMDAKVRRLFGRQQPVHKVLGG  326
            E ES+VE + +KI+       S S   E++K+K +S  ++ AK+ RLFGR++PVHKVLGG
Sbjct  7    EHESVVESVMEKINDKLHDHDSSSSDSEDDKEKISSVDAVKAKIYRLFGRERPVHKVLGG  66

Query  327  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  506
            GK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNAS+F
Sbjct  67   GKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNASTF  126

Query  507  IKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  686
            I KS P IP+V +PE+ VL  A+ALR ++N  L + RDIASG++LK FL VI GLW++SI
Sbjct  127  INKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDIASGKELKKFLAVIAGLWVLSI  186

Query  687  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  866
            +G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  E+KKQYAVF+ KVLSKIPR
Sbjct  187  LGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPR  246

Query  867  GPLKDKKL  890
            GPLKDKK 
Sbjct  247  GPLKDKKF  254



>gb|KJB52210.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=250

 Score =   293 bits (750),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 198/242 (82%), Gaps = 5/242 (2%)
 Frame = +3

Query  162  SLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  341
            SL+++IA+KI  HDSSSS     +  E       + AKV  LFGR++PVH VLGGGK AD
Sbjct  12   SLMDRIAEKIQAHDSSSSDSDNDKPSEST-----IKAKVFHLFGREKPVHHVLGGGKPAD  66

Query  342  VFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSA  521
            +FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALA+LFLWSNA++F+ KS 
Sbjct  67   IFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNAATFVNKSP  126

Query  522  phipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCC  701
            P IPEV IP++PV++FA ALR ++N   AVLRDIASGRDLK FL VI GLWI+SIVGS C
Sbjct  127  PRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWILSIVGSWC  186

Query  702  DFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKD  881
            +FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVL KIPRGPLK+
Sbjct  187  NFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLRKIPRGPLKE  246

Query  882  KK  887
            KK
Sbjct  247  KK  248



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 203/255 (80%), Gaps = 4/255 (2%)
 Frame = +3

Query  135  AEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  305
            A E  K E   ESL++KI +K H  DSSSS   + ++  K   +S+  AK+ RLFGR+QP
Sbjct  5    ASEHEKHESAAESLIDKITEKFHGSDSSSSDSDDDDKGIKSAASSAK-AKIYRLFGREQP  63

Query  306  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  485
            VHKVLGGGK AD+FLWR+KK+S GVLG ATAIW+LFE++EYHLL+ VCH LIL LA++FL
Sbjct  64   VHKVLGGGKPADIFLWRDKKVSAGVLGFATAIWVLFELIEYHLLSLVCHILILGLAIIFL  123

Query  486  WSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVIT  665
            WSNASSFI KS P IPEV + E+ V+  A+ALR + N   A+LRDI SG+DLK FL VI 
Sbjct  124  WSNASSFINKSPPKIPEVVVREDIVIGVANALRIEFNRAFAILRDIVSGKDLKKFLAVIA  183

Query  666  GLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAK  845
            GLW++S++GSC +FLTLFYI  VLLHTVP+LYEKY+D++DAFAEKA  ELKKQYAVFDAK
Sbjct  184  GLWVLSMLGSCFNFLTLFYICFVLLHTVPLLYEKYDDQIDAFAEKAEAELKKQYAVFDAK  243

Query  846  VLSKIPRGPLKDKKL  890
            VLSKIP+GPLKDKK 
Sbjct  244  VLSKIPKGPLKDKKF  258



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 197/254 (78%), Gaps = 6/254 (2%)
 Frame = +3

Query  144  DRKEE---ESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  305
            D KEE   ES+++KI +K H      SSS SD EK+         +M AK+ RLFGR++P
Sbjct  3    DHKEEPVPESVMDKITEKFHGGDSSSSSSDSDDEKKGSSLASAAEAMKAKIYRLFGRERP  62

Query  306  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  485
            VH VLGGGK AD+ LWRN+KIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LA+LFL
Sbjct  63   VHSVLGGGKPADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAILFL  122

Query  486  WSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVIT  665
            WSNAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI 
Sbjct  123  WSNASTFINKSPPNIPEVKIPEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIA  182

Query  666  GLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAK  845
            GLW++S++GSCC+FLTLFYI  V L+TVPVLYEKYED+VDAF EKAM ELKK YA+FD K
Sbjct  183  GLWLLSVLGSCCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAMTELKKYYAIFDEK  242

Query  846  VLSKIPRGPLKDKK  887
             LSKIP+GPLKDKK
Sbjct  243  CLSKIPKGPLKDKK  256



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 205/252 (81%), Gaps = 3/252 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            M++ + K EESL+EKI++K   HD SSSS    +++  + +   M AKV RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKNKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA++FI KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GL
Sbjct  118  NAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIVGL  177

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W+ SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA HE+KKQYAVFDAKVL
Sbjct  178  WVSSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPLAEKAWHEIKKQYAVFDAKVL  237

Query  852  SKIPRGPLKDKK  887
            SKIP+ PLK+KK
Sbjct  238  SKIPKRPLKEKK  249



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 199/245 (81%), Gaps = 4/245 (2%)
 Frame = +3

Query  159  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++KI +KIH HDSSSS   + + +        + +K+ RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDTSAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  518
            D+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNAS FI KS
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132

Query  519  AphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSC  698
             PHIP+VHIPE+PV++ ASALR ++N  +AVLRDIASGRDLK FL  I GLW++SI+GS 
Sbjct  133  LPHIPQVHIPEDPVIEIASALRVEINRAIAVLRDIASGRDLKSFLYAIAGLWVLSILGSW  192

Query  699  CDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  878
             +FLTL YI V++L TVPV YEKY+D+VDAFAEKAM E+KKQY VFDAKVLSKIPRGPLK
Sbjct  193  FNFLTLLYIGVIVLFTVPVFYEKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSKIPRGPLK  252

Query  879  DKKLA  893
            DKK+A
Sbjct  253  DKKIA  257



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   291 bits (744),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 168/251 (67%), Positives = 195/251 (78%), Gaps = 0/251 (0%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  320
            E+ K  ESL+EKI+          SS S+ +++   +   +  AKV RLFGR++PVH+VL
Sbjct  5    EEAKGGESLLEKISGNFGGGGGGGSSSSDSDDDRVAEAAEAAKAKVYRLFGRERPVHQVL  64

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  500
            GGGK ADVFLWRNKK+S G LG  T IW LFE+ EYHLLT   H LIL LAVLFLWSNA 
Sbjct  65   GGGKPADVFLWRNKKVSAGALGVVTVIWALFELAEYHLLTLAAHCLILTLAVLFLWSNAH  124

Query  501  SFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWII  680
            +FI KS P IPEV IPEEPVLQFASALR ++N   AVLRDIASG+DLK FL+VI GLW++
Sbjct  125  AFIHKSPPRIPEVSIPEEPVLQFASALRLEINQAFAVLRDIASGKDLKKFLLVIAGLWLL  184

Query  681  SIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKI  860
            SI G+ C+FLTLFYI  VLLHTVPVLYEK+ED++D FAE+AM ELKKQYAVFDAKVLSKI
Sbjct  185  SIAGNWCNFLTLFYIVFVLLHTVPVLYEKFEDKIDPFAERAMGELKKQYAVFDAKVLSKI  244

Query  861  PRGPLKDKKLA  893
            P GPLKDKK A
Sbjct  245  PLGPLKDKKKA  255



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   291 bits (744),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 196/253 (77%), Gaps = 3/253 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE     EE+L+E+I +KIH    SSSSDS+ E+ +      ++ +K+  LFGR++PVH
Sbjct  1    MAEHG---EETLIEQINEKIHGDGDSSSSDSDDEKSKASVVAEAVKSKIYHLFGREKPVH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            ++LGGGK ADVFLW+NKK S  VLGGATAIWILFE++EYHLLT VCH LIL+LA+LFLWS
Sbjct  58   QILGGGKPADVFLWKNKKASAVVLGGATAIWILFELMEYHLLTLVCHCLILSLAILFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA++ I KS PHIP V IPE+  +  + +L  ++N   +VLR+IA+GR+LK FL VI GL
Sbjct  118  NATTLINKSPPHIPVVSIPEDLAVNISRSLTYEINRGFSVLREIATGRELKKFLAVIAGL  177

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            WI+SI+GSCC+FLTLFYIA V LHTVP LY+KYED VD FAEKA  E KK YAVF AK L
Sbjct  178  WILSIIGSCCNFLTLFYIAFVTLHTVPFLYDKYEDRVDTFAEKATVEFKKHYAVFHAKCL  237

Query  852  SKIPRGPLKDKKL  890
            SKIPRGPLKDKK 
Sbjct  238  SKIPRGPLKDKKF  250



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2 [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   291 bits (744),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 198/245 (81%), Gaps = 4/245 (2%)
 Frame = +3

Query  159  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++KI +KIH HDSSSS   + + +        + +K+ RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDASAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  518
            D+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNAS FI KS
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132

Query  519  AphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSC  698
             PHIP+VHIPE PV++ ASALR ++N  +AVLR+IASGRDLK FL  I GLW++SIVGS 
Sbjct  133  LPHIPQVHIPEGPVVEIASALRVEINRAIAVLREIASGRDLKSFLYAIAGLWVLSIVGSW  192

Query  699  CDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  878
             +FLTL YI V++L TVP+ YEKY+D+VDAFAEKAM E+KKQY VFDAKVLSKIPRGPLK
Sbjct  193  FNFLTLLYIGVIVLFTVPLFYEKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSKIPRGPLK  252

Query  879  DKKLA  893
            DKK+A
Sbjct  253  DKKIA  257



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 194/252 (77%), Gaps = 2/252 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE   KEEESLVE + DKI          S    +   + T+ + AK+ RLFGR++PVH
Sbjct  1    MAE--HKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             VLGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWS
Sbjct  59   SVLGGGKPADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NAS+FI KS P+IPEV IPE+  +  A ++R ++N   A LR+I  G DLK FL+V+ GL
Sbjct  119  NASTFINKSPPNIPEVKIPEDLAVNVARSVRFEINRGFATLREIGLGHDLKKFLIVVAGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++S++GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKA+ ELKK YA+FD K L
Sbjct  179  WVLSVLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAVIELKKYYAIFDEKCL  238

Query  852  SKIPRGPLKDKK  887
            SKIP+GP K+KK
Sbjct  239  SKIPKGPSKNKK  250



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 179/252 (71%), Positives = 212/252 (84%), Gaps = 4/252 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE D+  E+S++E + +KIH HD SS SDS+  + + +  +  + +K+ R+FGR++PVH
Sbjct  1    MAEHDK--EDSVIESVMEKIHDHDKSSDSDSDHGKPKSESDS--LKSKIYRIFGREKPVH  56

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KVLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE+LE HLLT VC+ LILALA+LFLWS
Sbjct  57   KVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELLECHLLTLVCYFLILALALLFLWS  116

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NAS+FI KS PHIPEV IPEEPVLQ A+ALR ++N   +VLRDIASGRDLK FL VI GL
Sbjct  117  NASTFINKSPPHIPEVRIPEEPVLQIAAALRIEINWAFSVLRDIASGRDLKKFLTVIAGL  176

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVGS C+FLTLFYIA VLL+TVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVL
Sbjct  177  WVLSIVGSWCNFLTLFYIAFVLLYTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVL  236

Query  852  SKIPRGPLKDKK  887
            SKIP GPLK KK
Sbjct  237  SKIPMGPLKGKK  248



>ref|XP_010261408.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
 ref|XP_010261409.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=255

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 197/255 (77%), Gaps = 6/255 (2%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            AE+     ES++ KIA+K+H         S  + + +K + SS+ A V RLFGRQ+PVHK
Sbjct  5    AEDSGSTVESVMHKIAEKLHH----KDDSSSSDSDNEKSSPSSVKAAVYRLFGRQKPVHK  60

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK ADVFLWRNKKIS  VLGGATA W+LFE+LEYH LT VCH LIL+L++LFLWSN
Sbjct  61   VLGGGKPADVFLWRNKKISASVLGGATAAWVLFELLEYHFLTLVCHCLILSLSLLFLWSN  120

Query  495  ASSFIKKSAphipevhipee--pvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            A++FI KS        +     PVLQFASALR ++N   +VLRDIASGRDLK FL+VI G
Sbjct  121  ATTFINKSQSPPRIPEVYIPEDPVLQFASALRIEINSGFSVLRDIASGRDLKKFLVVIAG  180

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++SIVGS C+FLTLFYI  VLLHTVPV YEKYED+VD+FAEKAM E+KKQY VFDAKV
Sbjct  181  LWVLSIVGSWCNFLTLFYIVFVLLHTVPVFYEKYEDKVDSFAEKAMAEIKKQYVVFDAKV  240

Query  849  LSKIPRGPLKDKKLA  893
            LSKIPRGPLKDKK A
Sbjct  241  LSKIPRGPLKDKKRA  255



>gb|KHG09260.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=252

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 201/242 (83%), Gaps = 3/242 (1%)
 Frame = +3

Query  162  SLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  341
            SL+EKIA+KIH HDSSSSS    ++++ + +   +  KV RLFGR++PVH V GGGK AD
Sbjct  12   SLMEKIAEKIHGHDSSSSSSDSDDDKQSESS---IKDKVFRLFGREKPVHHVFGGGKPAD  68

Query  342  VFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSA  521
            + LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA+ FI KS 
Sbjct  69   ILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQFINKST  128

Query  522  phipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCC  701
            PHIPEV IP+EPVL+FA ALR ++N   AVLRDIA GRDLKMFL VI GLW++SIVGS C
Sbjct  129  PHIPEVQIPKEPVLEFAMALRFEINRAFAVLRDIALGRDLKMFLSVIAGLWVLSIVGSWC  188

Query  702  DFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKD  881
            +FLTLFYI  V+LHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSKIP GPLK 
Sbjct  189  NFLTLFYIVFVVLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPMGPLKQ  248

Query  882  KK  887
            KK
Sbjct  249  KK  250



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            A+V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VC
Sbjct  43   ARVFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVC  102

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            HGLI +L +LFLWSNASSFI KS+P IPEV IPE+ V+  A + R ++N   A LR IA 
Sbjct  103  HGLIFSLGLLFLWSNASSFINKSSPRIPEVVIPEDLVVNIALSTRYEINRAFANLRQIAL  162

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            GRD+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   
Sbjct  163  GRDIKKFLIVIAGLWLLSVLGSCCNFLTLLYIVFVVLHTVPILYEKYEDQIDSYGEKGWV  222

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  223  EIKKQYAVFDAKVLSKVPRGPLKDKK  248



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 168/259 (65%), Positives = 207/259 (80%), Gaps = 6/259 (2%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIH------RHdsssssdsekeeeekkkttssMDAKVRRLFGR  296
            AE+  K+EE+L+EK A+K+H         SS S   +K + +   + +S+  K+ RLFGR
Sbjct  5    AEDLDKKEETLIEKPAEKVHGDHDSSSSASSESDSEKKVKSKPASSPTSVKDKIFRLFGR  64

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVH+V GGGK ADVFLWRNK+IS  VLGGATA+W+LFE+LEYHLLT VCH LILALA+
Sbjct  65   EKPVHQVFGGGKPADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCHILILALAI  124

Query  477  LFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLM  656
            LFLWSNA++FI KS P IPEV + EEP LQ A+A+R ++N  LAVLR+IASGRDLK FL 
Sbjct  125  LFLWSNATTFINKSPPRIPEVRLSEEPFLQVAAAVRFEINRALAVLREIASGRDLKKFLA  184

Query  657  VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVF  836
            V++GLW  SI+GS C+FLTLFYI  VLLHT+PVLYEKYED+VD+FAEKAM E++K+YAVF
Sbjct  185  VVSGLWFFSILGSYCNFLTLFYITFVLLHTLPVLYEKYEDKVDSFAEKAMIEIRKKYAVF  244

Query  837  DAKVLSKIPRGPLKDKKLA  893
            D KVLSKIPRGP KDKK A
Sbjct  245  DEKVLSKIPRGPSKDKKRA  263



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 161/253 (64%), Positives = 203/253 (80%), Gaps = 3/253 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MA E  +  E+L+EKI +KIH    SSSSDS+ E+ +  +   ++ +K+ RLFGR++PVH
Sbjct  1    MATE--QPGETLIEKIKEKIHG-GDSSSSDSDDEKSKASEVAEAVKSKIFRLFGREKPVH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            ++LGGGK ADVFLW+NKK S  VLGGATAIW+LFE++EYHLLT VCH LIL+LA+LFLWS
Sbjct  58   RILGGGKPADVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA++FI KS PHIPEV IPE+  +  A +LR ++N   AVLR+IA+GRD+K FL VI GL
Sbjct  118  NATTFINKSPPHIPEVIIPEDLSVNIALSLRYEINRGFAVLREIAAGRDVKKFLAVIVGL  177

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++S++G+CC+FLTLFYIA V LHTVP LY+KYED+VD+FAEKA  E KK YAV  AK L
Sbjct  178  WVLSVIGNCCNFLTLFYIAFVTLHTVPFLYDKYEDQVDSFAEKATVEFKKHYAVIHAKYL  237

Query  852  SKIPRGPLKDKKL  890
            SKIPRGPLKDKK+
Sbjct  238  SKIPRGPLKDKKV  250



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 193/256 (75%), Gaps = 2/256 (1%)
 Frame = +3

Query  123  ESAMAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  299
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNAS+F+ KS P IPEV +PE+ V + AS LR ++N   AVL DIASGRDLK FL V
Sbjct  126  FLWSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAV  185

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            I GL ++S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA  ++KKQYAV D
Sbjct  186  IAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLD  245

Query  840  AKVLSKIPRGPLKDKK  887
             K +SKIPRGP K+KK
Sbjct  246  EKYISKIPRGPFKEKK  261



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 166/259 (64%), Positives = 208/259 (80%), Gaps = 5/259 (2%)
 Frame = +3

Query  123  ESAMAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  293
            E  MA+   + E   ES++EKI DK+H  D  SSS   ++++EK  +  ++ AK+ RLFG
Sbjct  146  EYTMADHAGEHESVVESVMEKINDKLH--DHDSSSSDSEDDKEKISSVDAVKAKIYRLFG  203

Query  294  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  473
            R++PVHKVLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALA
Sbjct  204  RERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALA  263

Query  474  VLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFL  653
            VLFLWSNAS+FI KS P IP+V +PE+ VL  A+ALR ++N  L + RDIASG++LK FL
Sbjct  264  VLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDIASGKELKKFL  323

Query  654  MVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAV  833
             VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAE A  E+KKQYAV
Sbjct  324  AVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAENAEAEIKKQYAV  383

Query  834  FDAKVLSKIPRGPLKDKKL  890
            F+ KVLSKIPRGPLKDKK 
Sbjct  384  FNVKVLSKIPRGPLKDKKF  402



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   289 bits (739),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 203/248 (82%), Gaps = 3/248 (1%)
 Frame = +3

Query  153  EEESLVEKIADKIHRH---dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            E ESL+EK+++KIH      SSSSS  ++ E++   +  S+ +KV RLFGR++PVHKVLG
Sbjct  22   ERESLMEKLSEKIHHKGGDSSSSSSSDDENEKKSSSSPRSLKSKVYRLFGRERPVHKVLG  81

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  503
            GGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ 
Sbjct  82   GGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  504  FIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIIS  683
            FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW++S
Sbjct  142  FIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLREIASGRDLKKFLSAIAGLWVLS  201

Query  684  IVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  863
            I+G CC FLTL YIA+VLL TVP+LY+KYED+VD++ EKAM ELKKQYAV DAKVLSKIP
Sbjct  202  ILGGCCSFLTLSYIALVLLFTVPLLYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIP  261

Query  864  RGPLKDKK  887
            RGPLKDKK
Sbjct  262  RGPLKDKK  269



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 202/250 (81%), Gaps = 2/250 (1%)
 Frame = +3

Query  144  DRKEEESLVEKIADKIHRHdsssssdsekeeeekkkt--tssMDAKVRRLFGRQQPVHKV  317
            + KEE+S++EK+++K+H   SSSSSDS+ +++    +   ++M AK+ RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSSAAAMKAKIYRLFGRERPVHSV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI
Sbjct  123  STFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWI  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +S++GS C+FLTLFYI  V L+TVPVLYEKYED++DAF EKA  ELKK YA+F+ K LSK
Sbjct  183  LSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKIDAFGEKAEIELKKYYALFEEKCLSK  242

Query  858  IPRGPLKDKK  887
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 192/253 (76%), Gaps = 2/253 (1%)
 Frame = +3

Query  132  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            MAE E  +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR++PV
Sbjct  1    MAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGREKPV  59

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            HKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLW  119

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNAS+F+ KS P IPEV +PE+ V + AS LR ++N   AVL DIASGRDLK FL VI G
Sbjct  120  SNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAG  179

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            L ++S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA  ++KKQYAV D K 
Sbjct  180  LLVLSLVGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEKY  239

Query  849  LSKIPRGPLKDKK  887
            +SKIPRGP K+KK
Sbjct  240  ISKIPRGPFKEKK  252



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 202/248 (81%), Gaps = 3/248 (1%)
 Frame = +3

Query  153  EEESLVEKIADKIHRH---dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            E ESL+EKI++KIH      SSSSSD ++ E++   +  S+ +KV RLFGR++PVHKVLG
Sbjct  22   ERESLMEKISEKIHHKGDSSSSSSSDDDENEKKSSPSPKSLKSKVYRLFGRERPVHKVLG  81

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  503
            GGK AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ 
Sbjct  82   GGKPADIFMWKNKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  504  FIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIIS  683
            FI KS P IPEVHIPEEP+LQ  S LR ++N   + LR+IASGRDLK FL  I GLW++S
Sbjct  142  FIHKSPPKIPEVHIPEEPLLQLVSGLRIEINCGFSSLREIASGRDLKKFLSAIAGLWVLS  201

Query  684  IVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  863
            I+G CC FLTL YIA+VLL TVP+ Y+KYED+VDA+ EKAM ELKKQYAVFDAKVLSKIP
Sbjct  202  ILGGCCSFLTLAYIALVLLFTVPLFYDKYEDKVDAYGEKAMAELKKQYAVFDAKVLSKIP  261

Query  864  RGPLKDKK  887
            RGPLKDKK
Sbjct  262  RGPLKDKK  269



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 198/252 (79%), Gaps = 6/252 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE   ++EES+++KI +K H     SSS S  ++E +  ++SS+ AK+ RLFGR++PVH
Sbjct  1    MAE---RKEESVMDKITEKFH---GGSSSSSSSDDEGRSGSSSSVKAKIYRLFGREKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             VLGGGK AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWS
Sbjct  55   SVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NAS+F+ K  P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GL
Sbjct  115  NASAFVNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            WI+S +GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K L
Sbjct  175  WILSFLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCL  234

Query  852  SKIPRGPLKDKK  887
            SKIP+GP KDKK
Sbjct  235  SKIPKGPSKDKK  246



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 203/255 (80%), Gaps = 2/255 (1%)
 Frame = +3

Query  123  ESAMAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            +S  A    + ++SL+EKI++KIH H+SSSSS S+ + E+ +   S    KV R+FGR++
Sbjct  4    QSESAGSTVEHDKSLMEKISEKIHDHESSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  62

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLF
Sbjct  63   PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLF  122

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA SFI K+ P IPEVH+PEEP LQ AS LR  +N   AVL DIASGR+LK FL+VI
Sbjct  123  LWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVI  182

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW++SIVG+ C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  E KK YAVFDA
Sbjct  183  AGLWVLSIVGTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDA  242

Query  843  KVLSKIPRGPLKDKK  887
            KVLSKIP+G LK+K+
Sbjct  243  KVLSKIPQG-LKNKR  256



>ref|XP_011624344.1| PREDICTED: reticulon-like protein B1 [Amborella trichopoda]
 ref|XP_011624345.1| PREDICTED: reticulon-like protein B1 [Amborella trichopoda]
 ref|XP_011624346.1| PREDICTED: reticulon-like protein B1 [Amborella trichopoda]
 ref|XP_011624347.1| PREDICTED: reticulon-like protein B1 [Amborella trichopoda]
 ref|XP_011624348.1| PREDICTED: reticulon-like protein B1 [Amborella trichopoda]
Length=250

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            K+ RLFGRQ+PVHKVLGGGK ADVFLWRNKKIS  VLGGAT IWILFE LEYH +T +CH
Sbjct  45   KINRLFGRQKPVHKVLGGGKPADVFLWRNKKISASVLGGATLIWILFECLEYHFVTLLCH  104

Query  453  GLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASG  632
             LIL LA+LFLWSN ++FI KS PHIPEV IPE+     A +LR ++N   +VLRDIASG
Sbjct  105  CLILTLALLFLWSNGTAFINKSPPHIPEVKIPEDVATNIALSLRYEINRAFSVLRDIASG  164

Query  633  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  812
            RDLKMFL V+ GLW++SI+GSCC+FLTLFYI  V+LHTVPVLYEKYED+VD+F+EKAM E
Sbjct  165  RDLKMFLTVVAGLWVLSILGSCCNFLTLFYITFVVLHTVPVLYEKYEDQVDSFSEKAMIE  224

Query  813  LKKQYAVFDAKVLSKIPRGPLKDKK  887
            +KKQYAVFDAKVLSKIPRGPLK KK
Sbjct  225  IKKQYAVFDAKVLSKIPRGPLKSKK  249



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 210/252 (83%), Gaps = 3/252 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeee---kkkttssMDAKVRRLFGRQQ  302
            MAE     EESL+EKI DKIH HDSSSSS S   +++   + +++SS+ +K+ RLFGR++
Sbjct  1    MAETQHHHEESLLEKITDKIHGHDSSSSSSSSDSDDDKKSEAQSSSSLKSKIYRLFGREK  60

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK AD+FLWRNKK+S GVLG AT IWILFE++EYHLLT VCH LILALA+LF
Sbjct  61   PVHKVLGGGKPADIFLWRNKKVSAGVLGVATVIWILFELVEYHLLTLVCHLLILALALLF  120

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNAS+FI KS P +P+V+IPE+PVLQ A+ALR ++N  LA+LR+IASGRDLK FL VI
Sbjct  121  LWSNASTFINKSPPRLPDVYIPEDPVLQVAAALRIEINRGLAILREIASGRDLKKFLSVI  180

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW++S+ G+  +FLTLFY A VLL TVPV+YEKYED+VD FAEKA+ E+KKQY VFDA
Sbjct  181  AGLWVLSVAGNLFNFLTLFYTAFVLLFTVPVIYEKYEDKVDPFAEKAIIEIKKQYKVFDA  240

Query  843  KVLSKIPRGPLK  878
            KVLSK+PRGPLK
Sbjct  241  KVLSKLPRGPLK  252



>emb|CDP05124.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   286 bits (732),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 201/244 (82%), Gaps = 1/244 (0%)
 Frame = +3

Query  159  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            E++ EKI +K H HDSSSS   +  +++K  +   + AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   ETVKEKITEKFHSHDSSSSDSDDDSKDKKPPSKD-IKAKIYRLFGREKPVHKVLGGGKPA  71

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  518
            DVFLWR+KKIS  VLG  TAIW+LFE+LEY+LLT VCH LILALAVLFLWSNAS+FI KS
Sbjct  72   DVFLWRDKKISASVLGVVTAIWVLFELLEYYLLTLVCHILILALAVLFLWSNASTFINKS  131

Query  519  AphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSC  698
             P  PEV +PE+ VL  ASALR +VN  LA LR+IASGRDLK FL VI GLW+ SI+GSC
Sbjct  132  PPQFPEVILPEDIVLGVASALRIEVNRALAALREIASGRDLKKFLAVIAGLWVFSILGSC  191

Query  699  CDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  878
            C+FLTLFYI+ +LLHTVPVLYEKYED+VD+FAEKA  E+KKQYAVF+AKVLSKIPRGPLK
Sbjct  192  CNFLTLFYISFILLHTVPVLYEKYEDQVDSFAEKAEAEIKKQYAVFNAKVLSKIPRGPLK  251

Query  879  DKKL  890
            DKK 
Sbjct  252  DKKF  255



>gb|ERN08636.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
Length=291

 Score =   287 bits (735),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 200/267 (75%), Gaps = 7/267 (3%)
 Frame = +3

Query  90   FG-ELRFEFG*VESAMAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssM  266
            FG E+   FG V +   E+     ES+++KI +  H        D      +     SS+
Sbjct  30   FGSEVALGFGAVMTEHKEDSGSVVESVMDKITETFHH------DDGSSSSSDSDDEKSSI  83

Query  267  DAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAV  446
             +K+ RLFGRQ+PVHKVLGGGK ADVFLWRNKKIS  VLGGAT IWILFE LEYH +T +
Sbjct  84   SSKINRLFGRQKPVHKVLGGGKPADVFLWRNKKISASVLGGATLIWILFECLEYHFVTLL  143

Query  447  CHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIA  626
            CH LIL LA+LFLWSN ++FI KS PHIPEV IPE+     A +LR ++N   +VLRDIA
Sbjct  144  CHCLILTLALLFLWSNGTAFINKSPPHIPEVKIPEDVATNIALSLRYEINRAFSVLRDIA  203

Query  627  SGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAM  806
            SGRDLKMFL V+ GLW++SI+GSCC+FLTLFYI  V+LHTVPVLYEKYED+VD+F+EKAM
Sbjct  204  SGRDLKMFLTVVAGLWVLSILGSCCNFLTLFYITFVVLHTVPVLYEKYEDQVDSFSEKAM  263

Query  807  HELKKQYAVFDAKVLSKIPRGPLKDKK  887
             E+KKQYAVFDAKVLSKIPRGPLK KK
Sbjct  264  IEIKKQYAVFDAKVLSKIPRGPLKSKK  290



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   287 bits (734),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  +CHGLI
Sbjct  84   RLFGREQPIHKVLGGGKPADVFMWRNKNISAGVLGGATAIWILFELLGYHLLAFLCHGLI  143

Query  462  LALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDL  641
             +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N   A LR+IA GRD+
Sbjct  144  FSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNVALSTRHEINRAFANLREIALGRDI  203

Query  642  KMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKK  821
            K FL+VI GLW++SI+GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KK
Sbjct  204  KKFLIVIAGLWLLSILGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEVKK  263

Query  822  QYAVFDAKVLSKIPRGPLKDKK  887
            QY+VFDAKVLSK+PRGPLKDKK
Sbjct  264  QYSVFDAKVLSKVPRGPLKDKK  285



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   285 bits (730),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 194/251 (77%), Gaps = 4/251 (2%)
 Frame = +3

Query  144  DRKEEESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            D KEE+S+++KI++K H      SS S D +K+       T +M AK+ RLFGR++PVH 
Sbjct  3    DHKEEQSVMDKISEKFHGGDSSSSSDSDDEKKKGSSSASATEAMKAKIYRLFGRERPVHS  62

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLWSN
Sbjct  63   VLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSN  122

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            ASSFI KS P+IPEV IPE+  +  A  LR ++N   A LR+I  G DLK FL+VI GLW
Sbjct  123  ASSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLW  182

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            + S++GSCC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKAM ELKK YA+FD K LS
Sbjct  183  LFSVLGSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLS  242

Query  855  KIPRGPLKDKK  887
            KIP+G LKDKK
Sbjct  243  KIPKG-LKDKK  252



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 191/245 (78%), Gaps = 3/245 (1%)
 Frame = +3

Query  159  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++KIA+KIH H  SSSS     E+++  +   +  KV RLFGR++PVH VLGGGK A
Sbjct  1    ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  57

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  518
            DV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI K+
Sbjct  58   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  117

Query  519  AphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSC  698
             P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDLK FL++I G WIISIVGS 
Sbjct  118  PPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISIVGSW  177

Query  699  CDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  878
            C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA+ E KKQYAVFD KVL+KIP+GPLK
Sbjct  178  CNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLNKIPKGPLK  237

Query  879  DKKLA  893
             KKLA
Sbjct  238  GKKLA  242



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            LI +L +LFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  135  LIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  194

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            D+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+
Sbjct  195  DIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEI  254

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  255  KKQYAVFDAKVLSKVPRGPLKDKK  278



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 202/248 (81%), Gaps = 3/248 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M AKV RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA++FI KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GL
Sbjct  118  NAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIAGL  177

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVG+ C+FLTLFYI  VLLHT+PVLYEKYED+VD   EKA HE+KKQYAVFDAKVL
Sbjct  178  WVLSIVGNWCNFLTLFYIVFVLLHTLPVLYEKYEDKVDQLTEKAWHEIKKQYAVFDAKVL  237

Query  852  SKIPRGPL  875
            SKIP+ PL
Sbjct  238  SKIPKRPL  245



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 191/245 (78%), Gaps = 3/245 (1%)
 Frame = +3

Query  159  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++KIA+KIH H  SSSS     E+++  +   +  KV RLFGR++PVH VLGGGK A
Sbjct  15   ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  71

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  518
            DV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI K+
Sbjct  72   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  131

Query  519  AphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSC  698
             P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDLK FL++I G WIISIVGS 
Sbjct  132  PPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISIVGSW  191

Query  699  CDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  878
            C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA+ E KKQYAVFD KVL+KIP+GPLK
Sbjct  192  CNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLNKIPKGPLK  251

Query  879  DKKLA  893
             KKLA
Sbjct  252  GKKLA  256



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 166/254 (65%), Positives = 192/254 (76%), Gaps = 6/254 (2%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MA+E  K    EESL+EKIA+KI       SS S   + EK ++  ++  K+ RLFGR++
Sbjct  1    MADEMEKSAPAEESLLEKIAEKI---HDHDSSSSSDSDNEKMESPMAVKDKIYRLFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKV GGGK ADV LWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LILAL+VLF
Sbjct  58   PVHKVFGGGKPADVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA SFI KS P IPE+H+ EE  L  ASALRN+VN    VLRDIA GRDLK FLMV+
Sbjct  118  LWSNAHSFINKSPPQIPEIHLHEEHFLLVASALRNEVNQAFTVLRDIALGRDLKKFLMVV  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW+IS+VGS C FLTL YI  VLLHTVPVLYEK+ED+VD  AEKA  ELKKQY V D 
Sbjct  178  AGLWVISVVGSWCHFLTLIYICFVLLHTVPVLYEKHEDKVDPMAEKAFVELKKQYGVLDE  237

Query  843  KVLSKIPRGPLKDK  884
            KVLSKIP GPLK K
Sbjct  238  KVLSKIPIGPLKAK  251



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 202/246 (82%), Gaps = 1/246 (0%)
 Frame = +3

Query  153  EEESLVEKIADKIH-RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  329
            E ESL+EK+++KIH + DSSSS D  +++     +  S+ +KV RLFGR++PVHKVLGGG
Sbjct  18   ERESLMEKLSEKIHHKGDSSSSDDENEKKPSSSSSPRSLKSKVYRLFGRERPVHKVLGGG  77

Query  330  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFI  509
            K AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ FI
Sbjct  78   KPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFI  137

Query  510  KKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIV  689
             KS P IPEVHIPEEP+LQ AS LR ++N   + L +IASGRD+K FL  I GLW++SI+
Sbjct  138  HKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSIL  197

Query  690  GSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRG  869
            G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSKIPRG
Sbjct  198  GGCCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPRG  257

Query  870  PLKDKK  887
            PLK+KK
Sbjct  258  PLKNKK  263



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS G+LGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGILGGATAIWILFELLGYHLLTFVCHG  138

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            LI AL VLFLWSNASSFI K+ P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  139  LIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  198

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DLK FLMVI G W++S++GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+
Sbjct  199  DLKKFLMVIAGFWLLSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWAEI  258

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAVFD KVLSK+PRGP KDKK
Sbjct  259  KKQYAVFDEKVLSKVPRGPAKDKK  282



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGVLGGATAIWILFELLGYHLLTFVCHG  138

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            LI AL VLFLWSNASSFI K+ P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  139  LIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  198

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DLK FLMVI G W++S++GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+
Sbjct  199  DLKKFLMVIAGFWLLSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEI  258

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAVFD KVLSK+PRGP KDKK
Sbjct  259  KKQYAVFDEKVLSKVPRGPAKDKK  282



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            AK+ RLFGR++PVHKVLGGGK A++FLWR+KK+S GVLG AT IW LFE+L+YHLLT VC
Sbjct  53   AKIYRLFGRERPVHKVLGGGKPAEIFLWRDKKVSAGVLGFATVIWALFELLQYHLLTLVC  112

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            H LI+A+ VLFLWSNAS+FI  + P IPEV +P + VL  ASALR ++N  L +LRDIAS
Sbjct  113  HILIVAITVLFLWSNASAFINTAPPQIPEVVLPRDIVLGVASALRIEMNRILEILRDIAS  172

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            G+DLK FL+VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLY+KYED+VDAFAEKA  
Sbjct  173  GKDLKKFLVVILGLWVVSILGNCWNFLTLFYIVFVLLHTVPVLYDKYEDKVDAFAEKAEA  232

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKKLA  893
            E+KK YAVF+ +VLSKIPRGPL+DK+LA
Sbjct  233  EIKKHYAVFNDQVLSKIPRGPLRDKRLA  260



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 200/253 (79%), Gaps = 4/253 (2%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  320
            E+ K EES++EKIA+KIH HD SSSS S+ ++E+K  + SSM  K+ RLFGR++PVHKV 
Sbjct  3    EEHKHEESIMEKIAEKIHGHDGSSSSSSDSDDEKKSASPSSMKKKIYRLFGREKPVHKVF  62

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  500
            GGGK AD+FLWRNKK+S GVLG AT  W+LFE+LEY+LLT   H  ILALA LFLWS+A 
Sbjct  63   GGGKPADIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTLFGHITILALACLFLWSSAI  122

Query  501  SFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWII  680
            +FI K+ PHIPE+HIPEE VLQ AS LR ++N     LRDIASGRDLK FL+VI GLW++
Sbjct  123  TFIHKTPPHIPEIHIPEEVVLQLASGLRIEINRGFTTLRDIASGRDLKKFLLVIAGLWLL  182

Query  681  SIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKV  848
            SIVGS C+FLTL YIA +LL TVPVLYEKYED+VD F EKAM E+KKQYAVFD    +KV
Sbjct  183  SIVGSSCNFLTLIYIATILLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVFDEKVLSKV  242

Query  849  LSKIPRGPLKDKK  887
            +SKIPRG    KK
Sbjct  243  MSKIPRGAFNKKK  255



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 158/277 (57%), Positives = 189/277 (68%), Gaps = 25/277 (9%)
 Frame = +3

Query  132  MAEEDRKE------EESLVEKIADKIH-------------------RHdsssssdsekee  236
            MAE+   E       E+L+EK+ADK+H                   R  + ++       
Sbjct  1    MAEQPHAEGGASPKHETLMEKLADKLHAGGGKGDSSSSDSDNDERPRPSAPAAEVKPSFS  60

Query  237  eekkkttssMDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFE  416
                   +   AKV RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGG TAIWILFE
Sbjct  61   VSAAAAAAEARAKVFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGVTAIWILFE  120

Query  417  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVN  596
             L YHLLT VCHGLI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N
Sbjct  121  CLGYHLLTFVCHGLIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEIN  180

Query  597  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  776
                 LR IA GRD+K FLMVI GLW++S++GSCC+FLTL YI  V+LHTVPVLYEKYED
Sbjct  181  RAFVNLRQIALGRDIKKFLMVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYED  240

Query  777  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  887
            ++D++ EK   E+KKQYAVFD KVLSK+PRGP KDKK
Sbjct  241  QIDSYGEKGWVEIKKQYAVFDEKVLSKVPRGPAKDKK  277



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 191/245 (78%), Gaps = 0/245 (0%)
 Frame = +3

Query  153  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            +EESL++KI +K H   SSSSS  ++       ++SS+ AK+ RLFGR++PVH VLGGGK
Sbjct  11   KEESLMDKITEKFHGSSSSSSSSDDEAGRAAGSSSSSVKAKIYRLFGREKPVHSVLGGGK  70

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  512
             AD+ LWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNAS+F+ 
Sbjct  71   PADLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVN  130

Query  513  KSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  692
            K  P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI+S +G
Sbjct  131  KCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSALG  190

Query  693  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  872
            S C+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP+GP
Sbjct  191  SSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGP  250

Query  873  LKDKK  887
             KDKK
Sbjct  251  SKDKK  255



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  52   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  111

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            H LIL+LAV FLWSNAS+FI KS P IP+V + E  VL  ASALR ++N    +LRDIAS
Sbjct  112  HLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIAS  171

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            GRDLKMFL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ 
Sbjct  172  GRDLKMFLGVIAVLWIVSLVGKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALI  231

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            E KKQYAVFDAKVLSKIP+GPLK+KK
Sbjct  232  EFKKQYAVFDAKVLSKIPKGPLKEKK  257



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 195/252 (77%), Gaps = 6/252 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE   KEEES+++ I+DK+H         S    +   + T+++ AK+ RLFGR++PVH
Sbjct  1    MAE--HKEEESVMDTISDKLHG----RGGSSSSSLDSDGERTAAVKAKIYRLFGREKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             VLGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWS
Sbjct  55   SVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+V+ GL
Sbjct  115  NASTFINKSPPNIPEVRIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            WI+S++GSCC+FLTLFYI  + L+TVPVLYEKY+D++DAF EKAM ELKK  A+FD K L
Sbjct  175  WILSVLGSCCNFLTLFYIVFMALYTVPVLYEKYDDKIDAFGEKAMIELKKYCAIFDEKCL  234

Query  852  SKIPRGPLKDKK  887
            +KIP+GP K+KK
Sbjct  235  AKIPKGPSKNKK  246



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   283 bits (725),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 166/253 (66%), Positives = 201/253 (79%), Gaps = 2/253 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE+     ES++ KI++KIH H+SSSS      E++   + S  D K+ RLFGR++PVH
Sbjct  1    MAEQSENPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWS
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA SFI KS P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G+DLK FL+VI GL
Sbjct  119  NAHSFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDLKKFLIVIAGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVL
Sbjct  179  WVMSIVGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVL  238

Query  852  SKIPRGPLKDKKL  890
            SKIP   LK KK+
Sbjct  239  SKIPVAALKAKKV  251



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   286 bits (732),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 203/255 (80%), Gaps = 2/255 (1%)
 Frame = +3

Query  123  ESAMAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            +S  A    + E+SL+EKI++KIH H+SSSSS S+ + E+ +   S    KV R+FGR++
Sbjct  86   QSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  144

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLF
Sbjct  145  PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLF  204

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA SFI K+ P IPEVH+PEEP LQ AS LR  +N   AVL DIASGR+LK FL+VI
Sbjct  205  LWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVI  264

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW++SIVG+ C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  E KK YAVFDA
Sbjct  265  AGLWVLSIVGTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDA  324

Query  843  KVLSKIPRGPLKDKK  887
            KVLSKIP+G LK+K+
Sbjct  325  KVLSKIPQG-LKNKR  338



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            LI +L +LFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  135  LIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  194

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            D+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+
Sbjct  195  DIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEI  254

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAV DAKVLSK+PRGPLKDKK
Sbjct  255  KKQYAVLDAKVLSKVPRGPLKDKK  278



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 189/246 (77%), Gaps = 1/246 (0%)
 Frame = +3

Query  156  EESLVEKIADKIHRHdsssssdsek-eeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            EE+L+E++ +KI     SSSS     E+ +    T ++ +K+ RLFGR++PVH++LGGGK
Sbjct  6    EETLIEQVTEKIRDGVDSSSSSDSDDEKSKASVVTEAVKSKINRLFGREKPVHQILGGGK  65

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  512
             ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA+  I 
Sbjct  66   PADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLIN  125

Query  513  KSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  692
            KS PHIP V IPE  V+  A +LR ++N   AVLR+IA+GRDLK FL+VI GLW++S VG
Sbjct  126  KSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREIATGRDLKKFLIVIAGLWVLSTVG  185

Query  693  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  872
             CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEKA  E KK YAVF AK LSKIPRGP
Sbjct  186  RCCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEKASVEFKKHYAVFQAKYLSKIPRGP  245

Query  873  LKDKKL  890
            LKDKK 
Sbjct  246  LKDKKF  251



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 166/253 (66%), Positives = 201/253 (79%), Gaps = 2/253 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE+     ES++ KI++KIH H+SSSS      E++   + S  D K+ RLFGR++PVH
Sbjct  1    MAEQSEDPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWS
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA SFI KS P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G+DLK FL+VI GL
Sbjct  119  NAHSFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDLKKFLIVIAGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVL
Sbjct  179  WVMSIVGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVL  238

Query  852  SKIPRGPLKDKKL  890
            SKIP   LK KK+
Sbjct  239  SKIPVAALKAKKV  251



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
             K+ RLFGR++P+HKVLGGGK AD+FLWR+KK++ GVLG AT IW LFE+LEYHLLT VC
Sbjct  47   TKIYRLFGREKPLHKVLGGGKPADIFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVC  106

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            H LI+A+AVLFLWSNAS+FI  + P IPEV +P++ VL  ASALR ++N  L +LRDIAS
Sbjct  107  HILIVAVAVLFLWSNASAFINTAPPQIPEVVLPKDIVLGVASALRIEINRALEILRDIAS  166

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            G+DLK FL+VI GLW++S++G+  +FLTLFYI  VLLHTVP+LYEKYED+VDAFAEKA  
Sbjct  167  GKDLKKFLVVIVGLWVVSVLGNIWNFLTLFYIVFVLLHTVPLLYEKYEDKVDAFAEKAEA  226

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            E+KK YAVFDA VLSKIPRGPLK KK
Sbjct  227  EIKKHYAVFDANVLSKIPRGPLKGKK  252



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 195/246 (79%), Gaps = 1/246 (0%)
 Frame = +3

Query  153  EEESLVEKIADKIH-RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  329
            E +S V+ + DK++ +  S   S    +++ KK   +++  K+ RLFGR++PVHKVLGGG
Sbjct  7    ENDSFVDSVTDKVNDKFHSHDYSSDSDDDKGKKSPVNAVKTKIYRLFGREKPVHKVLGGG  66

Query  330  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFI  509
            K ADVFLWR+KK++ GVLG AT IW LFE+LEYHLLT VCH LI+A+AVLFLWSNAS+FI
Sbjct  67   KPADVFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLWSNASAFI  126

Query  510  KKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIV  689
              + PHIPEV +P++ VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLWI+SI+
Sbjct  127  NTAPPHIPEVVLPKDIVLSVASALRIEINRALEILRDIASGKDLKKFLVVIVGLWIVSIL  186

Query  690  GSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRG  869
            G+  +FLTLFYI  VLLHTVPVLYEK+ED+VDA AEKA  E+KK YAVFDA VLSKIPRG
Sbjct  187  GNIWNFLTLFYIVFVLLHTVPVLYEKHEDKVDAVAEKAEAEIKKHYAVFDANVLSKIPRG  246

Query  870  PLKDKK  887
            PLK KK
Sbjct  247  PLKGKK  252



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 174/288 (60%), Positives = 211/288 (73%), Gaps = 35/288 (12%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQ  299
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ AK+ RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVL
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSN  +FI K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V
Sbjct  121  FLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNLKKFLVV  180

Query  660  ITGLWIISIVGSCCDFLTLFYI-------------------------------AVVLLHT  746
            +   W++S+VGS C+FLTLFY                                A VLLHT
Sbjct  181  VAAFWVLSVVGSWCNFLTLFYTCNDTGLLFLVPSSFIYTNFILNFDPSSLWKSAFVLLHT  240

Query  747  VPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  890
            VPVLYEKYED+VD FAEKA+ E+KKQYAVFDA VLSKIP GPLK KK+
Sbjct  241  VPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDANVLSKIPTGPLKSKKV  288



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 192/252 (76%), Gaps = 9/252 (4%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE    +EES+++KI++K+H         S   ++E     +++ AK+ RLFGR++PVH
Sbjct  1    MAEH---KEESVMDKISEKLHG------GSSSGSDDESSSAAAAVKAKIYRLFGREKPVH  51

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             VLGGGK AD+FLWRNKKIS GVL GATAIW+LFEV+EYHLLT +CH  IL L +LFLWS
Sbjct  52   SVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLCHCFILTLGILFLWS  111

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NAS+FI KS P+IPEV IPE+  +  A +LR ++N   A LRDI  GRDLK FL+VI GL
Sbjct  112  NASAFINKSPPNIPEVRIPEDLAVNVARSLRYEINRGFASLRDIGQGRDLKKFLIVIAGL  171

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W +S +GS C+FLTLFYI  ++L+TVPVLYEKYED++DA+ EKAM ELKK YA+FD K L
Sbjct  172  WTLSALGSSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAYGEKAMIELKKYYAIFDEKCL  231

Query  852  SKIPRGPLKDKK  887
            SKIP+GP KDKK
Sbjct  232  SKIPKGPSKDKK  243



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +3

Query  144  DRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + ++ ES+ E + DKI      S S S   + + K + S++ AK+ RLFGR+ PVHKVLG
Sbjct  7    EHEKHESVAESVMDKITEKFHGSDSSSSDSDNDIKSSASAVKAKIYRLFGRETPVHKVLG  66

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  503
            GGK AD+FLWR+KK +  VLG ATAIW+LFE+LEYHLL+ VCH LIL LA+LFLWSNAS+
Sbjct  67   GGKPADIFLWRDKKTTGYVLGVATAIWVLFELLEYHLLSLVCHFLILGLAILFLWSNAST  126

Query  504  FIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIIS  683
            FI KS P  PEV I E  V+  ASAL  + N   A+LR++ASG+DLK FL VI GLW++S
Sbjct  127  FISKSRPKFPEVIISENVVVSVASALTIEFNRAFAILREVASGKDLKKFLAVIAGLWVLS  186

Query  684  IVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  863
            ++GSC +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA HE+KKQYAVFD KVLSK+P
Sbjct  187  VLGSCFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKAEHEIKKQYAVFDVKVLSKLP  246

Query  864  RGPLKDKKL  890
            +  LK KK 
Sbjct  247  KAILKYKKF  255



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            LI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N   A LR IA GR
Sbjct  135  LIFSLGVLFLWSNASSFIHKSPPKIPEVVIPEDLVVNIAVSTRYEINRAFANLRRIALGR  194

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            D+K FLMVI GLW++S++GSCC+ LTL YI  V+LHTVPVLYEKYED++D + EK   E+
Sbjct  195  DIKKFLMVIAGLWLLSVLGSCCNLLTLVYIVFVVLHTVPVLYEKYEDQIDTYGEKGWVEI  254

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAVFD KVLSK+PRGP KDKK
Sbjct  255  KKQYAVFDEKVLSKVPRGPAKDKK  278



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS  VL  ATAIWILFE+LEYHLLT 
Sbjct  76   VQAKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISGSVLASATAIWILFELLEYHLLTL  135

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            +CH LI +LAVLFLW+NAS+FI KS PHIPEV +PE+P+L+  + LR+++N  LA+L DI
Sbjct  136  ICHSLIFSLAVLFLWANASTFINKSPPHIPEVILPEKPILEAVAGLRHELNRGLAMLHDI  195

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            A G+DLK FL VI GLWI+SIVG  C F+TLFYI  VLLHT+P+LYEKYED+VDAFAEKA
Sbjct  196  AMGKDLKKFLAVIAGLWILSIVGKSCGFITLFYINFVLLHTIPILYEKYEDKVDAFAEKA  255

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
            M E KK Y V + K +SKIPRGPLK+KK
Sbjct  256  MAEAKKHYGVINEKYISKIPRGPLKNKK  283



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            K+ RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H
Sbjct  81   KMFRLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGH  140

Query  453  GLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASG  632
             LI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N   A LR IA G
Sbjct  141  ALIFSLGVLFLWSNASSFINKSPPKIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALG  200

Query  633  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  812
            RD+K FL+VI GLW++SI+GSCC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E
Sbjct  201  RDIKKFLIVIAGLWLLSILGSCCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIE  260

Query  813  LKKQYAVFDAKVLSKIPRGPLKDKK  887
            +KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  261  VKKQYAVFDAKVLSKVPRGPLKDKK  285



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  54   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  113

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            H LIL+LAV FLWS AS+FI KS P IP+V IPE+ VL+ ASALR ++N    VLRDIAS
Sbjct  114  HLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIAS  173

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            GRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  
Sbjct  174  GRDLKTFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWI  233

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            E+KKQYAVFDAKVLSKIPRGP+K+KK
Sbjct  234  EIKKQYAVFDAKVLSKIPRGPVKEKK  259



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 200/249 (80%), Gaps = 4/249 (2%)
 Frame = +3

Query  153  EEESLVEKIADKIHRH----dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  320
            E ESL+EK+++KIH       SSSS +  +++     +  S+ +KV RLFGR++PVHKVL
Sbjct  18   ERESLMEKLSEKIHHKGDSSSSSSSDEENEKKTSSSSSPRSLKSKVYRLFGRERPVHKVL  77

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  500
            GGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+
Sbjct  78   GGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNAT  137

Query  501  SFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWII  680
             FI KS P IPE+HIPE+P+LQ AS LR ++N   + L +IASGRD+K FL  I GLW++
Sbjct  138  MFIHKSPPKIPEIHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVL  197

Query  681  SIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKI  860
            SI+G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSKI
Sbjct  198  SILGGCCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKI  257

Query  861  PRGPLKDKK  887
            PRGPLK+KK
Sbjct  258  PRGPLKNKK  266



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   281 bits (719),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/253 (61%), Positives = 190/253 (75%), Gaps = 2/253 (1%)
 Frame = +3

Query  132  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            MAE E  +E E +VE + DKI          S    +       ++ +K+ RLFGR++PV
Sbjct  1    MAEHEGEREREPVVESMVDKI-TEKIHDHHSSSSSSDSDDDKLDAVKSKIFRLFGREKPV  59

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            HKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VC+  I +LAVLFLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLFLW  119

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNAS+F+ KS P IPEV +PE+ V + AS LR ++N  +AVL DIASGRDLK FL VI G
Sbjct  120  SNASNFLNKSPPKIPEVLLPEKCVREVASGLRIEINRGVAVLHDIASGRDLKKFLAVIAG  179

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            L ++S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EK+  ++KKQYA+ D K 
Sbjct  180  LLVLSLVGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGCSEKSWIQIKKQYALLDEKY  239

Query  849  LSKIPRGPLKDKK  887
            LSKIPRGP K+KK
Sbjct  240  LSKIPRGPFKEKK  252



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   281 bits (719),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 172/210 (82%), Gaps = 0/210 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVH+VLGGGK ADV LWRNKKIS   LGG T  W+ FE+LEYHLLT 
Sbjct  46   VKAKIFRLFGREKPVHQVLGGGKPADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTL  105

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            VC+ LI++LA+LFLWSNA +FI KS P IPEVHIPE+P LQ  SAL  ++N   A LR I
Sbjct  106  VCYTLIVSLAILFLWSNAHTFIHKSPPRIPEVHIPEDPFLQVVSALTIEINQGFAALRSI  165

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL+VI GLW++SIVGS  +FLTLFYI+VVLLHTVPVLYEKYED++D  AEKA
Sbjct  166  ASGRDLKKFLIVIAGLWVLSIVGSWANFLTLFYISVVLLHTVPVLYEKYEDKIDPLAEKA  225

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKKLA  893
            + ELKKQY VFD KVLSKIP+GPLK KK A
Sbjct  226  LIELKKQYTVFDEKVLSKIPKGPLKGKKRA  255



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  58   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  117

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            H LIL+LAV FLWSNAS+FI KS P IP+V + E  VL  ASALR ++N    +LRDIAS
Sbjct  118  HLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIAS  177

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            GRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ 
Sbjct  178  GRDLKTFLGVIAILWILSVVGKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALI  237

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            E KKQYAVFDAKVLSKIP+GPLK+KK
Sbjct  238  EFKKQYAVFDAKVLSKIPKGPLKEKK  263



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 174/230 (76%), Gaps = 29/230 (13%)
 Frame = +3

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LI
Sbjct  49   RLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLI  108

Query  462  LALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDL  641
            L+LA+LFLWSNA++FI KS P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDL
Sbjct  109  LSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDL  168

Query  642  KMFLM-----------------------------VITGLWIISIVGSCCDFLTLFYIAVV  734
            K FLM                             VI GLW++SIVGSCC+FLTLFYIA V
Sbjct  169  KKFLMVCCSVFLSNVSGSWSISMGVILFGILVFQVIAGLWVLSIVGSCCNFLTLFYIAFV  228

Query  735  LLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  884
             LHT+PVLYEKYED+VD+FAEKAM ++KK YA F+AK LSKIPRGPLK K
Sbjct  229  TLHTLPVLYEKYEDKVDSFAEKAMTKVKKNYATFNAKCLSKIPRGPLKKK  278



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score =   282 bits (721),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            K+ RLFGR+QP+HKVLGGGK ADVF+WRNK +S GVLGGATAIWILFE+L YHLL  + H
Sbjct  85   KMFRLFGREQPIHKVLGGGKPADVFMWRNKHVSAGVLGGATAIWILFELLGYHLLAFLGH  144

Query  453  GLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASG  632
             LI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N   A LR IA G
Sbjct  145  ALIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALG  204

Query  633  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  812
            RD+K FL+VI GLW++SI+GSCC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E
Sbjct  205  RDIKKFLIVIAGLWLLSILGSCCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIE  264

Query  813  LKKQYAVFDAKVLSKIPRGPLKDKK  887
            +KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  265  VKKQYAVFDAKVLSKVPRGPLKDKK  289



>ref|XP_011084470.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=258

 Score =   281 bits (718),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 201/251 (80%), Gaps = 2/251 (1%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            E+     ESL++KI +K H   S SSS    + ++ K   +++ +K+ RLFGR++PVHKV
Sbjct  9    EKHESAAESLIDKITEKFH--GSDSSSSDSDDNKDIKSAAAAVKSKIYRLFGREKPVHKV  66

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALA++FLWSNA
Sbjct  67   LGGGKPADIFLWRDKKITAGVLGVATAIWVLFELLEYHLLTLVCHILILALALIFLWSNA  126

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            S+FI KS P IPE+ +PE+ VL  A+A R + N  LA+LRDIASGR+LK FL VI GLW+
Sbjct  127  STFINKSPPKIPEIIVPEDIVLGIAAAFRIEFNRALAILRDIASGRELKKFLAVIAGLWV  186

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +SI+G+  +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA  ELKKQYAVF+ KVLSK
Sbjct  187  LSILGNYFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKAEAELKKQYAVFNTKVLSK  246

Query  858  IPRGPLKDKKL  890
            IPRGPLKDKKL
Sbjct  247  IPRGPLKDKKL  257



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T 
Sbjct  41   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITL  100

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            VCH LIL+LAV FLWS AS+FI KS P IP+V IPE+ VL+ ASALR ++N    VLRDI
Sbjct  101  VCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDI  160

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA
Sbjct  161  ASGRDLKTFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKA  220

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
              E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  221  WIEIKKQYAVFDAKVLSKIPKGPVKEKK  248



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 198/254 (78%), Gaps = 6/254 (2%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + AK+ RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +FI K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+
Sbjct  118  LWSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVV  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD 
Sbjct  178  VGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDE  237

Query  843  KVLSKIPRGPLKDK  884
            KVLSKIP   LK K
Sbjct  238  KVLSKIPVASLKAK  251



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 203/254 (80%), Gaps = 5/254 (2%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKV
Sbjct  3    EDHKHEESIMEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
             +FI K++PHIPEV+IPE+PVLQ  S LR ++N  L VLR+IASG+D+K F++VI GLW+
Sbjct  123  CTFIHKASPHIPEVNIPEDPVLQLVSGLRIEINRGLTVLRNIASGKDVKKFILVIAGLWV  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  845
            +SI+GSC +FLTLFYIA VLL T+PVLYEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSIIGSCYNFLTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSK  242

Query  846  VLSKIPRGPLKDKK  887
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 199/249 (80%), Gaps = 4/249 (2%)
 Frame = +3

Query  153  EEESLVEKIADKIHRH----dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  320
            E ESL+EK+++KIH       SSSS D  +++     +  S+ +KV RLFGR++PVHKVL
Sbjct  23   ERESLMEKLSEKIHHKGDSSSSSSSDDENEKKPSSSSSPRSLKSKVYRLFGRERPVHKVL  82

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  500
            GGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLL  +CH +I+ALAVLFLWSNA+
Sbjct  83   GGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHVMIVALAVLFLWSNAT  142

Query  501  SFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWII  680
             FI KS P IPEVHIPEEP+LQ AS LR ++N   + L +IASGRD+K FL  I GLW++
Sbjct  143  MFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVL  202

Query  681  SIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKI  860
            SI+G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSKI
Sbjct  203  SILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKI  262

Query  861  PRGPLKDKK  887
            PRGPLK+KK
Sbjct  263  PRGPLKNKK  271



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 199/256 (78%), Gaps = 7/256 (3%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KIH H  SSSS S   +++KK ++  +  KV RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTKVYRLFGREQPVH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +AS+FI K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GL
Sbjct  118  SASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGL  177

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++S VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    
Sbjct  178  WVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVL  237

Query  840  AKVLSKIPRGPLKDKK  887
            +KV+SKIP+G    KK
Sbjct  238  SKVMSKIPKGAFYKKK  253



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH 
Sbjct  62   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHV  121

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            +I+ALAVLFLWSNA+ FI KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGR
Sbjct  122  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGR  181

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DLK FL  + GLWI+SI+G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM EL
Sbjct  182  DLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAEL  241

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAV DAKVLSKIPRGPLKDKK
Sbjct  242  KKQYAVLDAKVLSKIPRGPLKDKK  265



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 200/256 (78%), Gaps = 6/256 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KIH H  SSSS S  + ++ KK++S +  KV RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHGDSSSSSSSSDSDDDKKSSS-LKTKVYRLFGREQPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS
Sbjct  59   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +AS+FI K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GL
Sbjct  119  SASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++S VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    
Sbjct  179  WVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVL  238

Query  840  AKVLSKIPRGPLKDKK  887
            +KV+SKIP+G    KK
Sbjct  239  SKVMSKIPKGAFYKKK  254



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 198/254 (78%), Gaps = 6/254 (2%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + AK+ R+FGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWR+KK+S  VLG AT IW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +FI K++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+
Sbjct  118  LWSNAHTFINKTSPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVV  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD 
Sbjct  178  VGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDE  237

Query  843  KVLSKIPRGPLKDK  884
            KVLSKIP   LK K
Sbjct  238  KVLSKIPVASLKAK  251



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/258 (65%), Positives = 204/258 (79%), Gaps = 4/258 (2%)
 Frame = +3

Query  123  ESAMAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  293
            ESA A E   E    ESL++KI++KIH H   SSS S  E+E++  + SS+ AKV RLFG
Sbjct  9    ESAAAPEPAVEILERESLLDKISEKIH-HGDDSSSSSSDEDEKEASSPSSLKAKVYRLFG  67

Query  294  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  473
            R++PVHKVLGGGK AD+F+WR+KK+S  VLGG TA+W+LFE++EYHLL+ + H LI+ LA
Sbjct  68   REKPVHKVLGGGKPADIFMWRDKKMSASVLGGITAVWVLFELMEYHLLSLLSHVLIVVLA  127

Query  474  VLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFL  653
            VLF+WSNAS FI KS P IPEVHIPEEP+LQ AS LR ++N     LRDIASGRDLK FL
Sbjct  128  VLFIWSNASMFINKSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFL  187

Query  654  MVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAV  833
              I GLW++SIVG CC+FLTL YI +V+L T+PVLYEK+ED+VDA+ EKAM E+KKQYAV
Sbjct  188  TAIAGLWVLSIVGGCCNFLTLSYIGMVMLFTIPVLYEKHEDKVDAYGEKAMVEMKKQYAV  247

Query  834  FDAKVLSKIPRGPLKDKK  887
             D KVLSKIPRGPLK KK
Sbjct  248  LDEKVLSKIPRGPLKGKK  265



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 198/254 (78%), Gaps = 6/254 (2%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + AK+ RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +FI K+ P IPEVH+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+
Sbjct  118  LWSNAHTFINKTPPQIPEVHVPEEAFLTIASSLRNELNQAFVILRSIALGRDLKKFLMVV  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+ C+FLTL YI  V+LHTVP++YEK+ED+VD  AEKAM EL+KQY VFD 
Sbjct  178  VGLWIISVVGNWCNFLTLVYICFVVLHTVPMMYEKHEDKVDPLAEKAMKELQKQYLVFDE  237

Query  843  KVLSKIPRGPLKDK  884
            KV+SKIP   LK K
Sbjct  238  KVISKIPIASLKAK  251



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 194/244 (80%), Gaps = 0/244 (0%)
 Frame = +3

Query  156  EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQ  335
            E SL+EK  +KIH  D  S+S S   +++K     S  +KV RLFGR++PVHKVLGGGK 
Sbjct  10   EPSLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKPVHKVLGGGKP  69

Query  336  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  515
            AD+FLWR+KK+S GVLG ATAIWILFE++EYHL+T VCH LI  LA++FLW++AS+ I K
Sbjct  70   ADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFLWASASTHITK  129

Query  516  SAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  695
            S P+IPEV +PE+ VL+ AS LR + N  LA+LR+IASGR+LK FL  I GLW++S+VGS
Sbjct  130  SPPNIPEVQLPEKCVLEVASVLRFEANRGLALLREIASGRELKKFLAFIAGLWVLSMVGS  189

Query  696  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  875
              + +TLFYI  VLLHTVPV YEKYED+VD FAEKAM E+KKQ+AVF+ KVLSK+PRGPL
Sbjct  190  WFNSVTLFYITFVLLHTVPVFYEKYEDQVDPFAEKAMVEIKKQFAVFNEKVLSKVPRGPL  249

Query  876  KDKK  887
            KDKK
Sbjct  250  KDKK  253



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 167/256 (65%), Positives = 200/256 (78%), Gaps = 10/256 (4%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHISILALAVLFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +A++FI K+ PHIPEVHIPE+ VLQ AS LRN++N    +LR+IA GRDLK FLMV+ GL
Sbjct  115  SATTFIHKTPPHIPEVHIPEDVVLQLASGLRNEINRGFTLLRNIALGRDLKKFLMVVAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++S VGS C+FLTL YIA VLL TVPVLYEKYED+VD F EKAM E+KKQYAV D    
Sbjct  175  WVLSKVGSSCNFLTLIYIATVLLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEKVL  234

Query  840  AKVLSKIPRGPLKDKK  887
            +KV+SKIPRG    KK
Sbjct  235  SKVMSKIPRGAFNKKK  250



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 198/254 (78%), Gaps = 6/254 (2%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + AK+ R+FGR++
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +FI K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+
Sbjct  118  LWSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVV  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD 
Sbjct  178  VGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDE  237

Query  843  KVLSKIPRGPLKDK  884
            KVLSKIP   LK K
Sbjct  238  KVLSKIPVASLKAK  251



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 198/255 (78%), Gaps = 7/255 (3%)
 Frame = +3

Query  132  MAEEDRK----EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  299
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + AK+ R+FGR+
Sbjct  1    MAEEIEKSVPAEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  L
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGL  117

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNA +FI K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV
Sbjct  118  FLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMV  177

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            + GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD
Sbjct  178  VVGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFD  237

Query  840  AKVLSKIPRGPLKDK  884
             KVLSKIP   LK K
Sbjct  238  EKVLSKIPVASLKAK  252



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 159/250 (64%), Positives = 197/250 (79%), Gaps = 2/250 (1%)
 Frame = +3

Query  144  DRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            + KEE+S++EK+++K+H     SSS SD +K+        ++M AK+ RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGRERPVHSV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI
Sbjct  123  STFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWI  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +S++GS C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E KK YA+F+ K LSK
Sbjct  183  LSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFEEKCLSK  242

Query  858  IPRGPLKDKK  887
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 198/254 (78%), Gaps = 2/254 (1%)
 Frame = +3

Query  132  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  305
            MAE   +E   ES+++KI+DK H    SSSS S   +++KK + + + AK+ RLFGR+QP
Sbjct  1    MAEHKEEEPVAESMMDKISDKFHGGGGSSSSSSSDSDDDKKGSAAGVKAKIYRLFGREQP  60

Query  306  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  485
            VH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT V H LIL+LA LFL
Sbjct  61   VHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFL  120

Query  486  WSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVIT  665
            WSN   FI KS P+IPEV IPE+  +  A +LR+++N  L  LR+I  GRDLK FL+VI 
Sbjct  121  WSNVCIFIHKSPPNIPEVKIPEDLTVNIALSLRHEINRGLFTLREIGHGRDLKKFLIVIG  180

Query  666  GLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAK  845
            GLW++S++GSCC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKAM ELKK YA+F+ K
Sbjct  181  GLWVLSVLGSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEK  240

Query  846  VLSKIPRGPLKDKK  887
            VLSKIP+G LK+KK
Sbjct  241  VLSKIPKGALKNKK  254



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            AKV RLFGR++PVH+VLGGGK ADV LWR+KKIS G L  ATAIW++FE++ YHLLT VC
Sbjct  46   AKVYRLFGREKPVHQVLGGGKSADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTFVC  105

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            HGLIL+L +LFLWS A +FI KS P IPEV IPE+  +Q A  LR ++N  LAVLR++A 
Sbjct  106  HGLILSLVILFLWSKACTFINKSPPRIPEVSIPEDQAVQVARTLRYEMNRALAVLREVAL  165

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            GRD+K FL VI GLW++S+VGS  +FLTL YI  V LHTVPVLYEKYED+VDA AEKAM 
Sbjct  166  GRDVKKFLTVIAGLWLLSMVGSSVNFLTLVYILFVTLHTVPVLYEKYEDKVDAAAEKAMA  225

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            E+KKQYAV D KVLSKIPRGPLKDKK
Sbjct  226  EIKKQYAVLDDKVLSKIPRGPLKDKK  251



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 198/286 (69%), Gaps = 40/286 (14%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            A E    ++SLVEKI DKIH HDSSSS   + +            +KV RLFGR++P+H 
Sbjct  5    APEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW
Sbjct  121  ASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLW  180

Query  675  IISIVGSCCDFLTLFYIA--------------------------------VVLLHTVPVL  758
            ++SIVG+ C+F+TLFYI                                  VLLHTVPV+
Sbjct  181  LLSIVGNWCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYGSFETVFVLLHTVPVI  240

Query  759  YEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDK  884
            YEKYED++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  241  YEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  286



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M AK+ RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  1    MKAKIYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTL  60

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            VCH LI++LA+LFLWSNASSFI KS P+IPEV IPE+  +  A  LR ++N   A LR+I
Sbjct  61   VCHCLIVSLAILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREI  120

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
              G DLK FL+VI GLW+ S++GSCC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKA
Sbjct  121  GHGHDLKKFLIVIAGLWLFSVLGSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKA  180

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
            M ELKK YA+FD K LSKIP+G LKDKK
Sbjct  181  MIELKKYYAIFDEKCLSKIPKG-LKDKK  207



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   278 bits (712),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 159/250 (64%), Positives = 198/250 (79%), Gaps = 2/250 (1%)
 Frame = +3

Query  144  DRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            + KEE+S++EK+++K+H     SSS SD EK+      + +++ AK+ RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDEKKGSSSSSSAAAVKAKIYRLFGRERPVHSV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GR+LK FL+VI GLWI
Sbjct  123  STFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRELKKFLIVIAGLWI  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +S++GS C+FLTLFYI  V L+TVPVLYEKYED+VDA  EKA  ELKK YA+F+ K LSK
Sbjct  183  LSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDALGEKAEIELKKYYALFEEKCLSK  242

Query  858  IPRGPLKDKK  887
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            VCH LIL+LAV +LWSNAS+FI KS P IP V IPE+ VL+ ASALR ++N    VLR+I
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKSQPQIPXVQIPEKTVLELASALRIELNKGFYVLRBI  161

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA
Sbjct  162  ASGRDLKAFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKA  221

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
              E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  222  WIEIKKQYAVFDAKVLSKIPKGPVKEKK  249



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   280 bits (715),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 198/286 (69%), Gaps = 40/286 (14%)
 Frame = +3

Query  135  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            A E    ++SLVEKI DKIH HDSSSS   + +            +KV RLFGR++P+H 
Sbjct  5    APEHESADKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            AS+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW
Sbjct  121  ASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLW  180

Query  675  IISIVGSCCDFLTLFYIA--------------------------------VVLLHTVPVL  758
            ++SIVG+ C+F+TLFYI                                  VLLHTVPV+
Sbjct  181  LLSIVGNWCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYGSFETVFVLLHTVPVI  240

Query  759  YEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDK  884
            YEKYED++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  241  YEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  286



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 200/248 (81%), Gaps = 3/248 (1%)
 Frame = +3

Query  153  EEESLVEKIADKIHRH---dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            E ESL+EK+++KIH      SSSSSD E E++    +  S+ +KV RLFGR++PVHKVLG
Sbjct  22   ERESLMEKLSEKIHHKGDSSSSSSSDDENEKKSSSSSPKSLKSKVYRLFGRERPVHKVLG  81

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  503
            GGK AD+F+W++KK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ 
Sbjct  82   GGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  504  FIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIIS  683
            FI KS P IPEVHIPEEP+LQ AS LR ++N  ++ LR+IASGRD+K FL  I GLW++S
Sbjct  142  FIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDIKKFLSAIAGLWVLS  201

Query  684  IVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  863
            I+G C  FLTL YIA+VLL TVP+ Y+KYED+VD++ EKAM ELKKQYAV DAKV SKIP
Sbjct  202  ILGGCYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAELKKQYAVLDAKVFSKIP  261

Query  864  RGPLKDKK  887
            RGPLKDKK
Sbjct  262  RGPLKDKK  269



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   278 bits (711),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            + RLFGR++ VH VLGGGK AD+ LWRNKKIS GVL  ATAIW+LFEV+EYHLLT VCH 
Sbjct  53   IYRLFGRERDVHSVLGGGKTADLVLWRNKKISGGVLASATAIWLLFEVMEYHLLTLVCHC  112

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            LIL+LA+LFLWSNAS+FI KS P+IPEV I E+  +  A +LR ++N   A LR+I  GR
Sbjct  113  LILSLAILFLWSNASTFINKSPPNIPEVKISEDVAVNVALSLRYEINRGFATLREIGHGR  172

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DLK FL+VI G W++S++GSCC+FLTLFYI  V+L+TVPVLYEKYED+VDAF EKAM EL
Sbjct  173  DLKKFLIVIAGFWLLSVLGSCCNFLTLFYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIEL  232

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KK YA+FD K LSKIP+GPLKDKK
Sbjct  233  KKYYAIFDEKCLSKIPKGPLKDKK  256



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 171/257 (67%), Positives = 201/257 (78%), Gaps = 3/257 (1%)
 Frame = +3

Query  123  ESAMAEEDRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGR  296
            E   A    ++E SL+EKI DKIH   HDSSSSS S+ + E+ +K T S+ AKV R+FGR
Sbjct  4    EKEHAGSPVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAI  123

Query  477  LFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLM  656
            LFLWSNA +FI K+ PHIP+VH+PEEP LQ AS LR  +N   A+L DIASGRDLK FL 
Sbjct  124  LFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLA  183

Query  657  VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVF  836
            VI GLW++S+VG  C+FLTLFYI  VLLHTVPV+YEKYED++D  AEKA  E KKQYAVF
Sbjct  184  VIAGLWVLSVVGKWCNFLTLFYICFVLLHTVPVIYEKYEDKIDPLAEKATIEFKKQYAVF  243

Query  837  DAKVLSKIPRGPLKDKK  887
            DAKVLSKIP G LK K+
Sbjct  244  DAKVLSKIPHG-LKSKR  259



>ref|XP_007040378.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOY24879.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
Length=277

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 210/249 (84%), Gaps = 2/249 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE + K EE+L+EKI +KIH HDSSSSS S+ E+ +  ++   + + V RLFGR++PVH
Sbjct  1    MAEHEEKHEETLMEKITEKIHGHDSSSSSSSDDEDNKPSESP--IKSNVFRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            +VLGGGK AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT VCH LILALA+LFLWS
Sbjct  59   QVLGGGKPADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTLVCHLLILALAILFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA++FI KS P IPEV IP+EPVL+FA ALR ++N   AVLRDIASGRDLK FL VI GL
Sbjct  119  NATTFINKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKAMHE+KKQYAVFDAKVL
Sbjct  179  WVLSIVGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKAMHEIKKQYAVFDAKVL  238

Query  852  SKIPRGPLK  878
            SKIPRGPL 
Sbjct  239  SKIPRGPLN  247



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  55   VKSKIFRLFGREKPVHKVLGGGKPADVFLWRNKKISASVLAGATVLWVFFELLEYHLITL  114

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            VCH LI  LAV +LWSNAS+FI KS P IP+V IPE+ VL+ ASALR ++N    VLRDI
Sbjct  115  VCHLLITFLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRDI  174

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL V+  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA
Sbjct  175  ASGRDLKAFLGVVAVLWILSVVGKWFNFLTLFYILFVLLHTLPVIYEKYDDQIDAFGEKA  234

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
              E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  235  WIEIKKQYAVFDAKVLSKIPKGPVKEKK  262



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 170/257 (66%), Positives = 201/257 (78%), Gaps = 3/257 (1%)
 Frame = +3

Query  123  ESAMAEEDRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGR  296
            E   A    ++E SL+EKI DKIH   HDSSSSS S+ + E+ +K T S+ AKV R+FGR
Sbjct  4    EKEHAGSSVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAI  123

Query  477  LFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLM  656
            LFLWSNA +FI K+ PHIP+VH+PEEP LQ AS LR  +N   A+L DIASGRDLK FL 
Sbjct  124  LFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLA  183

Query  657  VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVF  836
            VI GLW++S+VG  C+FLTLFYI  VLLHTVPV+YE+YED++D  AEKA  E KKQYAVF
Sbjct  184  VIAGLWVLSVVGKWCNFLTLFYICFVLLHTVPVIYERYEDKIDPLAEKATIEFKKQYAVF  243

Query  837  DAKVLSKIPRGPLKDKK  887
            DAKVLSKIP G LK K+
Sbjct  244  DAKVLSKIPHG-LKSKR  259



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            VCH LIL+LAV +LWSNAS+FI KS P IP+V IPE+ VL+ ASALR ++N    VLR+I
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRNI  161

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA
Sbjct  162  ASGRDLKAFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKA  221

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
              E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  222  WIEIKKQYAVFDAKVLSKIPKGPVKEKK  249



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 204/266 (77%), Gaps = 11/266 (4%)
 Frame = +3

Query  123  ESAMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMD  269
            ES +A E   +  E ESL++KI++KIH           S    D +K++ +K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKTKKPSSPSSMQ  68

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +C
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLIC  128

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            H +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IAS
Sbjct  129  HVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIAS  188

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            GR+LK FL+ I GLWI+SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ 
Sbjct  189  GRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVI  248

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  249  ELKKQYAVLDEKVLSKIPLGPLKNKK  274



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 196/244 (80%), Gaps = 1/244 (0%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            +V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWA  119

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA +FIKK+ P IPEVH+PEEP LQ ASA R ++NH  AVLR IASGRDLK FLM I  L
Sbjct  120  NAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAAL  179

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++S+VGS C+FLTLFYIA+VLLH VPVLYEKYED++D  AEKAM E+KKQYAVFDAKVL
Sbjct  180  WVLSVVGSWCNFLTLFYIALVLLHIVPVLYEKYEDKIDPLAEKAMIEIKKQYAVFDAKVL  239

Query  852  SKIP  863
            SKIP
Sbjct  240  SKIP  243



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 158/250 (63%), Positives = 196/250 (78%), Gaps = 2/250 (1%)
 Frame = +3

Query  144  DRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            + KEE+S++EK+++K+H     SSS SD +K+        ++M AK+ RLFGR++PV  V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGRERPVQSV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI
Sbjct  123  STFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWI  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +S++GS C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E KK YA+F+ K LSK
Sbjct  183  LSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFEEKCLSK  242

Query  858  IPRGPLKDKK  887
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 201/254 (79%), Gaps = 5/254 (2%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+FLWRNKK+S GVLG  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
             +FI KS PHIPEVHIPE+P+LQ  S LR ++N  L +LR+IASG+D+K F++VI GLW+
Sbjct  123  CTFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGLWV  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL--  851
            +SI+GSC +FLTLFY A VLL T+PVLYEKYED+VDA+ EKAM E+KKQYAV D KVL  
Sbjct  183  LSIIGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVLRK  242

Query  852  --SKIPRGPLKDKK  887
              SKIPRG L  KK
Sbjct  243  VISKIPRGALNKKK  256



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 189/247 (77%), Gaps = 2/247 (1%)
 Frame = +3

Query  156  EESLVEKIADKIHRHdsssssdsek-eeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            EE+L+E++ +KI     SSSS     E+ +    T ++ +K+ RLFGR++PVH++LGGGK
Sbjct  6    EETLIEQVTEKIRDGVDSSSSSDSDDEKSKASVVTEAVKSKINRLFGREKPVHQILGGGK  65

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  512
             ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA+  I 
Sbjct  66   PADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLIN  125

Query  513  -KSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIV  689
             +S PHIP V IPE  V+  A +LR ++N   AVLR+IA+GRDLK FL+VI GLW++S V
Sbjct  126  NRSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREIATGRDLKKFLIVIAGLWVLSTV  185

Query  690  GSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRG  869
            G CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEKA  E KK YAVF AK LSKIPRG
Sbjct  186  GRCCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEKASVEFKKHYAVFQAKYLSKIPRG  245

Query  870  PLKDKKL  890
            PLKDKK 
Sbjct  246  PLKDKKF  252



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 205/265 (77%), Gaps = 10/265 (4%)
 Frame = +3

Query  123  ESAMAEE---DRKEEESLVEKIADKIHR-------HdsssssdsekeeeekkkttssMDA  272
            ES +A E   +  E ESL++KI++KIH          SS   D +K++ +K  + SSM +
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKTKKPSSPSSMQS  68

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH
Sbjct  69   KVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICH  128

Query  453  GLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASG  632
             +I+ LAVLFLWSNA+ FI KS P IPE+HIPEEP+LQ AS LR ++N   + LR+IASG
Sbjct  129  VMIVVLAVLFLWSNATMFINKSPPKIPEIHIPEEPILQLASGLRIEINRGFSSLREIASG  188

Query  633  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  812
            R+LK FL+ I GLWI+SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ E
Sbjct  189  RELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIE  248

Query  813  LKKQYAVFDAKVLSKIPRGPLKDKK  887
            LKKQYAV D KVLSKIP GPLK+KK
Sbjct  249  LKKQYAVLDEKVLSKIPLGPLKNKK  273



>ref|XP_007040377.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
 gb|EOY24878.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
Length=291

 Score =   278 bits (711),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 210/249 (84%), Gaps = 2/249 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE + K EE+L+EKI +KIH HDSSSSS S+ E+ +  ++   + + V RLFGR++PVH
Sbjct  1    MAEHEEKHEETLMEKITEKIHGHDSSSSSSSDDEDNKPSESP--IKSNVFRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            +VLGGGK AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT VCH LILALA+LFLWS
Sbjct  59   QVLGGGKPADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTLVCHLLILALAILFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA++FI KS P IPEV IP+EPVL+FA ALR ++N   AVLRDIASGRDLK FL VI GL
Sbjct  119  NATTFINKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKAMHE+KKQYAVFDAKVL
Sbjct  179  WVLSIVGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKAMHEIKKQYAVFDAKVL  238

Query  852  SKIPRGPLK  878
            SKIPRGPL 
Sbjct  239  SKIPRGPLN  247



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 162/254 (64%), Positives = 197/254 (78%), Gaps = 6/254 (2%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + AK+ RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSN  +FI K++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+
Sbjct  118  LWSNVHTFINKASPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVV  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+ C+FLTL Y   V+LHTVP+LYEK+ED+VD  AEKA+ EL+KQY VFD 
Sbjct  178  VGLWIISVVGNWCNFLTLVYFCFVILHTVPMLYEKHEDKVDPLAEKALKELQKQYVVFDE  237

Query  843  KVLSKIPRGPLKDK  884
            KVLSKIP   LK K
Sbjct  238  KVLSKIPIASLKAK  251



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 169/268 (63%), Positives = 200/268 (75%), Gaps = 18/268 (7%)
 Frame = +3

Query  132  MAEEDRKEE------------ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAK  275
            MAEE + EE            ES++EKIA+KIH H  SSSS S   +++KK ++  +  K
Sbjct  1    MAEEHKHEESIMEKIAEKIHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTK  58

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QPVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H 
Sbjct  59   VYRLFGREQPVHKVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHI  118

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
             IL LAVLFLWS+AS+FI K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGR
Sbjct  119  SILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGR  178

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+
Sbjct  179  DLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREI  238

Query  816  KKQYAVFD----AKVLSKIPRGPLKDKK  887
            KKQY VFD    +KV+SKIP+G    KK
Sbjct  239  KKQYVVFDEKVLSKVMSKIPKGAFYKKK  266



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 205/266 (77%), Gaps = 11/266 (4%)
 Frame = +3

Query  123  ESAMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMD  269
            ES +A E   +  E ESL++KI++KIH           S    D +K++++K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKKKKPSSPSSMQ  68

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +C
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLIC  128

Query  450  HGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIAS  629
            H +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IAS
Sbjct  129  HVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIAS  188

Query  630  GRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMH  809
            GR+LK FL+ I GLWI+SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ 
Sbjct  189  GRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVI  248

Query  810  ELKKQYAVFDAKVLSKIPRGPLKDKK  887
            ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  249  ELKKQYAVLDEKVLSKIPLGPLKNKK  274



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   276 bits (706),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 196/250 (78%), Gaps = 8/250 (3%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKI++KIH HD SSSS S+ ++++   +   +  K+ RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSAS---LKTKIYRLFGREQPLH  56

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            K+ GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS
Sbjct  57   KLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWS  116

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +AS+FI KS  HIPEVHIPE+ VLQ AS LR ++N    VLRDIASGRDLK FL+VI GL
Sbjct  117  SASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGL  176

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    
Sbjct  177  WVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVL  236

Query  840  AKVLSKIPRG  869
            +KV+SKIP+G
Sbjct  237  SKVMSKIPKG  246



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   276 bits (707),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 194/245 (79%), Gaps = 3/245 (1%)
 Frame = +3

Query  153  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E ESL+EKI++K+H       S S     + +    S+ +KV RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMEKISEKVHH---KGDSSSSSSSSDDENEKKSLKSKVYRLFGRERPVHKVLGGGK  78

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  512
             AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI 
Sbjct  79   PADIFMWKNKKMSGGVFGGATVAWVLFELIEYHLLTLLCHVMIVLLAVLFLWSNATMFIH  138

Query  513  KSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  692
            KS P IPEVHIPEEP+LQ AS LR ++N   + LR IASGRDLK FL  I GLW++S++G
Sbjct  139  KSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLRQIASGRDLKKFLSAIVGLWVLSVLG  198

Query  693  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  872
             CC FLTL YIA+VLL T+P+LY+KYED+VD++ EKAM ELKKQYAVFDAKVLSKIPRGP
Sbjct  199  GCCSFLTLAYIALVLLFTLPLLYDKYEDKVDSYGEKAMAELKKQYAVFDAKVLSKIPRGP  258

Query  873  LKDKK  887
            LKDKK
Sbjct  259  LKDKK  263



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   276 bits (707),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 205/264 (78%), Gaps = 9/264 (3%)
 Frame = +3

Query  123  ESAMAEE---DRKEEESLVEKIADKIH------RHdsssssdsekeeeekkkttssMDAK  275
            ES +A E   +  E ESL++KI++KIH         SS   D +K++++K  + SSM +K
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHGGDSSSSSSSSDDDDDKKKKKKKPSSPSSMQSK  68

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH 
Sbjct  69   VYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHV  128

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR
Sbjct  129  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGR  188

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DLK FL+ I GLW++SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ EL
Sbjct  189  DLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIEL  248

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAV D KVLSKIP GPLK+KK
Sbjct  249  KKQYAVLDEKVLSKIPLGPLKNKK  272



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   275 bits (704),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 195/254 (77%), Gaps = 8/254 (3%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    E+SL++KI++KIH HDSSS S+ EK +         + AK+ RLFGR++
Sbjct  1    MAEEIEKSMPAEQSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREK  55

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  56   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLF  115

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +FIKKS P IPE+H+PEEP L  AS+LRN++N    +LR IA GRDLK FLMV+
Sbjct  116  LWSNAHTFIKKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMVV  175

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+ C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  EL K Y VFD 
Sbjct  176  VGLWIISVVGNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDE  235

Query  843  KVLSKIPRGPLKDK  884
            KV+SKIP   LK K
Sbjct  236  KVVSKIPIASLKAK  249



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   275 bits (704),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 166/244 (68%), Positives = 196/244 (80%), Gaps = 1/244 (0%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            +V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWA  119

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA +FIKK+ P IPEVH+PEEP LQ ASA R ++NH  AVLR IASGRDLK FLM I  L
Sbjct  120  NAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAAL  179

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++S+VGS C+FLTLFYIA+VLLH +PVLYEKYED++D  AEKAM E+KKQYAVFDAKVL
Sbjct  180  WVLSVVGSWCNFLTLFYIALVLLHILPVLYEKYEDKIDPLAEKAMIEIKKQYAVFDAKVL  239

Query  852  SKIP  863
            SKIP
Sbjct  240  SKIP  243



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 198/256 (77%), Gaps = 10/256 (4%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +A++FI K+ PHIPEVHIPEE VLQ AS LR ++N    +LR+IA GRDLK FLMV+ GL
Sbjct  115  SATTFIHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++S VGS C+FLTL YIA VLL TVPV YEKYED+VD F EKAM E+KKQYAV D    
Sbjct  175  WVLSKVGSSCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVL  234

Query  840  AKVLSKIPRGPLKDKK  887
            +KV+SKIPRG    KK
Sbjct  235  SKVMSKIPRGAFNKKK  250



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 203/257 (79%), Gaps = 6/257 (2%)
 Frame = +3

Query  132  MAEEDRKE------EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  293
            MAEE  +       +ESL++KI +K+H HDSSSSS S+ + + +K  TSS+  KV RLFG
Sbjct  1    MAEEPERTVTTGAADESLLDKITEKLHGHDSSSSSSSDSDSDSEKTVTSSVKDKVFRLFG  60

Query  294  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  473
            R++PVH V G GK ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LA
Sbjct  61   RERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLA  120

Query  474  VLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFL  653
            VLFLWSNA +FI KS P IPE H+PEEP LQ ASALR +VN   AVL  I SGRDLK FL
Sbjct  121  VLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSGRDLKKFL  180

Query  654  MVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAV  833
            +VI  +WI+SIVG+ C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E+KKQYAV
Sbjct  181  VVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIEIKKQYAV  240

Query  834  FDAKVLSKIPRGPLKDK  884
            FDAKVLSKIP GPLK K
Sbjct  241  FDAKVLSKIPLGPLKAK  257



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/259 (61%), Positives = 195/259 (75%), Gaps = 6/259 (2%)
 Frame = +3

Query  132  MAEEDR---KEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGR  296
            MAE++      +ES V+KI DK+H    DSSSSS S   + + KKTT++  + V+   GR
Sbjct  1    MAEQEEITDPGQESFVDKITDKLHGSNDDSSSSSSSSDSDSDAKKTTAAPPSPVKEEIGR  60

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVHKV GGGK AD+FLWR+KKIS GVLGG TA+W+LFE+LEYHLLT VCH +I  L++
Sbjct  61   EKPVHKVFGGGKPADIFLWRDKKISGGVLGGVTAVWVLFELLEYHLLTLVCHIVIFTLSM  120

Query  477  LFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLM  656
            LFLWSN + FI K  P IP V + EEP +  A ALRN++N   AVLR+IASGRDLK FL+
Sbjct  121  LFLWSNVTIFINKRPPPIPVVSLSEEPFVGVALALRNEINRTCAVLREIASGRDLKKFLV  180

Query  657  VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVF  836
            V+  LW  SIVGSCC+FLTLFY+  VLLHTVPVLYEKY +++DAF EKA  E+KKQYAVF
Sbjct  181  VVAVLWFFSIVGSCCNFLTLFYLVFVLLHTVPVLYEKYNEKIDAFTEKATVEIKKQYAVF  240

Query  837  DAKVLSKIPRGPLKDKKLA  893
            DAK L KIP+GP  DKK A
Sbjct  241  DAKFLCKIPKGPF-DKKRA  258



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 200/252 (79%), Gaps = 7/252 (3%)
 Frame = +3

Query  153  EEESLVEKIADKIHR-------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            E ESL++KI++KIH          SS   + ++++ +K ++ SSM +KV RLFGR++PVH
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEYKEKKTKKPESPSSMKSKVYRLFGREKPVH  81

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KVLGGGK AD+F+W++KKIS GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWS
Sbjct  82   KVLGGGKPADIFMWKDKKISGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWS  141

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA+ FI KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GL
Sbjct  142  NATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIVGL  201

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVL
Sbjct  202  WVLSIMGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVL  261

Query  852  SKIPRGPLKDKK  887
            SKIP GPLK+KK
Sbjct  262  SKIPMGPLKNKK  273



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 204/265 (77%), Gaps = 10/265 (4%)
 Frame = +3

Query  123  ESAMAEE---DRKEEESLVEKIADKIHR-------HdsssssdsekeeeekkkttssMDA  272
            ES +A E   +  E ESL++KI++KIH          SS   D +K+ ++    +SSM +
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDEKKKTKKPSSPSSSMKS  68

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            KV RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH
Sbjct  69   KVYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCH  128

Query  453  GLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASG  632
             +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASG
Sbjct  129  VMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASG  188

Query  633  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  812
            RDLK FL+ I GLW++SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E
Sbjct  189  RDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIE  248

Query  813  LKKQYAVFDAKVLSKIPRGPLKDKK  887
            LKKQYAV D KVLSKIP GPLK+KK
Sbjct  249  LKKQYAVLDEKVLSKIPLGPLKNKK  273



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 192/250 (77%), Gaps = 9/250 (4%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KIH HD SSSS    ++++       +  K+ RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDDSSSSSDSDDDKKSST----LKTKIYRLFGREQPVH  55

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            K+ GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS
Sbjct  56   KIFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWS  115

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +A++FI K+ PHIPEVHIPEE VLQ AS LR ++N     LRDIASGRDLK FL+VI GL
Sbjct  116  SATTFIHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTALRDIASGRDLKKFLLVIAGL  175

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    
Sbjct  176  WVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVL  235

Query  840  AKVLSKIPRG  869
            +KV+SKIP+G
Sbjct  236  SKVMSKIPKG  245



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 194/252 (77%), Gaps = 8/252 (3%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    E+SL++KI++KIH HDSSS S+ EK +         + AK+ RLFGR++
Sbjct  1    MAEEIEKSMPAEQSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREK  55

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  56   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLF  115

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +FIKKS P IPE+H+PEEP L  AS+LRN++N    +LR IA GRDLK FLM++
Sbjct  116  LWSNAHTFIKKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMIV  175

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+ C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  EL K Y VFD 
Sbjct  176  VGLWIISVVGNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDE  235

Query  843  KVLSKIPRGPLK  878
            KV+SKIP   LK
Sbjct  236  KVVSKIPIASLK  247



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 195/255 (76%), Gaps = 9/255 (4%)
 Frame = +3

Query  132  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAE + + E   ESLV+KI +KI  HDSSSSSDS+ E+ +       + +KV RLFGR++
Sbjct  1    MAEHEGQRESAAESLVDKITEKISGHDSSSSSDSDNEKFDA------VKSKVFRLFGRER  54

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I  LAVLF
Sbjct  55   PVHKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFFLAVLF  114

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSN S F+ K  P IPEV +PE+ V + ASALR ++N   AVL DIASGRDLK  L VI
Sbjct  115  LWSNTSDFLNKPPPKIPEVVLPEQCVREVASALRIEINRGFAVLHDIASGRDLKKVLAVI  174

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLW++S++GSC + LTL YI+ VLLHTVPVLYEKYED+VDA++EK   E+KKQYAVFD 
Sbjct  175  AGLWVLSLIGSCINILTLLYISFVLLHTVPVLYEKYEDQVDAYSEKTWIEIKKQYAVFDE  234

Query  843  KVLSKIPRGPLKDKK  887
            K LSKIP+G LK +K
Sbjct  235  KYLSKIPKGALKGEK  249



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 165/257 (64%), Positives = 200/257 (78%), Gaps = 7/257 (3%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EESL+EKI++KIH H  SSSS S+ ++E+K  ++  +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESLMEKISEKIHGHGDSSSSSSDSDDEKKSDSS--LKTKIYRLFGREKPVH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATISWILFELLEYNLLTLFGHVSILALAVLFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +A++FI K+ PHIPE+HIPE+ VL+ AS LR ++N    VLR IA GRDLK FLMV+ GL
Sbjct  118  SATTFIHKTPPHIPEIHIPEKIVLELASGLRIEINRGFTVLRHIALGRDLKKFLMVVAGL  177

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++SI+GS C FLTL YIA V+L TVPVLYEKYED+VD F EKAM E+KKQYAV D    
Sbjct  178  WVLSILGSSCTFLTLVYIATVILFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEKVL  237

Query  840  AKVLSKIPRGPLKDKKL  890
            +KV+SKIP G L  KKL
Sbjct  238  SKVMSKIPIGALMKKKL  254



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 202/257 (79%), Gaps = 6/257 (2%)
 Frame = +3

Query  132  MAEEDRKE------EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  293
            MAEE          +ESL++KI +K+H HDSSSSS S+ + + +K  TSS+  KV RLFG
Sbjct  1    MAEEPESTVTNGAADESLLDKITEKLHGHDSSSSSSSDSDSDSEKTVTSSVKDKVFRLFG  60

Query  294  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  473
            R++PVH V G GK ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LA
Sbjct  61   RERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLA  120

Query  474  VLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFL  653
            VLFLWSNA +FI KS P IPE H+PEEP LQ ASALR +VN   AVL  I SGRDLK FL
Sbjct  121  VLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSGRDLKKFL  180

Query  654  MVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAV  833
            +VI  +WI+SIVG+ C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E+KKQYAV
Sbjct  181  VVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIEIKKQYAV  240

Query  834  FDAKVLSKIPRGPLKDK  884
            FDAKVLSKIP GPLK K
Sbjct  241  FDAKVLSKIPLGPLKAK  257



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 196/256 (77%), Gaps = 10/256 (4%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +A++FI K  PHIPEVHIPEE  LQ AS LR ++N    +LR+IA GR+LK FLMV+ GL
Sbjct  115  SATTFIHKKPPHIPEVHIPEEVALQLASGLRIEINRGFTILRNIALGRELKKFLMVVAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++S VGS C+FLTL YIA VLL TVPV YEKYED+VD F EKAM E+KKQYAV D    
Sbjct  175  WVLSKVGSSCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVL  234

Query  840  AKVLSKIPRGPLKDKK  887
            +KV+SKIPRG    KK
Sbjct  235  SKVMSKIPRGAFNKKK  250



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   273 bits (699),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 199/253 (79%), Gaps = 8/253 (3%)
 Frame = +3

Query  153  EEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            E ESL++KI++KIH           S    D ++++ +K ++ SSM +KV RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDDDDDKKEKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I G
Sbjct  142  SNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFG  201

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KV
Sbjct  202  LWVLSIMGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKV  261

Query  849  LSKIPRGPLKDKK  887
            LSKIP GPLK+KK
Sbjct  262  LSKIPMGPLKNKK  274



>gb|KFK31901.1| hypothetical protein AALP_AA6G173800 [Arabis alpina]
Length=259

 Score =   273 bits (697),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W+ KK+S GV GGAT  W+LFE++EYHLLT + H 
Sbjct  54   VYRLFGREKPVHKVLGGGKPADIFMWKKKKMSGGVFGGATVAWVLFELMEYHLLTLLSHV  113

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            +IL LAVLFLWSNA+ FI KS P IP++HIPEEP+LQ AS LR ++N   + L +IASGR
Sbjct  114  MILLLAVLFLWSNATMFIHKSPPKIPQLHIPEEPLLQLASGLRIEINRGFSSLHEIASGR  173

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DLK FL VI GLW++SI+G CC FLTL YIA+VLL TVP+LY+KYED+VD + EKAM EL
Sbjct  174  DLKKFLSVIAGLWVLSILGGCCSFLTLAYIALVLLFTVPLLYDKYEDKVDPYGEKAMLEL  233

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAVFDAKVLSKIP GPLK+KK
Sbjct  234  KKQYAVFDAKVLSKIPMGPLKNKK  257



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 159/256 (62%), Positives = 193/256 (75%), Gaps = 4/256 (2%)
 Frame = +3

Query  132  MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkt--tssMDAKVRRLFGRQ  299
            MAE  E+ K  ESL++KIADKIH HDS  S   E   E+   +   +S+ AK   LFGR+
Sbjct  1    MAEHTEEVKAAESLMDKIADKIHGHDSPVSPAVESLHEKAVSSGHAASLKAKAYSLFGRE  60

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVH V GGGK ADVFLWR+KK S  VL   T IW+ FE+L YHLLT + H LIL LA+L
Sbjct  61   KPVHNVFGGGKAADVFLWRDKKGSASVLIAITIIWVFFELLGYHLLTLMAHCLILVLAML  120

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNAS+FI KS P IP+V IPE+PVLQ ASA+  ++N    +LR+IASG+DLK FL V
Sbjct  121  FLWSNASTFINKSPPRIPQVKIPEKPVLQIASAITIEINRAFVILREIASGKDLKQFLSV  180

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            I GLW++SI+G   +FLTL YI VVLL T+PV YEKY+D+VDAFAEKAM E+KKQYAVFD
Sbjct  181  IAGLWVLSILGKWYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAFAEKAMIEIKKQYAVFD  240

Query  840  AKVLSKIPRGPLKDKK  887
            AKVLSK+P+G +KDKK
Sbjct  241  AKVLSKVPKGQMKDKK  256



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 199/245 (81%), Gaps = 0/245 (0%)
 Frame = +3

Query  153  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E ESL++KI++K+H    SSSSD ++++++  ++ SSM +KV RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMDKISEKLHHGGDSSSSDEDEKKKKSSESPSSMKSKVYRLFGREKPVHKVLGGGK  81

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  512
             AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI 
Sbjct  82   PADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFIN  141

Query  513  KSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  692
            KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW +SI+G
Sbjct  142  KSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLAAIAGLWFVSILG  201

Query  693  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  872
               +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GP
Sbjct  202  GWFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGP  261

Query  873  LKDKK  887
            LK+KK
Sbjct  262  LKNKK  266



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 197/254 (78%), Gaps = 6/254 (2%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + AK+ R+FGR++
Sbjct  1    MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA + I K++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+
Sbjct  118  LWSNAHTLINKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDLKKFLMVV  177

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD 
Sbjct  178  VGLWIISVVGNWFNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDE  237

Query  843  KVLSKIPRGPLKDK  884
            KVLSKIP   LK K
Sbjct  238  KVLSKIPIASLKAK  251



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 158/253 (62%), Positives = 199/253 (79%), Gaps = 8/253 (3%)
 Frame = +3

Query  153  EEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            E ESL++KI++KIH           S    D +K++ +K ++ SSM +KV RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEDKKKKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I G
Sbjct  142  SNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFG  201

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KV
Sbjct  202  LWVLSIMGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKV  261

Query  849  LSKIPRGPLKDKK  887
            LSKIP GPLK+KK
Sbjct  262  LSKIPMGPLKNKK  274



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 165/260 (63%), Positives = 199/260 (77%), Gaps = 10/260 (4%)
 Frame = +3

Query  132  MAEEDR-----KEEESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRL  287
            MA+E       + E SL+EKI +KIH   RH SSSSS    +E+ +KK  S + AKV R+
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRI  59

Query  288  FGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILA  467
            FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  
Sbjct  60   FGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIAT  119

Query  468  LAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKM  647
            LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L  IASG+DLK 
Sbjct  120  LAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHSIASGKDLKK  179

Query  648  FLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQY  827
            FL VI GLW++S+VG  C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK + E KKQY
Sbjct  180  FLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKVIIEFKKQY  239

Query  828  AVFDAKVLSKIPRGPLKDKK  887
            AVFDAKVLSKIPRG LK+K+
Sbjct  240  AVFDAKVLSKIPRG-LKNKR  258



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/253 (59%), Positives = 187/253 (74%), Gaps = 7/253 (3%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE +   ESL+EKI DKI  H  S + +    +  +      M  KV R+FGR++PVH
Sbjct  1    MAEEVK--AESLMEKIEDKILGHHDSPAPEVVHHDSPRS-----MQDKVFRIFGRERPVH  53

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             V GGGK AD+FLWR+KK+S G+LGGAT +W+LFE+LEYHLLT V H LI A+ + FLWS
Sbjct  54   HVFGGGKLADIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFLWS  113

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            N   FI KS P IPE+ IPE+ +LQ  S++  ++N  L V+RDIASG+DLK FL VI GL
Sbjct  114  NGLGFINKSPPKIPEIQIPEKTLLQIVSSITFEINRALVVIRDIASGKDLKQFLSVIAGL  173

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SI+G  C+FLTL YIA+VLL +VPV YEKY+ ++D  AEKAM E+KKQYAVFDAKVL
Sbjct  174  WVVSILGKSCNFLTLLYIAIVLLFSVPVFYEKYDHKIDPLAEKAMFEIKKQYAVFDAKVL  233

Query  852  SKIPRGPLKDKKL  890
            SKIPRG LK KK+
Sbjct  234  SKIPRGALKAKKI  246



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 161/273 (59%), Positives = 205/273 (75%), Gaps = 21/273 (8%)
 Frame = +3

Query  132  MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsekeeeekk  248
            MAEE + EE              ESL++KI++KIH          SSS  + +K++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  249  kttssMDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEY  428
             + SSM +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EY
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEY  120

Query  429  HLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLA  608
            HLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   +
Sbjct  121  HLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFS  180

Query  609  VLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDA  788
             LR+IASGRDLK FL  + GLW++S++G   +FLTL YIA+VLL TVP++Y+KYED+VD 
Sbjct  181  SLREIASGRDLKKFLSAVAGLWVLSVLGGWFNFLTLAYIALVLLFTVPIVYDKYEDKVDP  240

Query  789  FAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  887
              EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  241  LGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  273



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH 
Sbjct  67   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHV  126

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR
Sbjct  127  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGR  186

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DLK FL+ I GLW++SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ EL
Sbjct  187  DLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIEL  246

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAV D KVLSKIP GPLK+KK
Sbjct  247  KKQYAVLDEKVLSKIPLGPLKNKK  270



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 196/258 (76%), Gaps = 5/258 (2%)
 Frame = +3

Query  132  MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkk---ttssMDAKVRRLFGR  296
            MAE  ++ K  ESL++K+ DKIH HDSSS+    +   +K      ++S+ +KV RLFGR
Sbjct  1    MAEHADEVKAAESLLDKVPDKIHGHDSSSALPPSEAVRDKGIGGGYSASLKSKVNRLFGR  60

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVH V GGGK AD+FLWR KK+S GVL   T IW+ FE+LEYHLLT V H LI+ + +
Sbjct  61   EKPVHHVFGGGKAADIFLWRGKKVSAGVLIALTIIWVFFELLEYHLLTLVSHLLIIGIVM  120

Query  477  LFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLM  656
            LFLWSNAS+FI KS PHIP+V IPE+PVLQ ASA+ +++N    ++R+IASG+DLK FL 
Sbjct  121  LFLWSNASTFINKSPPHIPQVQIPEKPVLQIASAITSEINRAFVIVREIASGKDLKQFLS  180

Query  657  VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVF  836
             I GLW++SI+G   +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVF
Sbjct  181  AIAGLWVVSILGKYYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKALTEMKKQYAVF  240

Query  837  DAKVLSKIPRGPLKDKKL  890
            DAKVLSKIPRG  K KK 
Sbjct  241  DAKVLSKIPRGQTKAKKF  258



>ref|XP_012090159.1| PREDICTED: reticulon-like protein B5 [Jatropha curcas]
 gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 191/243 (79%), Gaps = 3/243 (1%)
 Frame = +3

Query  159  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++KI +KI  HDSSSSSDS+ ++  K      + +K+ RLFGR++PVHKVLGGGK A
Sbjct  7    ESLMDKITEKIRGHDSSSSSDSDDDKPSKVDA---VKSKIFRLFGREKPVHKVLGGGKPA  63

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  518
            DV LWRNK++S  VLGGAT +W+LFE+LEYHL+T VCH  IL LA+LFLWSNAS+F+ KS
Sbjct  64   DVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFLWSNASTFVNKS  123

Query  519  AphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSC  698
             P IP++ +PE+ VL+ ASALR ++N  LAVL DIA+GRD+K FL VI  LW++SI+GS 
Sbjct  124  PPEIPQIVLPEKYVLEIASALRIEINRALAVLHDIAAGRDVKTFLTVIASLWVLSIIGSW  183

Query  699  CDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  878
             +FLTL YI  VLLHTVP+ YEKYED++D  AEKA  E+KKQY VFD KVLSKIP G LK
Sbjct  184  FNFLTLLYIVFVLLHTVPLAYEKYEDQIDPIAEKAWIEIKKQYVVFDEKVLSKIPVGLLK  243

Query  879  DKK  887
            + K
Sbjct  244  ELK  246



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 195/251 (78%), Gaps = 1/251 (0%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeek-kkttssMDAKVRRLFGRQQPVHK  314
            EE     +S+++K++DK+H    SSSS S+ ++E+K   + ++M +K+ RLFGR++PVH 
Sbjct  6    EESESVVQSMMDKVSDKLHGSGDSSSSSSDSDDEKKGSSSAAAMKSKIYRLFGREKPVHS  65

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK AD+ LWRNKK S  VL GAT+IW+LFEV+EYHLL  VCH LIL+LA LFLWSN
Sbjct  66   VLGGGKPADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNLVCHCLILSLATLFLWSN  125

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            A +FI KS P+IPEV IPE+  +  A +LR ++N   + LRDI  GRDLK FL+VI  LW
Sbjct  126  ACTFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFSTLRDIGHGRDLKKFLIVIASLW  185

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            ++S++G+CC+FLTL YI  V+L+TVPVLYEKYED+VDAF EKAM ELKK YA+F+ K LS
Sbjct  186  VLSVLGNCCNFLTLSYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIFEEKCLS  245

Query  855  KIPRGPLKDKK  887
            KIP+G LK+KK
Sbjct  246  KIPKGHLKNKK  256



>ref|XP_010447719.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 167/254 (66%), Positives = 203/254 (80%), Gaps = 5/254 (2%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
             +FI KS PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW+
Sbjct  123  CTFIHKSTPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWV  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  845
            +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSIIGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVFSK  242

Query  846  VLSKIPRGPLKDKK  887
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 192/254 (76%), Gaps = 5/254 (2%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    EESL+EKIA+KIH      SS S   + EK ++ S++ AK+ RLFGR++
Sbjct  1    MAEESEKPVHAEESLMEKIAEKIHD--HHDSSSSSDSDHEKPESPSALKAKIYRLFGREK  58

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LI +LA +F
Sbjct  59   PVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLVCHILIFSLAAMF  118

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +F+KKS P IPEVH+ EE  L  ASALRN++N    +LR IA GRDLK FLMV+
Sbjct  119  LWSNAHAFMKKSPPKIPEVHVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVV  178

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK + ELKK Y VFD 
Sbjct  179  VGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDE  238

Query  843  KVLSKIPRGPLKDK  884
            KVLSKIP   LK K
Sbjct  239  KVLSKIPLASLKAK  252



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   271 bits (692),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 205/273 (75%), Gaps = 21/273 (8%)
 Frame = +3

Query  132  MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsekeeeekk  248
            MAEE + EE              ESL++KI++KIH          SSS  + +K++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  249  kttssMDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEY  428
             + SSM +KV RLFGR++PVHKVLGGGK A++F+W+NKK+S GVLG ATA W+LFE++EY
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPAEIFMWKNKKMSGGVLGAATAAWVLFELMEY  120

Query  429  HLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLA  608
            HLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N   +
Sbjct  121  HLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFS  180

Query  609  VLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDA  788
             LR+IASGRDLK FL  + GLW++S++G   +FLTL YIA+VLL TVP++Y+KYED+VD 
Sbjct  181  SLREIASGRDLKKFLSAVAGLWVLSVLGGWFNFLTLAYIALVLLFTVPIVYDKYEDKVDP  240

Query  789  FAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  887
              EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  241  LGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  273



>gb|ABR17571.1| unknown [Picea sitchensis]
 gb|ACN40850.1| unknown [Picea sitchensis]
Length=259

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 184/254 (72%), Gaps = 3/254 (1%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttss---MDAKVRRLFGRQQPV  308
            EE     +S++EK+A+K+  HDSSSS   +++ ++ +        + + V+RLFGR++PV
Sbjct  6    EEAASFLDSVMEKVAEKLPGHDSSSSDSDDEKSKKPESKKPEPSSISSSVKRLFGREKPV  65

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H + GGGK ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT +CH LIL + +LF+W
Sbjct  66   HTLFGGGKSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVW  125

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNAS+FI K    IP++   E+     ASALR ++N    V+ D+ASGRDLK FLMV+ G
Sbjct  126  SNASAFINKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHDVASGRDLKKFLMVVAG  185

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LWI+S++GS  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KAM E KK Y  FDAKV
Sbjct  186  LWILSVIGSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKV  245

Query  849  LSKIPRGPLKDKKL  890
            LSKIPRGPLKDKK 
Sbjct  246  LSKIPRGPLKDKKF  259



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 193/256 (75%), Gaps = 7/256 (3%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KIH       S S   + +  K ++S+  K+ RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKIAEKIHG--HDDGSSSSSSDSDDDKKSASLKTKIYRLFGREQPLH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +A++FI KS PHIPEVHIPEE VL+ AS LR ++N    VLRDIASGRDLK FL+VI GL
Sbjct  118  SATTFIHKSPPHIPEVHIPEEVVLELASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGL  177

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++S +GS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD KVL
Sbjct  178  WVLSKLGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVL  237

Query  852  ----SKIPRGPLKDKK  887
                SKIP+G    KK
Sbjct  238  SKVMSKIPKGAFYKKK  253



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 194/251 (77%), Gaps = 4/251 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K  E + E + +KIH HDSSSSS+SE E+ +       + AK+ RLFGR++PVH
Sbjct  1    MAEEIEKSVE-VEESLMEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREKPVH  56

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWS
Sbjct  57   KVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWS  116

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA +FIKKS P IPE+H+PEE  L  AS+LRN+VN    +LR IA GRDLK FLMVI GL
Sbjct  117  NAHTFIKKSPPQIPEIHVPEEAFLVIASSLRNEVNQAFVILRSIALGRDLKKFLMVIVGL  176

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            WIIS+VG+  +FLTL YI  V+LHTVP++YEK+ED+VD FAEKAM EL+KQY VFD KV+
Sbjct  177  WIISVVGNWFNFLTLVYICFVVLHTVPMMYEKHEDKVDPFAEKAMKELQKQYLVFDEKVI  236

Query  852  SKIPRGPLKDK  884
            SKIP   LK K
Sbjct  237  SKIPIASLKAK  247



>ref|XP_004149448.1| PREDICTED: reticulon-like protein B1 [Cucumis sativus]
 ref|XP_011651426.1| PREDICTED: reticulon-like protein B1 [Cucumis sativus]
 gb|KGN57883.1| hypothetical protein Csa_3G363160 [Cucumis sativus]
Length=250

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR +PVH VLGGGK ADVFLW+NKK S GVLGGATA+WILFE+LEY L+T VCH 
Sbjct  45   VYRLFGRDKPVHTVLGGGKPADVFLWKNKKNSAGVLGGATALWILFELLEYQLITLVCHI  104

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            LI+ LA+ FLWS A++FI K+ P IP+V +PE+ +LQ  ++LR ++N  ++ LRD+ASGR
Sbjct  105  LIILLAIPFLWSYANTFINKTPPQIPDVRLPEDCLLQVVTSLRIEINRIISTLRDVASGR  164

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DL+ FL    GLWI+SI GS C+FLTL Y+  +LLHTVPVLYEKYED+VD FAEKA+ EL
Sbjct  165  DLRKFLSAFLGLWILSIAGSWCNFLTLLYMCFILLHTVPVLYEKYEDQVDPFAEKALIEL  224

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYA FDAKVLSKIP GPL++KK
Sbjct  225  KKQYAEFDAKVLSKIPLGPLQEKK  248



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 180/255 (71%), Gaps = 5/255 (2%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIH-RHdsssssdsekeeee-kkkttssMDAKVRRLFGRQQP  305
            MAE     EESL+EKI +K H RH SS     +++          ++ AK+ RLFGR++P
Sbjct  1    MAEH---REESLLEKITEKFHGRHSSSVVDSDDEKSSRGPSAAAEAVKAKIYRLFGREKP  57

Query  306  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  485
            VHKVLGGGK ADVFLWRNKK+S    G  TAIW+ FE++EYHL+T VCHGLIL+LA++FL
Sbjct  58   VHKVLGGGKPADVFLWRNKKVSASTFGAVTAIWVFFELMEYHLITLVCHGLILSLAIIFL  117

Query  486  WSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVIT  665
            W NA++FI KS PH+PEV I E+  L    +LR  +N  L  LRDIASGRDLK FL    
Sbjct  118  WCNATTFISKSRPHVPEVSISEDLALNVVLSLRYVINRGLVALRDIASGRDLKKFLAAAA  177

Query  666  GLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAK  845
             LW++SI+ +CC FL LFYIA V L+TVPVLYEKYED VDAFAEKA  E KK Y V   K
Sbjct  178  ALWVLSIIANCCSFLMLFYIAFVALYTVPVLYEKYEDRVDAFAEKAEAEFKKHYVVIHVK  237

Query  846  VLSKIPRGPLKDKKL  890
             LSKIP GPLKDKK 
Sbjct  238  YLSKIPMGPLKDKKF  252



>emb|CDY08353.1| BnaC09g12430D [Brassica napus]
Length=250

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 193/255 (76%), Gaps = 10/255 (4%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+ +Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELFQYNLLTLFGHISILALAVLFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +AS+FI K  P IPEVHIPEE VLQ AS LR ++N    +LR IA GRDLK FLMVI GL
Sbjct  115  SASTFIHKKPPRIPEVHIPEEVVLQLASGLRIEINRGFTLLRHIALGRDLKKFLMVIAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++S VGS C+FLTL Y A VLL TVPVLYEKYED+VD F EKAM E+KKQYAV D KVL
Sbjct  175  WVLSKVGSSCNFLTLVYSATVLLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEKVL  234

Query  852  ----SKIPRGPLKDK  884
                SKIP+G  K K
Sbjct  235  SKVISKIPKGAFKKK  249



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/254 (61%), Positives = 190/254 (75%), Gaps = 5/254 (2%)
 Frame = +3

Query  132  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            MAEE  K    EESL+EKIA+KIH      SS S   + EK ++ S++ AK+ RLFGR++
Sbjct  1    MAEESEKPVHTEESLMEKIAEKIHD--HHDSSSSSDSDHEKPESQSALKAKIYRLFGREK  58

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI +LA +F
Sbjct  59   PVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFSLAAMF  118

Query  483  LWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVI  662
            LWSNA +F+KKS P IPE+ + EE  L  ASALRN++N    +LR IA GRDLK FLMV+
Sbjct  119  LWSNAHAFMKKSPPKIPEIQVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVV  178

Query  663  TGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA  842
             GLWIIS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK + ELKK Y VFD 
Sbjct  179  VGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDE  238

Query  843  KVLSKIPRGPLKDK  884
            KVLSKIP   LK K
Sbjct  239  KVLSKIPLASLKAK  252



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 197/245 (80%), Gaps = 1/245 (0%)
 Frame = +3

Query  153  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E  SL++KI++KIH H   SSS S+ E E+K  + SSM +KV RLFGR++PVHKVLGGGK
Sbjct  68   ERGSLMDKISEKIH-HKGDSSSSSDDESEKKPSSPSSMKSKVYRLFGRERPVHKVLGGGK  126

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  512
             AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH +I+ LA LFLWSNA+ FI+
Sbjct  127  PADIFMWKNKKVSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVTLAALFLWSNATMFIR  186

Query  513  KSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  692
            KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI+SI+G
Sbjct  187  KSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWILSILG  246

Query  693  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  872
             CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELK QYAV DAKVLSKIPR  
Sbjct  247  GCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKNQYAVLDAKVLSKIPRWT  306

Query  873  LKDKK  887
             K+KK
Sbjct  307  SKNKK  311



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 199/247 (81%), Gaps = 2/247 (1%)
 Frame = +3

Query  153  EEESLVEKIADKIHR--HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGG  326
            E ESL++KI++K+H     SSS  D +K++++  ++ SSM +KV RLFGR++PVHKVLGG
Sbjct  22   ERESLMDKISEKLHHGGDSSSSDEDDDKKKKKSSESPSSMKSKVYRLFGREKPVHKVLGG  81

Query  327  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  506
            GK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  82   GKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  141

Query  507  IKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  686
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW++SI
Sbjct  142  INKSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLTAIAGLWVMSI  201

Query  687  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  866
            +G   +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  202  LGGWFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPL  261

Query  867  GPLKDKK  887
            GPLK+KK
Sbjct  262  GPLKNKK  268



>ref|XP_002441411.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
 gb|EES19841.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
Length=255

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 202/253 (80%), Gaps = 1/253 (0%)
 Frame = +3

Query  132  MAEEDRKEEE-SLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            MAE+ R+E   S+++KI+DK+H   S SSS S   ++E    T+++ AK+ RLFGR++PV
Sbjct  1    MAEQHREESGGSVLDKISDKLHGRGSGSSSSSSDSDDEHSSATAAVKAKIYRLFGREKPV  60

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H VLGGGK AD+FLWRNK+IS GVL GATAIW+LFEV++YHLLT +CH LIL LA+LFLW
Sbjct  61   HSVLGGGKPADLFLWRNKRISGGVLAGATAIWLLFEVMDYHLLTLLCHCLILTLAILFLW  120

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA++FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+VI G
Sbjct  121  SNATTFINKSPPNIPEVKIPEDLAVNVARSLRYEINRGFATLREIGQGHDLKKFLIVIAG  180

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LWI+S++GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM ELKK YA+FD K 
Sbjct  181  LWILSVLGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKKYYAIFDEKC  240

Query  849  LSKIPRGPLKDKK  887
            LSKIP+GPLKDKK
Sbjct  241  LSKIPKGPLKDKK  253



>gb|ACN40158.1| unknown [Picea sitchensis]
Length=259

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 184/254 (72%), Gaps = 3/254 (1%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttss---MDAKVRRLFGRQQPV  308
            EE     +S++EK+A+K+  HDSSSS   +++ ++ +        + + V+RLFGR++PV
Sbjct  6    EEAASFLDSVMEKVAEKLPGHDSSSSDSDDEKSKKPESKKPEPSSISSSVKRLFGREKPV  65

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H + GGGK ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT +CH LIL + +LF+W
Sbjct  66   HTLFGGGKSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVW  125

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNAS+FI K    IP++   E+     ASALR ++N    V+ ++ASGRDLK FLMV+ G
Sbjct  126  SNASAFINKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHNVASGRDLKKFLMVVAG  185

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LWI+S++GS  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KAM E KK Y  FDAKV
Sbjct  186  LWILSVIGSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKV  245

Query  849  LSKIPRGPLKDKKL  890
            LSKIPRGPLKDKK 
Sbjct  246  LSKIPRGPLKDKKF  259



>ref|XP_008377768.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 194/258 (75%), Gaps = 5/258 (2%)
 Frame = +3

Query  132  MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkt---tssMDAKVRRLFGR  296
            MAE  +  K  ES +++I+DKIH HDSSS+  S     +K      ++S+ +KV RLFGR
Sbjct  1    MAERTDGVKAAESSMDRISDKIHGHDSSSAVPSSGAVHDKGIGGGHSTSLKSKVNRLFGR  60

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVH V GGGK ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT V H LIL +A 
Sbjct  61   EKPVHHVFGGGKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIAS  120

Query  477  LFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLM  656
            LFLWSNAS+FI KS PHIP+V IPE+ VLQ AS +  ++N    +LR+IASG+DLK FL 
Sbjct  121  LFLWSNASTFINKSPPHIPQVQIPEKLVLQIASVITLEINRAFVILREIASGKDLKQFLS  180

Query  657  VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVF  836
            VI GLW++SI+G   +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVF
Sbjct  181  VIAGLWVVSILGKWYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKALIEIKKQYAVF  240

Query  837  DAKVLSKIPRGPLKDKKL  890
            DAKV+SKIPRG LKDKK 
Sbjct  241  DAKVMSKIPRGQLKDKKF  258



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 170/258 (66%), Positives = 199/258 (77%), Gaps = 11/258 (4%)
 Frame = +3

Query  132  MAEEDRKE-------EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLF  290
            MAEE           +ESL++KI++K+H HDSSSSSDS+ E+         +  KV RLF
Sbjct  1    MAEEPESTVTTAAAADESLLDKISEKLHGHDSSSSSDSDSEKTVTSS----VKDKVFRLF  56

Query  291  GRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  470
            GR++PVH VLG GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYH LT VCH LIL L
Sbjct  57   GRERPVHSVLGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHFLTLVCHILILLL  116

Query  471  AVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMF  650
            AVLFLWSNA +FI KS P IP+VH+PEEP+LQ AS LR ++N   AVL  I SGRDLK F
Sbjct  117  AVLFLWSNAHTFIHKSPPRIPDVHLPEEPILQVASVLRIEINRGFAVLHSIGSGRDLKKF  176

Query  651  LMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYA  830
            LMVI G+WI+SIVG+ C+FLTLFYI  +LLHT PVLYEKYED++D  AEKA+ E+KKQYA
Sbjct  177  LMVIAGVWILSIVGNWCNFLTLFYITFILLHTTPVLYEKYEDKIDPLAEKAVIEIKKQYA  236

Query  831  VFDAKVLSKIPRGPLKDK  884
            VFDAKVLSKIP G LK K
Sbjct  237  VFDAKVLSKIPVGLLKAK  254



>ref|XP_010436110.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 202/254 (80%), Gaps = 5/254 (2%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
             +FI K+ PH+PEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW 
Sbjct  123  CTFIHKATPHLPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWA  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  845
            +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSIIGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSK  242

Query  846  VLSKIPRGPLKDKK  887
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>ref|XP_009334492.1| PREDICTED: reticulon-like protein B2 [Pyrus x bretschneideri]
Length=258

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 194/258 (75%), Gaps = 5/258 (2%)
 Frame = +3

Query  132  MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkt---tssMDAKVRRLFGR  296
            MAE  +  K  ESL+++I+DKIH HDSSS   S     +K      ++S+ +KV RLFGR
Sbjct  1    MAERTDGVKAAESLMDRISDKIHGHDSSSVVPSSGVVHDKGIGGGHSTSLKSKVNRLFGR  60

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVH V GGGK ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT V H LIL +A 
Sbjct  61   EKPVHHVFGGGKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIAS  120

Query  477  LFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLM  656
            LFLWSNAS+FI KS PHIP+V IPE+PVLQ AS +  ++N    +LR+IASG+DLK FL 
Sbjct  121  LFLWSNASTFINKSPPHIPQVQIPEKPVLQIASVITMEINRAFVILREIASGKDLKQFLS  180

Query  657  VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVF  836
            VI GLW++SI+G   +FLTL YI VVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVF
Sbjct  181  VIAGLWVVSILGKWYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAVAEKALIEIKKQYAVF  240

Query  837  DAKVLSKIPRGPLKDKKL  890
            DAKV+SKIPRG LKDKK 
Sbjct  241  DAKVMSKIPRGQLKDKKF  258



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 193/248 (78%), Gaps = 3/248 (1%)
 Frame = +3

Query  150  KEEESLVEKIADKIHRHdsssssdseke--eeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            ++E SL+EK+ DKIH  D  SSS S  +   E+ +K T S+ AKV R+FGR++PVH VLG
Sbjct  13   EDEPSLLEKMGDKIHGGDHHSSSSSSSDSDNEKSEKKTESVKAKVFRIFGRERPVHHVLG  72

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  503
            GGK ADVFLWRNKK+S GVL GAT IW+LFE+L+YHLLT V H LI ALA+LFLWSNA +
Sbjct  73   GGKXADVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTLVGHILIGALAILFLWSNAHA  132

Query  504  FIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIIS  683
            FI K+ P IPEV +PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW++S
Sbjct  133  FIHKTPPRIPEVRLPEEPFLQVASELRVQINCAFALLHDIASGRDLKKFLAVIAGLWVLS  192

Query  684  IVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  863
            +VG  C+FLTLFYI  V+LHTVPV+YEKYED++D  AE+A  E KKQYA FDAKVLSKIP
Sbjct  193  VVGKWCNFLTLFYICFVVLHTVPVIYEKYEDKIDPLAERATIEFKKQYAXFDAKVLSKIP  252

Query  864  RGPLKDKK  887
             G LK+K+
Sbjct  253  HG-LKNKR  259



>ref|XP_010441324.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 201/254 (79%), Gaps = 5/254 (2%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE++EY  LT +CH  + ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYRFLTFLCHFAMAALAALFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
             +FI KS P IPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW+
Sbjct  123  CTFIHKSTPRIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWV  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  845
            +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSIIGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDDKVFSK  242

Query  846  VLSKIPRGPLKDKK  887
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 190/255 (75%), Gaps = 10/255 (4%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KI          S   + + +K  SS+  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKI-----HGHDGSSSSDSDDEKKASSIKTKIFRLFGREKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +A++FI K  PHIPEVHIPEE VLQ AS LR ++N    +LR+IA GRDLK FLMV+ GL
Sbjct  115  SATTFIHKKPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQYAV D    
Sbjct  175  WVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVL  234

Query  840  AKVLSKIPRGPLKDK  884
            +KV+SKIPRG    K
Sbjct  235  SKVMSKIPRGAFNKK  249



>ref|XP_006284372.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
 gb|EOA17270.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
Length=257

 Score =   268 bits (684),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 166/254 (65%), Positives = 203/254 (80%), Gaps = 5/254 (2%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            ED K EES++EKI +KIH + DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGNGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
             +FI K+ PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLWI
Sbjct  123  CTFIHKATPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWI  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  845
            +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSILGSCCNFLTLFYIATVLLFTIPVIYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSK  242

Query  846  VLSKIPRGPLKDKK  887
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 195/256 (76%), Gaps = 4/256 (2%)
 Frame = +3

Query  132  MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAK--VRRLFGRQ  299
            MAE  ED K E  L+EK+ +KIH H  SSSS S   + EK K  +    K  V RLFGR+
Sbjct  1    MAEHGEDAKAEHGLMEKMTEKIHDHHDSSSSSSSDSDTEKPKPAAEESPKEKVFRLFGRE  60

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVH VLGGGK ADVFLWRNKKIS GVLGGAT +++LFE++EYHLLT +CH LI ALAV+
Sbjct  61   RPVHHVLGGGKPADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICHILIGALAVM  120

Query  480  FLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMV  659
            FLWSNA +   K+APHIPEV +PEEP LQ AS LR  +N   A+L +IASGR+LK FL+V
Sbjct  121  FLWSNAHTIFHKTAPHIPEVSLPEEPFLQVASELRLQINWAFALLHNIASGRELKKFLIV  180

Query  660  ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD  839
            I GLW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYE +VD  AEKA  E+KKQY VFD
Sbjct  181  IAGLWVLSIVGSWCNFLTLFYITFVLLHTVPVLYEKYEHKVDPLAEKATIEMKKQYGVFD  240

Query  840  AKVLSKIPRGPLKDKK  887
            AKV++K+    LK+K+
Sbjct  241  AKVVTKVRETVLKNKR  256



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 167/257 (65%), Positives = 199/257 (77%), Gaps = 8/257 (3%)
 Frame = +3

Query  132  MAEEDRK------EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  293
            MAEE          +ESL++KI +K+H HDSSSSS S+ + E+   ++  +  +V RLFG
Sbjct  1    MAEEPESTVTTGAPDESLLDKITEKLHGHDSSSSSSSDSDSEKTVTSS--VKDRVFRLFG  58

Query  294  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  473
            R++PVH V G GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL LA
Sbjct  59   RERPVHSVFGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHILILLLA  118

Query  474  VLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFL  653
            VLFLWSNA +FI KS P IPEVH+PEEP  Q ASALR ++N   A+L  I SGRDLK FL
Sbjct  119  VLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSGRDLKKFL  178

Query  654  MVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAV  833
            ++I G+WI+SIVG+ C+FLTLFYI  VL HTVPVLYEKYED++D  AEKA+ E+KKQY V
Sbjct  179  VIIAGVWILSIVGNWCNFLTLFYITFVLSHTVPVLYEKYEDKIDPLAEKAVIEIKKQYVV  238

Query  834  FDAKVLSKIPRGPLKDK  884
            FDAKVLSKIP GPLK K
Sbjct  239  FDAKVLSKIPLGPLKAK  255



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 153/251 (61%), Positives = 195/251 (78%), Gaps = 4/251 (2%)
 Frame = +3

Query  144  DRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            + KEE   ES+++KI+DK H     SSS S   ++EKK + + + AK+ RLFGR++PVH 
Sbjct  3    EHKEEPVAESMMDKISDKFHG-GGDSSSSSSDSDDEKKGSAAGVKAKIYRLFGREKPVHA  61

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT V H LIL+LA LFL+SN
Sbjct  62   VLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVGHCLILSLATLFLYSN  121

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
               F+ KS P+IPEV IPE+  +  A +LR+++N     LR+I  GRDLK FL+VI GLW
Sbjct  122  VCIFVHKSPPNIPEVKIPEDMTVNIALSLRHEINRGFFTLREIGHGRDLKKFLIVIGGLW  181

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  854
            ++S++GSCC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKAM ELKK YA+F+ KVLS
Sbjct  182  VLSVLGSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKVLS  241

Query  855  KIPRGPLKDKK  887
            KIP+G LK+KK
Sbjct  242  KIPKGALKNKK  252



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 168/234 (72%), Gaps = 32/234 (14%)
 Frame = +3

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI
Sbjct  3    RLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALI  62

Query  462  LALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDL  641
             +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N   A LR IA GRD+
Sbjct  63   FSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDI  122

Query  642  KMFLMVITGLWIISIVGSCCDFLTLFYIA-------------------------------  728
            K FL+VI GLW++SI+GSCC+FLTLFYI                                
Sbjct  123  KKFLIVIAGLWLLSILGSCCNFLTLFYIGEGSQLSIPFLAPLLPNVDLVFTVDLSLLCQT  182

Query  729  -VVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  887
              V+LHTVPV+YEKYED++D + EK   E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  183  VFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPLKDKK  236



>ref|XP_010105716.1| Reticulon-like protein [Morus notabilis]
 gb|EXC05936.1| Reticulon-like protein [Morus notabilis]
Length=264

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 196/236 (83%), Gaps = 3/236 (1%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  320
            E   E ESL+EKIADKIH HDSSSSSDS+ ++  K +    + AK+ RLFGR++P+HKVL
Sbjct  3    EHAGEPESLIEKIADKIHGHDSSSSSDSDDDKPSKVEE---VQAKIFRLFGREKPIHKVL  59

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  500
            GGGK ADVFLWRNKK+S GVLGGAT +W+LFE+LEYHL+T VCH LIL+LA+LFLWSNAS
Sbjct  60   GGGKPADVFLWRNKKLSAGVLGGATILWVLFELLEYHLITLVCHILILSLALLFLWSNAS  119

Query  501  SFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWII  680
            + I KS P IPEV IPE+ VL+ AS LR +VN+ LAVLR+IASG++LK FL +I GLW++
Sbjct  120  TLINKSPPQIPEVRIPEKIVLEVASVLRAEVNYALAVLRNIASGKELKKFLGIIAGLWVL  179

Query  681  SIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            S+VG+ C+FLTLFYIA V+LHTVPVLYEKYED+VDA +E+A  E+KKQY VFD+K 
Sbjct  180  SVVGNWCNFLTLFYIAFVVLHTVPVLYEKYEDQVDALSERATIEIKKQYVVFDSKT  235



>ref|XP_011037168.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
Length=252

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 206/253 (81%), Gaps = 1/253 (0%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE+     ES++ KI++KIH H+SSSSSDSE + E+K   + S+  K+ RLFGR++PVH
Sbjct  1    MAEQSENPIESIMGKISEKIH-HESSSSSDSESDSEKKSYPSESVKDKIWRLFGREKPVH  59

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+LFLWS
Sbjct  60   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALLFLWS  119

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA +FI KS P IP+VH+PEEPVLQ ASAL  ++N     LR IA+G+DLK FL+VI GL
Sbjct  120  NAHAFIYKSPPRIPQVHLPEEPVLQVASALCVEINGAYVFLRSIAAGKDLKKFLIVIAGL  179

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVL
Sbjct  180  WVMSIVGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVL  239

Query  852  SKIPRGPLKDKKL  890
            SKIP   LK KK+
Sbjct  240  SKIPVAALKAKKV  252



>ref|XP_002301382.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
 gb|EEE80655.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
Length=251

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 161/253 (64%), Positives = 194/253 (77%), Gaps = 2/253 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE+     ES++EKI +K+H     SSS   + + +K     S+ AK+ RLFGR++PVH
Sbjct  1    MAEQSESPTESVMEKIIEKVHH--HESSSSDSELDSDKPDPLESVKAKIWRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             VLGGGK ADVFLWRNKK+S GVLG  TA+W+LFE++EYHLLT VCH LILA A+LFLWS
Sbjct  59   HVLGGGKPADVFLWRNKKVSAGVLGFVTAMWVLFELIEYHLLTLVCHILILAAALLFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA + I KS P IPEVH+PE+ VLQ ASAL  ++N   A LR +A+G+D K FLM+I GL
Sbjct  119  NACTLINKSPPRIPEVHLPEKLVLQVASALCVEINSAFAGLRSVAAGKDFKKFLMIIAGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVGS C FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAM E+KKQYAVFDAKVL
Sbjct  179  WVLSIVGSSCHFLTLFYICFVLLHTVPVLYEKYEDKVDPLAEKAMVEIKKQYAVFDAKVL  238

Query  852  SKIPRGPLKDKKL  890
            SKIP   LK K++
Sbjct  239  SKIPVASLKAKRV  251



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 169/208 (81%), Gaps = 1/208 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            +  KV R+FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +WILFE+LEY+LLT 
Sbjct  48   VKTKVFRIFGREKPVHHVLGGGKTADVFLWRNKKVSGGVLGGATVVWILFELLEYNLLTL  107

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
            V H LI  LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L +I
Sbjct  108  VAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHNI  167

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASG+DLK FL VI GLW++S+VG  C+FLTLFYI+ VLLHTVPV+YEKYED++D  AEK 
Sbjct  168  ASGKDLKKFLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPLAEKV  227

Query  804  MHELKKQYAVFDAKVLSKIPRGPLKDKK  887
              E KKQYAVFDAKVL+KIPRG LK+K+
Sbjct  228  TIEFKKQYAVFDAKVLNKIPRG-LKNKR  254



>ref|NP_001185307.1| reticulon-like protein B3 [Arabidopsis thaliana]
 gb|AEE34191.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=271

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 196/266 (74%), Gaps = 24/266 (9%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKI++KIH HD SSSS S+ ++++   +   +  K+ RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSAS---LKTKIYRLFGREQPLH  56

Query  312  KVLGGGKQ----------------ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            K+ GGGK                 AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  57   KLFGGGKHSENQDINERFGLVFAAADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  116

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
              H  ILALAVLFLWS+AS+FI KS  HIPEVHIPE+ VLQ AS LR ++N    VLRDI
Sbjct  117  FGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDI  176

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKA
Sbjct  177  ASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKA  236

Query  804  MHELKKQYAVFD----AKVLSKIPRG  869
            M E+KKQY  FD    +KV+SKIP+G
Sbjct  237  MREIKKQYVEFDVKVLSKVMSKIPKG  262



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   265 bits (678),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 196/260 (75%), Gaps = 10/260 (4%)
 Frame = +3

Query  132  MAEEDR-----KEEESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRL  287
            MA+E       + E SL+EKI +KIH   RH SSSSS    +E+ +KK  S + AKV R+
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRI  59

Query  288  FGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILA  467
            FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  
Sbjct  60   FGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIAT  119

Query  468  LAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKM  647
            LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L  IASG+DLK 
Sbjct  120  LAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCSFALLHSIASGKDLKK  179

Query  648  FLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQY  827
            FL VI GLW++S+VG  C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK   E KKQY
Sbjct  180  FLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKVTIEFKKQY  239

Query  828  AVFDAKVLSKIPRGPLKDKK  887
             VFDAKVLSKIP G LK+K+
Sbjct  240  DVFDAKVLSKIPCG-LKNKR  258



>ref|XP_004961431.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=252

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 199/252 (79%), Gaps = 2/252 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE+ +  EES++EK++DK+H     SSS S   ++E+   T+++ AK+ RLFGR++PVH
Sbjct  1    MAEQHK--EESVLEKLSDKLHGRGGGSSSSSSDSDDERSSATTAVKAKIYRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
             VLGGGK AD+FLWRNK+IS GVL GATAIW+LFEV++YHLLT +CH LIL LA+LFLWS
Sbjct  59   SVLGGGKPADLFLWRNKRISGGVLAGATAIWLLFEVMDYHLLTLLCHCLILTLAILFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA++FI KS P+IPEV IPE+  +  A +LR ++N   A LR I  G DLK FL+V+ GL
Sbjct  119  NATTFINKSPPNIPEVKIPEDLAVNVARSLRYEINRGFATLRGIGQGHDLKKFLIVVAGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            WI+S++GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EK M ELKK YA+FD K L
Sbjct  179  WILSVLGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKTMVELKKYYAIFDEKCL  238

Query  852  SKIPRGPLKDKK  887
            SKIP+GP +DKK
Sbjct  239  SKIPKGPSRDKK  250



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 164/250 (66%), Positives = 201/250 (80%), Gaps = 5/250 (2%)
 Frame = +3

Query  153  EEESLVEKIADKIHR-----HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            E ESL++KI++KIH        SSSSSD EKE++EK  + SSM +KV RLFGR++PVHKV
Sbjct  23   ERESLMDKISEKIHHGGGDSSSSSSSSDDEKEKKEKPSSPSSMKSKVYRLFGREKPVHKV  82

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  83   LGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  142

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
            + FI KS P IPEVHIPEEPVLQ AS LR ++N     LR+IASGRDLK F+  I GLW+
Sbjct  143  TMFIHKSPPKIPEVHIPEEPVLQLASGLRIEINRGFYSLREIASGRDLKKFISAIAGLWV  202

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            +SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  203  LSILGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  262

Query  858  IPRGPLKDKK  887
            IP GPLK+KK
Sbjct  263  IPLGPLKNKK  272



>ref|XP_009112802.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=250

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 188/255 (74%), Gaps = 10/255 (4%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAEE  K EES++EKIA+KI          S   + + +K  SS+  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKI-----HGHDGSSSSDSDDEKKASSIKTKIFRLFGREKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLF W 
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFSWP  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            +A++FI K  PHIPEVHIPEE VLQ AS LR ++N    +LR+IA GRDLK FLMV+ GL
Sbjct  115  SATTFIHKKPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGL  174

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----  839
            W++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQYAV D    
Sbjct  175  WVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVL  234

Query  840  AKVLSKIPRGPLKDK  884
            +KV+SKIPRG    K
Sbjct  235  SKVMSKIPRGAFNKK  249



>ref|XP_006402470.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
 gb|ESQ43923.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
Length=253

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 187/249 (75%), Gaps = 3/249 (1%)
 Frame = +3

Query  138  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  317
            E+    EESL+EKIA+KI       SS S + E EK  + S++ AK+ RLFGR++PVHKV
Sbjct  6    EKSVPTEESLIEKIAEKI---HDHDSSSSSESEHEKPDSPSALKAKIYRLFGREKPVHKV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  497
            LGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI ALAVLFL SNA
Sbjct  63   LGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAVLFLLSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  677
             +F+KKS P IPE+HI EE  L  ASALRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  123  HAFMKKSPPKIPEIHIKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVFGLWI  182

Query  678  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  857
            IS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK + ELKK Y VFD KVLSK
Sbjct  183  ISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSK  242

Query  858  IPRGPLKDK  884
            IP   LK K
Sbjct  243  IPVASLKAK  251



>emb|CDX90792.1| BnaA03g24720D [Brassica napus]
Length=267

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGAT  W+LFE+LEYHLLT +CH 
Sbjct  62   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELLEYHLLTLLCHV  121

Query  456  LILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGR  635
            +I+ALAVLFLWSNA+ FI KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGR
Sbjct  122  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGR  181

Query  636  DLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHEL  815
            DLK FL  + GLWI+SI+G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM EL
Sbjct  182  DLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAEL  241

Query  816  KKQYAVFDAKVLSKIPRGPLKDKK  887
            KKQYAV DAKVLSKIPRGPLKDKK
Sbjct  242  KKQYAVLDAKVLSKIPRGPLKDKK  265



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 165/206 (80%), Gaps = 4/206 (2%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            +  K+ RLFGR+QP+HK+ GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  26   LKTKIYRLFGREQPLHKLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  85

Query  444  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDI  623
              H  ILALAVLFLWS+AS+FI KS  HIPEVHIPE+ VLQ AS LR ++N    VLRDI
Sbjct  86   FGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDI  145

Query  624  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  803
            ASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKA
Sbjct  146  ASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKA  205

Query  804  MHELKKQYAVFD----AKVLSKIPRG  869
            M E+KKQY  FD    +KV+SKIP+G
Sbjct  206  MREIKKQYVEFDVKVLSKVMSKIPKG  231



>gb|KFK33000.1| hypothetical protein AALP_AA6G316900 [Arabis alpina]
Length=258

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 200/254 (79%), Gaps = 6/254 (2%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAK--VRRLFGRQQPVHK  314
            ED K EESL+EKIA+KIH H  SSSS    ++++   ++SS   K  + RLFGR++PVHK
Sbjct  3    EDHKHEESLLEKIAEKIHGHGDSSSSHDSDDDKKSTSSSSSSSFKSKIYRLFGREKPVHK  62

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  494
            VLGGGK AD+FLWRNKK+S GV G  TA WI+FE++EYH LT +CH  ILALA LFLWSN
Sbjct  63   VLGGGKPADIFLWRNKKVSGGVFGAVTACWIVFELIEYHFLTFLCHFAILALAALFLWSN  122

Query  495  ASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  674
            A +FI K++PHIPEVHIPE+PVLQ AS LR + N  L VLR+IASG+D+K F++VI GLW
Sbjct  123  ACTFIHKASPHIPEVHIPEDPVLQLASGLRIETNRALTVLRNIASGKDIKKFILVIAGLW  182

Query  675  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL-  851
            I+SI+GSCC+FLTLFY A VLL T+PV+YEKYED++DA+ EKAM E+KKQYAV D KVL 
Sbjct  183  ILSIIGSCCNFLTLFYTATVLLFTIPVIYEKYEDKIDAYGEKAMKEIKKQYAVLDEKVLS  242

Query  852  ---SKIPRGPLKDK  884
               SKIPRG L  K
Sbjct  243  KIMSKIPRGSLNKK  256



>gb|ACG32549.1| seed maturation protein [Zea mays]
Length=254

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 153/253 (60%), Positives = 201/253 (79%), Gaps = 2/253 (1%)
 Frame = +3

Query  132  MAEEDRKEEE-SLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            MAE+ ++E   ++++KI+DK+H      SS S   ++E+   T+++ AK+ R+FGR++PV
Sbjct  1    MAEQHKEESGVTVLDKISDKLHG-RGGGSSSSSDSDDERSSATAAVKAKIYRIFGREKPV  59

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H VLGGGK AD+FLWRNK+IS GVL GATA W+LFEV++YHLLT +CH LIL LA+LFLW
Sbjct  60   HSVLGGGKPADLFLWRNKRISGGVLAGATAFWLLFEVMDYHLLTLLCHCLILTLAILFLW  119

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SNA++FI KS P+IPEV IP++  + FA +LR ++N   A LR+I  G DLK FL+VI G
Sbjct  120  SNATTFINKSPPNIPEVKIPDDLAVNFARSLRYEINRGFATLREIGQGHDLKKFLIVIAG  179

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LWI+S++GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM ELKK YA+FD K 
Sbjct  180  LWILSVLGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKKYYAIFDEKC  239

Query  849  LSKIPRGPLKDKK  887
            LSKIP+GPLKDKK
Sbjct  240  LSKIPKGPLKDKK  252



>ref|XP_007135152.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
 gb|ESW07146.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
Length=255

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = +3

Query  159  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++KIADK+H HDSSSSSDS+ E++E       +  KV RLFGR++PVH VLGGGK A
Sbjct  15   ESLLDKIADKLHGHDSSSSSDSDSEKKESSS----IKDKVFRLFGREKPVHSVLGGGKPA  70

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  518
            DV LWRNKKIS  VL  ATA+WI FE+LEYHLLT V H LIL LAVLFLWSNA +FI K+
Sbjct  71   DVLLWRNKKISASVLSVATAVWIFFELLEYHLLTLVGHILILLLAVLFLWSNAHTFIHKA  130

Query  519  AphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSC  698
             P IP VH+PEEP LQFASAL  ++N   A L  I SGRDLK FL+VI G WI+SIVGS 
Sbjct  131  PPRIPVVHLPEEPFLQFASALTIEINRGFAALHAIGSGRDLKTFLVVIVGTWILSIVGSW  190

Query  699  CDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  878
             +F+TLFYI  VLLHTVPVLY+KYED++D  AEKA+ E KKQYAVFD KVLSKIP+GPLK
Sbjct  191  VNFMTLFYIVFVLLHTVPVLYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLSKIPKGPLK  250

Query  879  DKKLA  893
             KKLA
Sbjct  251  YKKLA  255



>gb|KHN29299.1| Reticulon-like protein B5 [Glycine soja]
Length=250

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            +V RLFGR++PVH V G GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH
Sbjct  45   RVFRLFGRERPVHSVFGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCH  104

Query  453  GLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASG  632
             LIL LAVLFLWSNA +FI KS P IPEVH+PEEP  Q ASALR ++N   A+L  I SG
Sbjct  105  ILILLLAVLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSG  164

Query  633  RDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHE  812
            RDLK FL++I G+WI+SIVG+ C+FLTLFYI  VLLHTVPVLYEKYED++D  AEKA+ E
Sbjct  165  RDLKKFLVIIAGVWILSIVGNWCNFLTLFYITFVLLHTVPVLYEKYEDKIDPLAEKAVIE  224

Query  813  LKKQYAVFDAKVLSKIPRGPLKDK  884
            +KKQY VFDAKVLSKIP GPLK K
Sbjct  225  IKKQYVVFDAKVLSKIPLGPLKAK  248



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 195/253 (77%), Gaps = 8/253 (3%)
 Frame = +3

Query  153  EEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            E ESL++KI++KIH           S    D   +++EK  + SSM +KV RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEDDKNDKKKEKPSSPSSMKSKVYRLFGREKPV  81

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  489  SNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITG  668
            SN + FI KS P IP+VHIPEEPVLQ AS LR ++N   + LR+IASGRDLK F+  I G
Sbjct  142  SNVTRFIHKSPPKIPQVHIPEEPVLQLASGLRIEINRGFSSLREIASGRDLKKFISAIAG  201

Query  669  LWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKV  848
            LW++SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KV
Sbjct  202  LWVLSILGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKV  261

Query  849  LSKIPRGPLKDKK  887
            LSKIP GPLK+KK
Sbjct  262  LSKIPLGPLKNKK  274



>ref|XP_010671578.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 163/281 (58%), Positives = 191/281 (68%), Gaps = 30/281 (11%)
 Frame = +3

Query  141  EDRKEEESLVEKIADKIHRH------------------------------dsssssdsek  230
            E+  E  SL+EKI+DKIH H                                     + +
Sbjct  6    EEHHESSSLMEKISDKIHGHDSSSSSSDEESDKKKSSSSETPSVPAAAHVPPPEVVPATE  65

Query  231  eeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWIL  410
            + E     +SS  +K+ RLFGRQ+PVHKVLGGGK ADV LWRNKKIS   LG AT IW L
Sbjct  66   KAEAPASPSSSTSSKIYRLFGRQKPVHKVLGGGKPADVLLWRNKKISASALGVATVIWFL  125

Query  411  FEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepvLQFASALRND  590
            FE+LEYHLLT +CH LI  LAVLFLWSNAS+FI K+ P IP+VHIP+  +L+F S LR +
Sbjct  126  FELLEYHLLTLLCHILIFTLAVLFLWSNASAFIHKAPPRIPDVHIPDNALLEFISVLRFE  185

Query  591  VNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKY  770
            +N  L+VLRDIASG++LK F  VI GLW++S+VGS  +FLTL Y+  VLLHTVPVLYEKY
Sbjct  186  INRALSVLRDIASGKELKKFFGVIAGLWVVSVVGSWFNFLTLVYLLFVLLHTVPVLYEKY  245

Query  771  EDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  893
            ED VDAFAEKA  ELKKQYAV D K LSKIPRGPLKDKK A
Sbjct  246  EDHVDAFAEKAAIELKKQYAVADEKFLSKIPRGPLKDKKSA  286



>gb|AFK42059.1| unknown [Lotus japonicus]
Length=258

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 191/262 (73%), Gaps = 17/262 (6%)
 Frame = +3

Query  132  MAEEDRKEE-------ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLF  290
            MAEE  +         ESL++KI+DK+         DS  + + +K + SS+  K+ RLF
Sbjct  1    MAEESAESTVTAAATGESLLDKISDKL------HDHDSSSDSDSEKPSLSSVKQKIFRLF  54

Query  291  GRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  470
            GR++P+H VLGGGK ADV LW+NKK+S G LG ATA+W+ FE+LEYHLLT VCH LIL++
Sbjct  55   GREKPLHSVLGGGKPADVLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSI  114

Query  471  AVLFLWSNASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMF  650
             +LFLWSNA + + K+ P IP  H+PEEP L+ ASALR ++NH  A LRDI +G+D+K F
Sbjct  115  TLLFLWSNAHTLLHKAPPRIPVFHLPEEPFLEIASALRIEINHGFAALRDIGTGKDVKKF  174

Query  651  LMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYA  830
            L+ I GLWI+SIVGS C+FLTLFYI  VLL T+P LY+KYED++D  AEKA HE+KKQY 
Sbjct  175  LIAIVGLWILSIVGSWCNFLTLFYINFVLLLTIPFLYDKYEDKIDPLAEKAAHEIKKQYV  234

Query  831  VFDA----KVLSKIPRGPLKDK  884
            VFDA    KVLSKIP+G LK K
Sbjct  235  VFDAKVLSKVLSKIPKGLLKGK  256



>ref|XP_007040376.1| Reticulan like protein B3, putative isoform 1 [Theobroma cacao]
 gb|EOY24877.1| Reticulan like protein B3, putative isoform 1 [Theobroma cacao]
Length=269

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 202/240 (84%), Gaps = 2/240 (1%)
 Frame = +3

Query  132  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MAE + K EE+L+EKI +KIH HDSSSSS S+ E+ +  ++   + + V RLFGR++PVH
Sbjct  1    MAEHEEKHEETLMEKITEKIHGHDSSSSSSSDDEDNKPSESP--IKSNVFRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  491
            +VLGGGK AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT VCH LILALA+LFLWS
Sbjct  59   QVLGGGKPADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTLVCHLLILALAILFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  671
            NA++FI KS P IPEV IP+EPVL+FA ALR ++N   AVLRDIASGRDLK FL VI GL
Sbjct  119  NATTFINKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGL  178

Query  672  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  851
            W++SIVGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKAMHE+KKQYAVFDAKVL
Sbjct  179  WVLSIVGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKAMHEIKKQYAVFDAKVL  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3138588462517