BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2142

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAV88066.1|  NBS-LRR protein                                       63.9    2e-18   Ipomoea batatas [batate]
gb|AAV88068.1|  NBS-LRR protein                                       72.8    5e-18   Ipomoea batatas [batate]
gb|AAV88067.1|  NBS-LRR protein                                       65.5    1e-16   Ipomoea batatas [batate]
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...  77.0    2e-14   Nicotiana tomentosiformis
ref|XP_009624584.1|  PREDICTED: putative late blight resistance p...  70.5    2e-13   Nicotiana tomentosiformis
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...  65.1    3e-13   Sesamum indicum [beniseed]
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...  70.1    3e-13   
ref|XP_009624582.1|  PREDICTED: putative late blight resistance p...  69.7    3e-13   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...  64.7    2e-12   Nicotiana sylvestris
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...  69.3    2e-12   
ref|XP_011073066.1|  PREDICTED: putative late blight resistance p...  69.7    3e-12   Sesamum indicum [beniseed]
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...  62.4    3e-12   
ref|XP_009763644.1|  PREDICTED: putative late blight resistance p...  75.1    3e-12   Nicotiana sylvestris
gb|AAV88065.1|  leucine-rich repeat protein                           75.5    4e-12   Ipomoea batatas [batate]
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...  76.3    4e-12   Nicotiana sylvestris
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...  75.1    8e-12   Nicotiana sylvestris
ref|XP_009603167.1|  PREDICTED: putative late blight resistance p...  66.6    8e-12   
dbj|BAD18094.1|  NBS-LRR protein                                      72.8    8e-12   Ipomoea batatas [batate]
ref|XP_009603166.1|  PREDICTED: putative late blight resistance p...  67.0    8e-12   Nicotiana tomentosiformis
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...  64.7    1e-11   Nicotiana sylvestris
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...  55.5    1e-11   Nicotiana sylvestris
ref|XP_009615718.1|  PREDICTED: putative late blight resistance p...  73.9    1e-11   Nicotiana tomentosiformis
ref|XP_011090484.1|  PREDICTED: putative late blight resistance p...  74.3    1e-11   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501  58.9    2e-11   
gb|ACE79493.1|  NBS-coding resistance gene analog                     71.2    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_009773240.1|  PREDICTED: putative late blight resistance p...  73.6    2e-11   Nicotiana sylvestris
gb|ACE79495.1|  NBS-coding resistance gene analog                     71.2    2e-11   Nicotiana sylvestris
gb|ACE79489.1|  NBS-coding resistance gene analog                     71.2    2e-11   Nicotiana tabacum [American tobacco]
gb|ACE79487.1|  NBS-coding resistance gene analog                     71.2    2e-11   Nicotiana tabacum [American tobacco]
gb|ACE79491.1|  NBS-coding resistance gene analog                     71.2    2e-11   Nicotiana tabacum [American tobacco]
gb|ACE79492.1|  NBS-coding resistance gene analog                     71.2    3e-11   Nicotiana tabacum [American tobacco]
gb|ACE79488.1|  NBS-coding resistance gene analog                     71.2    3e-11   Nicotiana tabacum [American tobacco]
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...  73.2    3e-11   Nicotiana tomentosiformis
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...  73.2    3e-11   Nicotiana sylvestris
gb|ACE79490.1|  NBS-coding resistance gene analog                     71.2    3e-11   Nicotiana tabacum [American tobacco]
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...  63.2    5e-11   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...  72.4    6e-11   Nicotiana tomentosiformis
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...  72.4    6e-11   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...  72.4    7e-11   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...  72.4    7e-11   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...  72.4    7e-11   Nicotiana tomentosiformis
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...  72.4    7e-11   Nicotiana tomentosiformis
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...  72.0    7e-11   Nicotiana tomentosiformis
ref|XP_009760414.1|  PREDICTED: disease susceptibility protein LO...  67.8    7e-11   Nicotiana sylvestris
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg              57.8    7e-11   Erythranthe guttata [common monkey flower]
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...  72.0    8e-11   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...  72.0    8e-11   Nicotiana tomentosiformis
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...  72.0    8e-11   Nicotiana tomentosiformis
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...  71.6    9e-11   Nicotiana tomentosiformis
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...  71.6    1e-10   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...  71.6    1e-10   Nicotiana tomentosiformis
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...  71.6    1e-10   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...  71.6    1e-10   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...  71.6    1e-10   Nicotiana tomentosiformis
ref|XP_009612031.1|  PREDICTED: putative late blight resistance p...  59.3    1e-10   Nicotiana tomentosiformis
ref|XP_011072557.1|  PREDICTED: putative late blight resistance p...  62.4    2e-10   Sesamum indicum [beniseed]
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...  68.6    2e-10   Nicotiana sylvestris
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...  62.8    2e-10   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  70.9    2e-10   Nicotiana sylvestris
ref|XP_009769811.1|  PREDICTED: putative late blight resistance p...  67.0    2e-10   Nicotiana sylvestris
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  70.5    2e-10   
ref|XP_009777085.1|  PREDICTED: putative late blight resistance p...  70.1    2e-10   Nicotiana sylvestris
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  70.5    3e-10   Nicotiana sylvestris
gb|ACF22006.1|  NBS-coding resistance gene protein                    67.0    3e-10   Nicotiana tabacum [American tobacco]
gb|ACE79413.1|  NBS-coding resistance gene analog                     68.6    3e-10   Nicotiana tabacum [American tobacco]
ref|XP_009606269.1|  PREDICTED: putative late blight resistance p...  68.9    4e-10   
gb|ACE79400.1|  NBS-coding resistance gene analog                     67.8    5e-10   Nicotiana tabacum [American tobacco]
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...  59.7    5e-10   
ref|XP_009592156.1|  PREDICTED: late blight resistance protein R1...  69.3    5e-10   
gb|ACE79448.1|  NBS-coding resistance gene analog                     67.8    5e-10   Nicotiana tabacum [American tobacco]
ref|XP_009780985.1|  PREDICTED: putative late blight resistance p...  69.3    6e-10   Nicotiana sylvestris
gb|ACE79429.1|  NBS-coding resistance gene analog                     67.8    6e-10   Nicotiana tabacum [American tobacco]
gb|ACE79449.1|  NBS-coding resistance gene analog                     67.8    6e-10   Nicotiana tabacum [American tobacco]
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  69.3    6e-10   Solanum tuberosum [potatoes]
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...  69.3    7e-10   Nicotiana sylvestris
ref|XP_009786584.1|  PREDICTED: disease resistance RPP13-like pro...  66.6    7e-10   Nicotiana sylvestris
ref|XP_010040374.1|  PREDICTED: putative disease resistance RPP13...  61.2    8e-10   Eucalyptus grandis [rose gum]
ref|XP_009794810.1|  PREDICTED: putative late blight resistance p...  65.5    8e-10   Nicotiana sylvestris
ref|XP_011101277.1|  PREDICTED: putative late blight resistance p...  68.9    9e-10   
ref|XP_010659191.1|  PREDICTED: putative disease resistance RPP13...  63.9    1e-09   
emb|CAN67336.1|  hypothetical protein VITISV_004414                   63.9    1e-09   Vitis vinifera
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...  65.1    1e-09   Nicotiana sylvestris
gb|ACF22012.1|  NBS-coding resistance gene protein                    67.0    1e-09   Nicotiana tabacum [American tobacco]
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...  61.6    1e-09   Sesamum indicum [beniseed]
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...  68.6    1e-09   Nicotiana tomentosiformis
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  68.6    1e-09   Nicotiana tomentosiformis
ref|XP_009769771.1|  PREDICTED: late blight resistance protein R1...  68.2    1e-09   Nicotiana sylvestris
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  68.2    1e-09   Nicotiana tomentosiformis
ref|XP_009609961.1|  PREDICTED: putative disease resistance RPP13...  67.0    1e-09   Nicotiana tomentosiformis
dbj|BAD26260.1|  putative disease related protein 2                   68.2    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08369.1|  hypothetical protein OsI_30626                        68.2    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009614998.1|  PREDICTED: putative late blight resistance p...  68.2    2e-09   Nicotiana tomentosiformis
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  68.2    2e-09   Nicotiana tomentosiformis
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  67.8    2e-09   Sesamum indicum [beniseed]
ref|XP_009614999.1|  PREDICTED: putative late blight resistance p...  67.8    2e-09   Nicotiana tomentosiformis
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...  67.8    2e-09   Nicotiana sylvestris
gb|AAF09256.1|AF202179_1  disease resistance protein BS2              67.8    2e-09   Capsicum chacoense
ref|XP_009780986.1|  PREDICTED: late blight resistance protein R1...  67.8    2e-09   Nicotiana sylvestris
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...  67.4    2e-09   
ref|XP_009761661.1|  PREDICTED: late blight resistance protein R1...  67.0    3e-09   Nicotiana sylvestris
ref|XP_009598609.1|  PREDICTED: putative late blight resistance p...  67.0    3e-09   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...  67.0    3e-09   Nicotiana tomentosiformis
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...  67.0    3e-09   Nicotiana sylvestris
gb|ACE79399.1|  NBS-coding resistance gene analog                     65.5    3e-09   Nicotiana tabacum [American tobacco]
emb|CDP05557.1|  unnamed protein product                              66.6    3e-09   Coffea canephora [robusta coffee]
gb|ACE79434.1|  NBS-coding resistance gene analog                     65.5    3e-09   Nicotiana tabacum [American tobacco]
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...  60.8    4e-09   Nicotiana sylvestris
ref|XP_006352021.1|  PREDICTED: putative late blight resistance p...  67.0    4e-09   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...  62.4    4e-09   Nicotiana tomentosiformis
ref|XP_009608888.1|  PREDICTED: putative late blight resistance p...  66.6    4e-09   Nicotiana tomentosiformis
gb|ACE79422.1|  NBS-coding resistance gene analog                     65.5    4e-09   Nicotiana tabacum [American tobacco]
ref|XP_009590018.1|  PREDICTED: putative late blight resistance p...  66.6    4e-09   
ref|XP_006362539.1|  PREDICTED: putative late blight resistance p...  66.6    5e-09   Solanum tuberosum [potatoes]
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  66.6    5e-09   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...  66.6    5e-09   Solanum tuberosum [potatoes]
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  66.6    5e-09   
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  66.6    5e-09   
gb|ACE79438.1|  NBS-coding resistance gene analog                     65.1    5e-09   Nicotiana tabacum [American tobacco]
gb|KJB49315.1|  hypothetical protein B456_008G112600                  66.6    6e-09   Gossypium raimondii
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...  66.2    6e-09   Nicotiana sylvestris
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...  66.2    6e-09   Nicotiana sylvestris
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...  66.2    6e-09   
emb|CDP19195.1|  unnamed protein product                              66.2    6e-09   Coffea canephora [robusta coffee]
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...  66.2    6e-09   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...  66.2    7e-09   
ref|XP_009608040.1|  PREDICTED: putative late blight resistance p...  66.2    7e-09   
ref|XP_008777037.1|  PREDICTED: putative disease resistance prote...  60.1    7e-09   
ref|XP_008350664.1|  PREDICTED: putative disease resistance prote...  65.9    7e-09   
ref|XP_011091330.1|  PREDICTED: putative inactive disease suscept...  65.9    8e-09   Sesamum indicum [beniseed]
ref|XP_009612837.1|  PREDICTED: putative late blight resistance p...  65.9    8e-09   
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...  65.9    8e-09   Nicotiana sylvestris
ref|XP_008363331.1|  PREDICTED: putative disease resistance prote...  65.9    8e-09   
gb|ACE79412.1|  NBS-coding resistance gene analog                     64.7    9e-09   Nicotiana tabacum [American tobacco]
gb|ACE79442.1|  NBS-coding resistance gene analog                     64.3    9e-09   Nicotiana tabacum [American tobacco]
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...  65.9    9e-09   Nicotiana sylvestris
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...  65.9    9e-09   Nicotiana sylvestris
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...  65.9    9e-09   Sesamum indicum [beniseed]
gb|ACE79424.1|  NBS-coding resistance gene analog                     64.3    9e-09   Nicotiana tabacum [American tobacco]
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...  65.9    9e-09   Nicotiana sylvestris
gb|ACE79425.1|  NBS-coding resistance gene analog                     64.3    1e-08   Nicotiana tabacum [American tobacco]
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...  65.5    1e-08   Nicotiana sylvestris
ref|XP_006367915.1|  PREDICTED: putative disease resistance RPP13...  65.1    1e-08   Solanum tuberosum [potatoes]
ref|XP_009759016.1|  PREDICTED: putative late blight resistance p...  65.5    1e-08   Nicotiana sylvestris
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...  57.4    1e-08   Nicotiana sylvestris
gb|ACE79401.1|  NBS-coding resistance gene analog                     63.9    1e-08   Nicotiana tabacum [American tobacco]
ref|XP_009796570.1|  PREDICTED: putative late blight resistance p...  65.1    1e-08   Nicotiana sylvestris
emb|CDP19356.1|  unnamed protein product                              65.1    1e-08   Coffea canephora [robusta coffee]
gb|ACF22008.1|  NBS-coding resistance gene protein                    63.9    1e-08   Nicotiana tabacum [American tobacco]
ref|XP_008797616.1|  PREDICTED: putative disease resistance prote...  65.1    1e-08   Phoenix dactylifera
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg              65.1    1e-08   Erythranthe guttata [common monkey flower]
gb|KCW72272.1|  hypothetical protein EUGRSUZ_E00733                   61.6    2e-08   Eucalyptus grandis [rose gum]
gb|EAY96750.1|  hypothetical protein OsI_18670                        65.1    2e-08   Oryza sativa Indica Group [Indian rice]
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg              64.7    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...  64.7    2e-08   Nicotiana tomentosiformis
ref|XP_011102162.1|  PREDICTED: putative late blight resistance p...  64.7    2e-08   Sesamum indicum [beniseed]
gb|AFD18780.1|  putative resistance protein                           62.4    2e-08   Solanum bulbocastanum [ornamental nightshade]
ref|XP_009793286.1|  PREDICTED: putative late blight resistance p...  64.3    2e-08   Nicotiana sylvestris
ref|XP_010046117.1|  PREDICTED: putative disease resistance RPP13...  63.5    2e-08   
ref|XP_011091448.1|  PREDICTED: putative disease resistance prote...  64.3    2e-08   
ref|XP_010273761.1|  PREDICTED: putative disease resistance prote...  64.3    2e-08   
gb|EYU23518.1|  hypothetical protein MIMGU_mgv1a019595mg              64.7    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_006362537.1|  PREDICTED: putative late blight resistance p...  64.7    2e-08   Solanum tuberosum [potatoes]
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...  64.7    2e-08   Nicotiana sylvestris
ref|XP_008461342.1|  PREDICTED: disease resistance protein RGA2-l...  64.7    2e-08   
ref|XP_008461339.1|  PREDICTED: disease resistance protein RGA2-l...  64.7    2e-08   
ref|XP_008461338.1|  PREDICTED: disease resistance protein RGA2-l...  64.7    2e-08   
gb|ACE79441.1|  NBS-coding resistance gene analog                     63.2    2e-08   Nicotiana tabacum [American tobacco]
ref|XP_006367920.1|  PREDICTED: putative late blight resistance p...  63.9    2e-08   
ref|XP_009777473.1|  PREDICTED: putative late blight resistance p...  64.3    3e-08   Nicotiana sylvestris
ref|XP_006367916.1|  PREDICTED: putative late blight resistance p...  63.9    3e-08   Solanum tuberosum [potatoes]
ref|XP_009782023.1|  PREDICTED: putative late blight resistance p...  64.3    3e-08   Nicotiana sylvestris
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  64.3    3e-08   Solanum lycopersicum
ref|XP_009622529.1|  PREDICTED: putative late blight resistance p...  64.3    3e-08   Nicotiana tomentosiformis
ref|XP_011086979.1|  PREDICTED: putative late blight resistance p...  64.3    3e-08   Sesamum indicum [beniseed]
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  64.3    3e-08   Nicotiana sylvestris
ref|XP_006356564.1|  PREDICTED: putative late blight resistance p...  64.3    3e-08   Solanum tuberosum [potatoes]
ref|XP_009589053.1|  PREDICTED: putative late blight resistance p...  63.9    3e-08   
gb|KCW72458.1|  hypothetical protein EUGRSUZ_E00908                   64.3    3e-08   Eucalyptus grandis [rose gum]
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...  61.6    3e-08   
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  64.3    3e-08   Nicotiana sylvestris
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  64.3    3e-08   Nicotiana sylvestris
gb|EYU23616.1|  hypothetical protein MIMGU_mgv1a025793mg              63.9    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  63.9    3e-08   Nicotiana tomentosiformis
gb|ACF22011.1|  NBS-coding resistance gene protein                    62.8    3e-08   Nicotiana tabacum [American tobacco]
ref|XP_009759467.1|  PREDICTED: putative late blight resistance p...  61.2    3e-08   Nicotiana sylvestris
gb|ACF22014.1|  NBS-coding resistance gene protein                    62.8    4e-08   Nicotiana tabacum [American tobacco]
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  63.9    4e-08   
ref|XP_008811538.1|  PREDICTED: putative disease resistance RPP13...  63.9    4e-08   
ref|XP_010058328.1|  PREDICTED: probable disease resistance RPP8-...  63.9    4e-08   
emb|CDP21009.1|  unnamed protein product                              63.9    4e-08   Coffea canephora [robusta coffee]
gb|KDO39612.1|  hypothetical protein CISIN_1g043855mg                 63.9    4e-08   Citrus sinensis [apfelsine]
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  63.9    4e-08   Nicotiana sylvestris
ref|XP_009603187.1|  PREDICTED: putative late blight resistance p...  63.9    4e-08   Nicotiana tomentosiformis
ref|XP_009770862.1|  PREDICTED: putative late blight resistance p...  63.9    4e-08   Nicotiana sylvestris
emb|CDP10671.1|  unnamed protein product                              63.9    4e-08   Coffea canephora [robusta coffee]
ref|XP_007010985.1|  LRR and NB-ARC domains-containing disease re...  63.9    4e-08   
ref|XP_007052454.1|  LRR and NB-ARC domains-containing disease re...  62.8    4e-08   
emb|CDP05558.1|  unnamed protein product                              63.9    4e-08   Coffea canephora [robusta coffee]
ref|XP_010645145.1|  PREDICTED: putative disease resistance prote...  63.9    4e-08   
gb|ABR29793.1|  CC-NBS-LRR protein                                    63.5    4e-08   Solanum tuberosum [potatoes]
ref|XP_006356563.1|  PREDICTED: putative late blight resistance p...  63.9    4e-08   
gb|ACE79420.1|  NBS-coding resistance gene analog                     63.2    4e-08   Nicotiana tabacum [American tobacco]
ref|XP_010644910.1|  PREDICTED: putative disease resistance prote...  63.9    4e-08   
emb|CAN81911.1|  hypothetical protein VITISV_042289                   62.8    4e-08   Vitis vinifera
ref|XP_010645146.1|  PREDICTED: putative disease resistance prote...  63.9    4e-08   Vitis vinifera
ref|XP_010644907.1|  PREDICTED: putative disease resistance prote...  63.5    4e-08   
ref|XP_010659153.1|  PREDICTED: putative disease resistance RPP13...  62.8    5e-08   Vitis vinifera
ref|XP_008354961.1|  PREDICTED: putative disease resistance prote...  63.5    5e-08   
ref|XP_010319246.1|  PREDICTED: putative late blight resistance p...  63.5    5e-08   
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg              63.5    5e-08   Erythranthe guttata [common monkey flower]
emb|CAN83380.1|  hypothetical protein VITISV_040727                   63.5    5e-08   Vitis vinifera
ref|XP_006356910.1|  PREDICTED: putative late blight resistance p...  63.2    5e-08   
ref|XP_004491239.1|  PREDICTED: putative disease resistance prote...  63.5    5e-08   
ref|XP_004491238.1|  PREDICTED: putative disease resistance prote...  63.5    5e-08   
ref|XP_009792722.1|  PREDICTED: putative late blight resistance p...  63.5    5e-08   Nicotiana sylvestris
ref|XP_009770867.1|  PREDICTED: putative late blight resistance p...  63.5    5e-08   Nicotiana sylvestris
ref|XP_009596957.1|  PREDICTED: putative late blight resistance p...  63.5    5e-08   Nicotiana tomentosiformis
ref|XP_007052448.1|  LRR and NB-ARC domains-containing disease re...  62.0    5e-08   
ref|XP_010644908.1|  PREDICTED: putative disease resistance prote...  63.5    5e-08   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  63.5    5e-08   
ref|XP_006451769.1|  hypothetical protein CICLE_v10007328mg           63.5    5e-08   Citrus clementina [clementine]
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...  63.5    5e-08   
ref|XP_010046361.1|  PREDICTED: putative disease resistance RPP13...  60.5    5e-08   
gb|AEW48210.1|  disease resistance protein RGH5                       63.5    5e-08   Solanum huancabambense
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  63.5    5e-08   Nicotiana tomentosiformis
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...  63.5    6e-08   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg              63.2    6e-08   Erythranthe guttata [common monkey flower]
gb|ACE79451.1|  NBS-coding resistance gene analog                     62.4    6e-08   Nicotiana tabacum [American tobacco]
ref|XP_007009923.1|  NBS type disease resistance protein, putative    63.5    6e-08   
gb|ABB00481.1|  I2                                                    61.6    6e-08   Solanum tuberosum [potatoes]
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  63.5    6e-08   Sesamum indicum [beniseed]
ref|XP_011072647.1|  PREDICTED: putative late blight resistance p...  63.2    6e-08   
ref|XP_008350673.1|  PREDICTED: putative disease resistance prote...  63.2    6e-08   
ref|XP_011091324.1|  PREDICTED: probable disease resistance prote...  63.2    6e-08   Sesamum indicum [beniseed]
gb|ACF22032.1|  NBS-coding resistance gene protein                    62.4    6e-08   Nicotiana tabacum [American tobacco]
ref|XP_010101172.1|  Putative disease resistance protein              62.8    6e-08   
emb|CDP17557.1|  unnamed protein product                              63.2    7e-08   Coffea canephora [robusta coffee]
gb|KDO47604.1|  hypothetical protein CISIN_1g036079mg                 60.1    7e-08   Citrus sinensis [apfelsine]
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  63.2    7e-08   Sesamum indicum [beniseed]
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...  63.2    7e-08   Nicotiana tomentosiformis
gb|ABB00515.1|  I2                                                    61.6    7e-08   Solanum demissum
gb|ABB00490.1|  I2                                                    61.6    7e-08   Solanum demissum
gb|ABB00524.1|  I2                                                    61.6    7e-08   Solanum demissum
gb|KDO49259.1|  hypothetical protein CISIN_1g001955mg                 63.2    7e-08   Citrus sinensis [apfelsine]
ref|XP_010321918.1|  PREDICTED: putative late blight resistance p...  62.8    7e-08   
gb|KJB75066.1|  hypothetical protein B456_012G021900                  62.8    7e-08   Gossypium raimondii
ref|XP_006356561.1|  PREDICTED: putative late blight resistance p...  62.8    7e-08   Solanum tuberosum [potatoes]
gb|AGX27504.1|  NBS-LRR class resistance protein Fy8-Ry8              62.4    8e-08   Sesamum indicum [beniseed]
ref|XP_008652942.1|  PREDICTED: putative disease resistance RPP13...  62.4    8e-08   
ref|XP_003599591.1|  NBS-LRR type disease resistance protein          62.8    8e-08   
ref|XP_010914530.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...  62.8    8e-08   
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...  62.8    8e-08   
ref|XP_010055901.1|  PREDICTED: probable disease resistance RPP8-...  59.7    8e-08   Eucalyptus grandis [rose gum]
gb|AEW48196.1|  disease resistance protein RGH7                       62.8    8e-08   Solanum chacoense
gb|EYU29922.1|  hypothetical protein MIMGU_mgv1a0259201mg             62.8    8e-08   Erythranthe guttata [common monkey flower]
ref|XP_008810083.1|  PREDICTED: putative disease resistance RPP13...  62.8    8e-08   
ref|XP_011624292.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...  62.8    9e-08   
ref|XP_006441993.1|  hypothetical protein CICLE_v100186882mg          57.0    9e-08   
ref|XP_010661463.1|  PREDICTED: probable disease resistance RPP8-...  62.8    9e-08   Vitis vinifera
ref|XP_003599519.1|  Cc-nbs-lrr resistance protein                    62.8    9e-08   Medicago truncatula
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...  60.5    9e-08   
gb|KEH30519.1|  NBS-LRR type disease resistance protein               62.8    9e-08   Medicago truncatula
ref|XP_006478487.1|  PREDICTED: putative disease resistance prote...  57.0    9e-08   
ref|XP_003599363.1|  NBS-LRR type disease resistance protein          62.8    9e-08   Medicago truncatula
ref|XP_003599377.1|  NBS-LRR type disease resistance protein          62.8    1e-07   Medicago truncatula
gb|KDO49744.1|  hypothetical protein CISIN_1g047556mg                 57.0    1e-07   Citrus sinensis [apfelsine]
ref|XP_011087335.1|  PREDICTED: putative late blight resistance p...  62.8    1e-07   
emb|CDP20568.1|  unnamed protein product                              62.8    1e-07   Coffea canephora [robusta coffee]
ref|XP_009765183.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  62.8    1e-07   Nicotiana sylvestris
ref|XP_006366309.1|  PREDICTED: putative late blight resistance p...  62.4    1e-07   Solanum tuberosum [potatoes]
gb|EEC72357.1|  hypothetical protein OsI_05605                        62.8    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010041197.1|  PREDICTED: putative disease resistance RPP13...  62.0    1e-07   Eucalyptus grandis [rose gum]
gb|AEW48212.1|  disease resistance protein RGH1                       62.4    1e-07   Solanum leptophyes x Solanum sparsipilum
ref|XP_007052455.1|  Cc-nbs-lrr resistance protein, putative isof...  62.8    1e-07   
ref|XP_010101144.1|  Putative disease resistance protein RGA4         60.5    1e-07   
gb|AAT66781.1|  Putative disease resistance protein, identical        62.4    1e-07   Solanum demissum
ref|XP_003599413.1|  NBS-LRR type disease resistance protein          62.4    1e-07   Medicago truncatula
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg              62.4    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_010273758.1|  PREDICTED: putative disease resistance prote...  62.4    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010914711.1|  PREDICTED: putative disease resistance prote...  62.4    1e-07   
ref|XP_003599348.1|  NBS-LRR type disease resistance protein          62.4    1e-07   
emb|CDP07634.1|  unnamed protein product                              62.4    1e-07   
ref|XP_009618710.1|  PREDICTED: putative late blight resistance p...  62.4    1e-07   
emb|CDP11825.1|  unnamed protein product                              62.4    1e-07   
ref|XP_010026099.1|  PREDICTED: putative disease resistance RPP13...  61.6    1e-07   
emb|CDP18602.1|  unnamed protein product                              62.0    1e-07   
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...  62.4    1e-07   
ref|XP_009760596.1|  PREDICTED: late blight resistance protein R1...  62.4    1e-07   
emb|CDP20772.1|  unnamed protein product                              62.4    1e-07   
ref|XP_009768632.1|  PREDICTED: putative late blight resistance p...  62.4    1e-07   
ref|XP_009760600.1|  PREDICTED: late blight resistance protein R1...  62.4    1e-07   
ref|XP_009760597.1|  PREDICTED: late blight resistance protein R1...  62.4    1e-07   
gb|KCW72549.1|  hypothetical protein EUGRSUZ_E01015                   58.5    1e-07   
ref|XP_004238957.1|  PREDICTED: putative late blight resistance p...  62.0    1e-07   
ref|XP_004237148.1|  PREDICTED: putative late blight resistance p...  62.4    1e-07   
ref|XP_009618708.1|  PREDICTED: putative late blight resistance p...  62.4    1e-07   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...  62.0    1e-07   
gb|AES69651.2|  LRR and NB-ARC domain disease resistance protein      62.4    1e-07   
ref|XP_003599400.1|  NBS-LRR type disease resistance protein          62.4    1e-07   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...  62.0    1e-07   
ref|XP_010046406.1|  PREDICTED: putative disease resistance RPP13...  61.6    1e-07   
ref|XP_009618706.1|  PREDICTED: putative late blight resistance p...  62.0    2e-07   
emb|CDP21725.1|  unnamed protein product                              62.0    2e-07   
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...  62.0    2e-07   
ref|XP_007009194.1|  Disease resistance protein RPP8                  57.8    2e-07   
ref|XP_009766122.1|  PREDICTED: putative late blight resistance p...  61.6    2e-07   
ref|XP_009796562.1|  PREDICTED: putative late blight resistance p...  62.0    2e-07   
ref|XP_003624059.1|  NBS-LRR type disease resistance protein          62.0    2e-07   
ref|XP_006478486.1|  PREDICTED: putative disease resistance RPP13...  57.4    2e-07   
ref|XP_008810409.1|  PREDICTED: disease resistance RPP8-like prot...  62.0    2e-07   
emb|CDP10807.1|  unnamed protein product                              62.0    2e-07   
emb|CDP21941.1|  unnamed protein product                              61.6    2e-07   
ref|XP_009608047.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.0    2e-07   
gb|KJB74068.1|  hypothetical protein B456_011G270100                  62.0    2e-07   
emb|CDP21584.1|  unnamed protein product                              61.6    2e-07   
ref|NP_001066818.1|  Os12g0500500                                     62.0    2e-07   
ref|XP_006365692.1|  PREDICTED: putative late blight resistance p...  61.6    2e-07   
ref|XP_006478481.1|  PREDICTED: putative disease resistance RPP13...  57.4    2e-07   
gb|ACE79439.1|  NBS-coding resistance gene analog                     61.2    2e-07   
ref|XP_009592131.1|  PREDICTED: putative late blight resistance p...  62.0    2e-07   
ref|XP_006384740.1|  hypothetical protein POPTR_0004s20690g           58.5    2e-07   
gb|AES69619.2|  LRR and NB-ARC domain disease resistance protein      62.0    2e-07   
ref|XP_003599368.1|  NBS-LRR type disease resistance protein          62.0    2e-07   
gb|ACE79462.1|  NBS-coding resistance gene analog                     61.2    2e-07   
ref|XP_007131449.1|  hypothetical protein PHAVU_011G014300g           62.0    2e-07   
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  62.0    2e-07   
ref|XP_010058323.1|  PREDICTED: putative disease resistance prote...  59.3    2e-07   
gb|AES69611.2|  LRR and NB-ARC domain disease resistance protein      62.0    2e-07   
ref|XP_003599360.1|  NBS-LRR resistance-like protein 1N               62.0    2e-07   
ref|XP_003599370.1|  Cc-nbs-lrr resistance protein                    62.0    2e-07   
ref|XP_009760599.1|  PREDICTED: late blight resistance protein R1...  61.6    2e-07   
ref|XP_006350053.1|  PREDICTED: putative late blight resistance p...  61.6    2e-07   
gb|AEW48198.1|  disease resistance protein RGH4                       61.6    2e-07   
ref|XP_009760595.1|  PREDICTED: late blight resistance protein R1...  61.6    2e-07   
gb|AFB17980.1|  Rx-like protein                                       61.2    2e-07   
gb|ACF22034.1|  NBS-coding resistance gene protein                    60.8    2e-07   
emb|CDP13828.1|  unnamed protein product                              61.6    2e-07   
gb|ACE79428.1|  NBS-coding resistance gene analog                     60.8    2e-07   
ref|XP_006423591.1|  hypothetical protein CICLE_v10027800mg           61.6    2e-07   
emb|CAN81725.1|  hypothetical protein VITISV_034604                   61.2    2e-07   
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  61.6    2e-07   
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  61.6    2e-07   
gb|AFB17983.1|  Rx-like protein                                       61.2    2e-07   
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  61.6    2e-07   
ref|XP_003599473.1|  Cc-nbs-lrr resistance protein                    61.6    2e-07   
gb|ACE79417.1|  NBS-coding resistance gene analog                     60.8    2e-07   
ref|XP_007131450.1|  hypothetical protein PHAVU_011G014400g           61.2    2e-07   
emb|CDP17160.1|  unnamed protein product                              61.6    2e-07   
emb|CDP13095.1|  unnamed protein product                              61.6    2e-07   
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  61.6    2e-07   
gb|AFB17979.1|  Rx-like protein                                       60.8    2e-07   
ref|XP_009417896.1|  PREDICTED: putative disease resistance prote...  61.2    2e-07   
ref|XP_010914720.1|  PREDICTED: putative disease resistance prote...  61.6    2e-07   
ref|XP_008350652.1|  PREDICTED: disease resistance protein RGA2-like  61.6    2e-07   
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  61.6    2e-07   
gb|AEW48192.1|  disease resistance protein RGH3                       61.6    2e-07   
ref|XP_007131448.1|  hypothetical protein PHAVU_011G014200g           61.6    2e-07   
ref|XP_010026096.1|  PREDICTED: putative disease resistance RPP13...  61.2    3e-07   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  61.2    3e-07   
gb|ACE79456.1|  NBS-coding resistance gene analog                     60.8    3e-07   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...  61.6    3e-07   
ref|XP_008812968.1|  PREDICTED: putative disease resistance RPP13...  61.2    3e-07   
gb|ACE79435.1|  NBS-coding resistance gene analog                     60.8    3e-07   
gb|ACE79459.1|  NBS-coding resistance gene analog                     60.8    3e-07   
ref|XP_009613225.1|  PREDICTED: late blight resistance protein R1...  61.2    3e-07   
emb|CDP19798.1|  unnamed protein product                              61.2    3e-07   
emb|CDP17544.1|  unnamed protein product                              61.2    3e-07   
ref|XP_010914742.1|  PREDICTED: putative disease resistance RPP13...  61.2    3e-07   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...  59.7    3e-07   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...  59.7    3e-07   
ref|XP_010058358.1|  PREDICTED: probable disease resistance prote...  57.8    3e-07   
gb|EYU23506.1|  hypothetical protein MIMGU_mgv1a001122mg              61.2    3e-07   
gb|ACE79426.1|  NBS-coding resistance gene analog                     60.5    3e-07   
gb|ABB00383.1|  I2                                                    59.7    3e-07   
ref|XP_007010950.1|  LRR and NB-ARC domains-containing disease re...  61.2    3e-07   
ref|XP_009800886.1|  PREDICTED: putative late blight resistance p...  61.2    3e-07   
ref|XP_004971264.1|  PREDICTED: putative disease resistance prote...  61.2    3e-07   
gb|ACE79453.1|  NBS-coding resistance gene analog                     60.5    3e-07   
ref|XP_004971260.1|  PREDICTED: putative disease resistance prote...  61.2    3e-07   
ref|XP_007010987.1|  LRR and NB-ARC domains-containing disease re...  61.2    3e-07   
gb|AEW48190.1|  disease resistance protein RX4                        61.2    3e-07   
gb|KFK22148.1|  hypothetical protein AALP_AAs59531U000200             60.8    3e-07   
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  61.2    3e-07   
gb|ACI43068.1|  NBS-LRR root-knot nematode resistance protein         61.2    3e-07   
emb|CAN80606.1|  hypothetical protein VITISV_002648                   61.2    3e-07   
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...  61.2    3e-07   
gb|KEH38203.1|  LRR and NB-ARC domain disease resistance protein      61.2    3e-07   
ref|XP_002529624.1|  leucine-rich repeat containing protein, puta...  61.2    3e-07   
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  61.2    3e-07   
ref|XP_003599431.1|  Cc-nbs-lrr resistance protein                    61.2    3e-07   
ref|XP_011089052.1|  PREDICTED: putative disease resistance prote...  54.7    3e-07   
gb|ACE79455.1|  NBS-coding resistance gene analog                     60.5    3e-07   
ref|XP_003599436.1|  NBS-LRR type disease resistance protein          61.2    3e-07   
gb|ACE79510.1|  NBS-coding resistance gene analog                     59.7    3e-07   
ref|XP_006366389.1|  PREDICTED: putative disease resistance RPP13...  61.2    3e-07   
ref|XP_010040534.1|  PREDICTED: putative disease resistance RPP13...  60.5    3e-07   
ref|XP_004242250.1|  PREDICTED: putative late blight resistance p...  60.8    3e-07   
gb|ACE79509.1|  NBS-coding resistance gene analog                     59.7    3e-07   
gb|ACE79511.1|  NBS-coding resistance gene analog                     59.7    3e-07   
gb|ACE79513.1|  NBS-coding resistance gene analog                     59.7    3e-07   
gb|ACE79512.1|  NBS-coding resistance gene analog                     59.7    3e-07   
ref|XP_008377908.1|  PREDICTED: disease resistance protein RPM1-like  60.8    3e-07   
ref|XP_010058277.1|  PREDICTED: disease resistance protein RPP8-like  60.8    3e-07   
gb|AEW48216.1|  disease resistance protein RX3                        60.8    3e-07   
ref|XP_003599404.1|  Cc-nbs-lrr resistance protein                    61.2    3e-07   
ref|XP_003637535.1|  NBS-containing resistance-like protein           60.1    3e-07   
gb|AFB17976.1|  Rx-like protein                                       60.5    3e-07   
gb|KCW58340.1|  hypothetical protein EUGRSUZ_H01023                   61.2    3e-07   
gb|KCW58335.1|  hypothetical protein EUGRSUZ_H01018                   61.2    3e-07   
ref|XP_010026094.1|  PREDICTED: putative disease resistance RPP13...  61.2    4e-07   
gb|ACE79508.1|  NBS-coding resistance gene analog                     59.7    4e-07   
ref|XP_010323848.1|  PREDICTED: putative late blight resistance p...  60.8    4e-07   
ref|XP_003629595.1|  Cc-nbs-lrr resistance protein                    60.8    4e-07   
gb|ABI96211.1|  NBS-LRR resistance protein-like protein               61.2    4e-07   
ref|XP_002523983.1|  Disease resistance protein RGA2, putative        60.8    4e-07   
gb|AEW48205.1|  disease resistance protein RGH2                       60.8    4e-07   
ref|XP_003599114.1|  hypothetical protein MTR_3g028040                60.8    4e-07   
gb|ACE79446.1|  NBS-coding resistance gene analog                     60.5    4e-07   
ref|XP_006478628.1|  PREDICTED: putative disease resistance RPP13...  60.8    4e-07   
gb|AGX27499.1|  NBS-LRR class resistance protein Fy1-Ry1              60.5    4e-07   
gb|EYU25639.1|  hypothetical protein MIMGU_mgv1a022176mg              60.5    4e-07   
ref|XP_004485724.1|  PREDICTED: putative disease resistance RPP13...  60.8    4e-07   
emb|CDP12769.1|  unnamed protein product                              58.9    4e-07   
gb|ABB00379.1|  I2                                                    59.7    4e-07   
ref|XP_009608835.1|  PREDICTED: late blight resistance protein R1...  60.8    4e-07   
ref|XP_009371521.1|  PREDICTED: putative disease resistance prote...  60.8    4e-07   
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1              60.8    4e-07   
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...  60.8    4e-07   
gb|KCW72465.1|  hypothetical protein EUGRSUZ_E00917                   57.8    4e-07   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1              60.8    4e-07   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1              60.8    4e-07   
gb|KDO64025.1|  hypothetical protein CISIN_1g046770mg                 60.5    4e-07   
ref|XP_010273759.1|  PREDICTED: putative disease resistance prote...  60.8    4e-07   
gb|ABB00381.1|  I2                                                    59.3    4e-07   
ref|XP_006598098.1|  PREDICTED: resistance protein KR4 isoform X2     60.8    4e-07   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1              60.8    4e-07   
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1              60.8    4e-07   
gb|KJB74071.1|  hypothetical protein B456_011G270400                  60.8    4e-07   
ref|XP_009608834.1|  PREDICTED: late blight resistance protein R1...  60.8    4e-07   
emb|CDP21174.1|  unnamed protein product                              60.5    4e-07   
ref|XP_003599514.1|  Cc-nbs resistance protein                        60.8    4e-07   
ref|XP_007010994.1|  LRR and NB-ARC domains-containing disease re...  60.8    4e-07   
ref|XP_010045687.1|  PREDICTED: putative disease resistance RPP13...  60.5    4e-07   
ref|XP_002299922.2|  NBS-LRR resistance gene-like protein ARGH30      52.4    4e-07   
ref|XP_004485725.1|  PREDICTED: putative disease resistance RPP13...  60.8    4e-07   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1              60.5    4e-07   
gb|AEW48200.1|  disease resistance protein RGH7                       60.8    4e-07   
ref|XP_010269704.1|  PREDICTED: putative disease resistance RPP13...  60.8    4e-07   
emb|CDP10805.1|  unnamed protein product                              60.8    4e-07   
ref|XP_010055906.1|  PREDICTED: putative disease resistance prote...  57.4    4e-07   
gb|ACE79427.1|  NBS-coding resistance gene analog                     60.1    4e-07   
emb|CDP17266.1|  unnamed protein product                              60.5    4e-07   
ref|XP_008238997.1|  PREDICTED: putative disease resistance prote...  60.8    4e-07   
ref|XP_006659887.1|  PREDICTED: putative disease resistance prote...  60.8    5e-07   
emb|CAN67241.1|  hypothetical protein VITISV_037461                   60.8    5e-07   
ref|XP_008231705.1|  PREDICTED: putative disease resistance RPP13...  60.8    5e-07   
gb|KCW58349.1|  hypothetical protein EUGRSUZ_H01033                   60.8    5e-07   
ref|XP_007011206.1|  NB-ARC domain-containing disease resistance ...  60.8    5e-07   
gb|ABI96216.1|  NBS-LRR resistance protein-like protein               60.8    5e-07   
ref|XP_010644892.1|  PREDICTED: putative disease resistance prote...  60.8    5e-07   
ref|XP_010644883.1|  PREDICTED: putative disease resistance prote...  60.8    5e-07   
ref|XP_010647281.1|  PREDICTED: putative disease resistance prote...  60.1    5e-07   
ref|XP_009788554.1|  PREDICTED: putative late blight resistance p...  60.8    5e-07   
ref|XP_010315011.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  60.5    5e-07   
ref|XP_008377548.1|  PREDICTED: putative disease resistance prote...  60.5    5e-07   
ref|XP_010045698.1|  PREDICTED: putative disease resistance prote...  60.5    5e-07   
ref|XP_002532127.1|  leucine-rich repeat containing protein, puta...  60.5    5e-07   
gb|AFB17982.1|  Rx-like protein                                       60.1    5e-07   
ref|XP_006598097.1|  PREDICTED: resistance protein KR4 isoform X1     60.5    5e-07   
gb|AEW48217.1|  disease resistance protein RX5                        60.5    5e-07   
ref|XP_010069842.1|  PREDICTED: putative disease resistance prote...  60.5    5e-07   
gb|KCW58343.1|  hypothetical protein EUGRSUZ_H01027                   60.5    5e-07   
gb|EYU23523.1|  hypothetical protein MIMGU_mgv1a025044mg              60.5    5e-07   
ref|XP_006470956.1|  PREDICTED: putative disease resistance prote...  60.5    5e-07   
ref|XP_006470955.1|  PREDICTED: putative disease resistance prote...  60.5    5e-07   
ref|XP_009383503.1|  PREDICTED: putative disease resistance prote...  60.5    5e-07   
ref|XP_010058349.1|  PREDICTED: probable disease resistance RPP8-...  60.5    5e-07   
ref|XP_007011207.1|  LRR and NB-ARC domains-containing disease re...  60.5    5e-07   
ref|XP_011469158.1|  PREDICTED: putative disease resistance RPP13...  60.5    5e-07   
ref|XP_010644891.1|  PREDICTED: putative disease resistance prote...  60.5    5e-07   
ref|XP_010663514.1|  PREDICTED: putative disease resistance prote...  52.8    5e-07   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  57.0    5e-07   
gb|ABI96218.1|  truncated NBS-LRR resistance protein-like protein     60.5    5e-07   
ref|XP_010661449.1|  PREDICTED: putative disease resistance RPP13...  59.7    5e-07   
emb|CDP11620.1|  unnamed protein product                              60.5    5e-07   
ref|XP_003599567.1|  Cc-nbs resistance protein                        60.5    5e-07   
gb|AES69845.2|  LRR and NB-ARC domain disease resistance protein      60.5    5e-07   
gb|KEH17686.1|  LRR and NB-ARC domain disease resistance protein      60.5    5e-07   
ref|XP_003599596.1|  NBS-LRR type disease resistance protein          60.5    5e-07   
ref|XP_003599594.1|  NBS-LRR type disease resistance protein          60.5    5e-07   
ref|XP_002269455.2|  PREDICTED: probable disease resistance prote...  60.5    5e-07   
gb|KCW72453.1|  hypothetical protein EUGRSUZ_E00899                   59.3    5e-07   
ref|XP_008375295.1|  PREDICTED: putative disease resistance RPP13...  59.3    5e-07   
ref|XP_009778429.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  60.5    5e-07   
ref|XP_004240498.1|  PREDICTED: putative late blight resistance p...  60.5    5e-07   
ref|XP_009757967.1|  PREDICTED: putative late blight resistance p...  60.5    5e-07   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2             60.5    5e-07   
ref|XP_009622003.1|  PREDICTED: putative late blight resistance p...  60.5    6e-07   
ref|XP_010647271.1|  PREDICTED: disease resistance protein RPP13-...  56.6    6e-07   
ref|XP_004240499.1|  PREDICTED: putative late blight resistance p...  60.5    6e-07   



>gb|AAV88066.1| NBS-LRR protein [Ipomoea batatas]
Length=846

 Score = 63.9 bits (154),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 45/143 (31%), Positives = 76/143 (53%), Gaps = 16/143 (11%)
 Frame = +2

Query  374  LADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTA  553
            L++F+L  + P+     D+ + Y  +L Q    A +    + E+        E +  K  
Sbjct  79   LSNFLLAIKNPE-----DQQKAYQQQLLQTLGEAAQNAAKLVEK------SKETDDDKEV  127

Query  554  HDVLQRFQVLSIQH--ASHSKEQMIGK-KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGK  724
             ++     +  ++H  AS     M+G+ +D   II KL+   G +E KV++I GM GIGK
Sbjct  128  VNISGGPVIPWLKHDSASEPSNVMVGRGRDRMLIIDKLI--RGSEELKVLSIVGMPGIGK  185

Query  725  TTLARXVYEDSPISTHFDVRAWI  793
            TTLAR VY++  +++HFDV+ W+
Sbjct  186  TTLARSVYKNKLVTSHFDVQKWV  208


 Score = 56.6 bits (135),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 15/93 (16%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKL----GFLISQHDEE  255
            MACVA+ SL+ TI+LEFLQ +PR        +  + E ++SF++KL    GF+    ++ 
Sbjct  1    MACVALTSLMATIKLEFLQPNPR--------VVLDDEAMESFYEKLSSLQGFV---QEKS  49

Query  256  RIDGVEAVKRLETKLRDLAYRVEDEIEILVAHL  354
               G  A++ LE ++RD A   ED IE  +++ 
Sbjct  50   GARGGTAIRHLEIQIRDFALEAEDRIETQLSNF  82



>gb|AAV88068.1| NBS-LRR protein [Ipomoea batatas]
Length=849

 Score = 72.8 bits (177),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 48/141 (34%), Positives = 77/141 (55%), Gaps = 15/141 (11%)
 Frame = +2

Query  374  LADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTA  553
            L++F+L K +       ++ +    KLHQ    A E        L+KI N  + E  +  
Sbjct  75   LSNFLLAKNR-------EDQQKAAQKLHQTLIEAAEN----AAHLLKISNESDDESNE-C  122

Query  554  HDVLQRFQVLSIQHASHSKE-QMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTT  730
            H ++      S++      E +M+G+++++ ++K  L      +++VI I GM GIGKTT
Sbjct  123  HSLIPWSLDTSLRLQPPKLEGRMVGRRNDYLLVKNQLLY--SDQRRVILIVGMNGIGKTT  180

Query  731  LARXVYEDSPISTHFDVRAWI  793
            LA  VYEDS +++HFDVRAWI
Sbjct  181  LAASVYEDSSVASHFDVRAWI  201


 Score = 46.2 bits (108),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 11/89 (12%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERIDG  267
            M CVA+ SL+ TIEL+FL+  PR  +        + EL   F +KL  L  Q   ++  G
Sbjct  1    MGCVALTSLMATIELQFLRSIPRVSI-------LDDELPIKFFEKLSSL--QAFLQQKSG  51

Query  268  VEAVKRLETKLRDLAYRVEDEIEILVAHL  354
              A++ LE ++RD A   ED IEI +++ 
Sbjct  52   --AIRDLEIQIRDFALDAEDRIEIQLSNF  78



>gb|AAV88067.1| NBS-LRR protein [Ipomoea batatas]
Length=779

 Score = 65.5 bits (158),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 78/146 (53%), Gaps = 22/146 (15%)
 Frame = +2

Query  374  LADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKN----IDEAEG  541
            L++F+L  + P+     D+ + Y  KLHQ    A E    + E+  +  +    I+E+EG
Sbjct  84   LSNFLLAIKNPE-----DQQKAY-QKLHQTLGEAAENAAELLEKSKQTDDEEVVINESEG  137

Query  542  RKTAHDVLQRFQVLSIQH--ASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGG  715
                        + S++H   S     M+G+  +   +++ L   G  + +V++I GM G
Sbjct  138  P----------LIPSLKHYLVSEPSNIMVGRHYDLRQVREKLLWRGTWKLEVLSIVGMPG  187

Query  716  IGKTTLARXVYEDSPISTHFDVRAWI  793
            IGKTTLAR VYE++ ++ HF+VR+W+
Sbjct  188  IGKTTLARSVYENALVAGHFEVRSWV  213


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 14/95 (15%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKEL---IQSFHQKLGFL---ISQHD  249
            MACVA+ SL+ TI+LEF+Q +       N  +P + E    I S  +KL  L   + Q  
Sbjct  1    MACVALTSLMATIQLEFVQPN-------NGRVPLDDEASISINSLFEKLSSLQGFVQQKS  53

Query  250  EERIDGVEAVKRLETKLRDLAYRVEDEIEILVAHL  354
              +  G  A++ LE ++RD A   ED IEI +++ 
Sbjct  54   GAKGRGT-AIRHLEIEIRDFALDAEDRIEIQLSNF  87



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score = 77.0 bits (188),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 53/153 (35%), Positives = 83/153 (54%), Gaps = 27/153 (18%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDE  532
            + +++R L + V+  ++ Q++T     E +C  L QV     E+I  +++E +KI+   +
Sbjct  76   YTIQLR-LTEAVMANDEMQKETA---REMFCDSLQQV----AEDISRVQKESMKIQQKGK  127

Query  533  -------AEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
                    +G  +A DVL            + K+ M+G+ D+ + + + LT     E KV
Sbjct  128  QASKKSLVQGSSSAKDVL------------NVKKNMVGRDDQRKRLLEDLTRGSSGELKV  175

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            I I GMGGIGKTTLA+ VY D  I +HFDVRAW
Sbjct  176  IPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAW  208


 Score = 30.0 bits (66),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 45/85 (53%), Gaps = 6/85 (7%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFL-ISQHDEERID  264
            MA  ++ASL+RT+EL      P        LI  ++E I + ++K+  L +   + ER +
Sbjct  1    MAYASIASLMRTVELLLTLKSP-----IQSLICDHREEILTLNEKVSSLEVFLKNSERSN  55

Query  265  GVEAVKRLETKLRDLAYRVEDEIEI  339
              E +  LE  ++++A  VE  I++
Sbjct  56   VSEEMTDLEAWIKEVANVVEYTIQL  80



>ref|XP_009624584.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana tomentosiformis]
Length=723

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 68/115 (59%), Gaps = 2/115 (2%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+EE++++KEEL K+K+ +     +  +  L       + H S  +  M+G 
Sbjct  103  RLLKILQRAIEEVDSVKEELNKLKDNNNNNNMRAGNFSLGGSSSPRL-HVSTLENNMVGH  161

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              E E+++  LT +   + +VI+I GMGGIGK+T A+ ++ D  I + FDVR W+
Sbjct  162  NIEQELMRGQLTGNS-SQLEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWV  215


 Score = 32.7 bits (73),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 15/95 (16%)
 Frame = +1

Query  88   MACV--AVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERI  261
            MA V  AV SL+ TI+L          +Q +H     KE ++  + K+G ++   D    
Sbjct  1    MATVYAAVTSLMGTIQL---ISQSTSDLQEDH-----KEHLKLLYDKVGSMLEFLDTNSD  52

Query  262  DGVEAVKRLETKLRDLAYRVEDEIEILVAHLYHED  366
            D  E ++ L  K++D+A++VEDE+E   +H++  D
Sbjct  53   D--EPMRDLLKKVKDVAHKVEDEVE---SHIWRGD  82



>ref|XP_011083958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=877

 Score = 65.1 bits (157),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 9/118 (8%)
 Frame = +2

Query  440  YCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQM  619
            +C +L +V    +E  ++ K ++++ +N+    G K        F   S++ AS  K  M
Sbjct  95   FCEELQRV----VENFDSAKLQVMEFRNM----GSKNLAPK-NSFSAGSLRLASGGKNSM  145

Query  620  IGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            +G  DE   IK  LT     +  VI+I GMGG GKTTLAR +Y+D+ I  HF  RAW+
Sbjct  146  VGFVDEMLQIKDRLTGQPSYKLDVISIVGMGGSGKTTLARSMYDDAFIVYHFYTRAWV  203


 Score = 37.7 bits (86),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 46/88 (52%), Gaps = 10/88 (11%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERIDG  267
            MA  +V SL+ T+E           ++  H I +NKE I+    K+ FL +  ++     
Sbjct  1    MAYASVVSLIETLEE----------IRDGHEILYNKEQIECLLSKVSFLQTFLEDFSQKN  50

Query  268  VEAVKRLETKLRDLAYRVEDEIEILVAH  351
             + VK LET++RD AY  ++ I+  +++
Sbjct  51   SKEVKELETQIRDAAYAAQNMIDSYISN  78



>ref|XP_009624579.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624580.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624581.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 70.1 bits (170),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 39/115 (34%), Positives = 68/115 (59%), Gaps = 2/115 (2%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+EE++++KEEL K+K+ +     +  +  L       + H S  +  M+G 
Sbjct  103  RLLKILQRAIEEVDSVKEELNKLKDNNNNNNMRAGNFSLGGSSSPRL-HVSTLENNMVGH  161

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              E E+++  LT +   + +VI+I GMGGIGK+T A+ ++ D  I + FDVR W+
Sbjct  162  NIEQELMRGQLTGNS-SQLEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWV  215


 Score = 32.3 bits (72),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 15/95 (16%)
 Frame = +1

Query  88   MACV--AVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERI  261
            MA V  AV SL+ TI+L          +Q +H     KE ++  + K+G ++   D    
Sbjct  1    MATVYAAVTSLMGTIQL---ISQSTSDLQEDH-----KEHLKLLYDKVGSMLEFLDTNSD  52

Query  262  DGVEAVKRLETKLRDLAYRVEDEIEILVAHLYHED  366
            D  E ++ L  K++D+A++VEDE+E   +H++  D
Sbjct  53   D--EPMRDLLKKVKDVAHKVEDEVE---SHIWRGD  82



>ref|XP_009624582.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=843

 Score = 69.7 bits (169),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 39/115 (34%), Positives = 68/115 (59%), Gaps = 2/115 (2%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+EE++++KEEL K+K+ +     +  +  L       + H S  +  M+G 
Sbjct  103  RLLKILQRAIEEVDSVKEELNKLKDNNNNNNMRAGNFSLGGSSSPRL-HVSTLENNMVGH  161

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              E E+++  LT +   + +VI+I GMGGIGK+T A+ ++ D  I + FDVR W+
Sbjct  162  NIEQELMRGQLTGNS-SQLEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWV  215


 Score = 32.7 bits (73),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 15/95 (16%)
 Frame = +1

Query  88   MACV--AVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERI  261
            MA V  AV SL+ TI+L          +Q +H     KE ++  + K+G ++   D    
Sbjct  1    MATVYAAVTSLMGTIQL---ISQSTSDLQEDH-----KEHLKLLYDKVGSMLEFLDTNSD  52

Query  262  DGVEAVKRLETKLRDLAYRVEDEIEILVAHLYHED  366
            D  E ++ L  K++D+A++VEDE+E   +H++  D
Sbjct  53   D--EPMRDLLKKVKDVAHKVEDEVE---SHIWRGD  82



>ref|XP_009762697.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762698.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762699.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=900

 Score = 64.7 bits (156),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 63/115 (55%), Gaps = 5/115 (4%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+E I++IKEEL K +  +  +   ++       +     H S  +  M+G 
Sbjct  102  RLLKILQRAIEAIDSIKEELFKQRENNNMQAGNSSLGGSNSPE----SHVSTLENNMVGY  157

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             DE   + + LT    ++ +VI+I GMGGIGK+T A+ V+ D  +   FDVR W+
Sbjct  158  NDEQASMLRQLTGDS-RQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWV  211


 Score = 35.0 bits (79),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 12/83 (14%)
 Frame = +1

Query  91   ACVAVASLLRTIELEFLQYHPRPLVQYN-HLIPFNKELIQSFHQKLGFLISQHDEERIDG  267
            A  AV SL+ TI L         + Q N  L   +KE ++  ++K+G L+   D    DG
Sbjct  3    AYAAVTSLMGTIHL---------ISQSNLDLQDGHKEHLKLLYEKVGSLLEFLDTNSDDG  53

Query  268  VEAVKRLETKLRDLAYRVEDEIE  336
              ++K L+ K++DLA+ VED++E
Sbjct  54   --SMKDLQEKVKDLAHEVEDKVE  74



>ref|XP_009631207.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=933

 Score = 69.3 bits (168),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 39/115 (34%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L  + Q A+EE++++KEEL K+K+ +     +  +  L       + H S  +  M+G 
Sbjct  103  RLLMILQRAIEEVDSVKEELNKLKDNNNNNNMRAGNFSLGGSSSPRL-HVSTLENNMVGH  161

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              E E+++  LT +   + +VI+I GMGGIGK+T A+ ++ D  I + FDVR W+
Sbjct  162  NIEQELMRGQLTGNS-SQLEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWV  215


 Score = 30.4 bits (67),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 5/58 (9%)
 Frame = +1

Query  193  KELIQSFHQKLGFLISQHDEERIDGVEAVKRLETKLRDLAYRVEDEIEILVAHLYHED  366
            KE ++  + K+G ++   D    D  E ++ L  K++D+A++VEDE+E   +H++  D
Sbjct  30   KEHLKLLYDKVGSMLEFLDTNSDD--EPMRDLLKKVKDVAHKVEDEVE---SHIWRGD  82



>ref|XP_011073066.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=777

 Score = 69.7 bits (169),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 66/113 (58%), Gaps = 7/113 (6%)
 Frame = +2

Query  458  QVFQSAMEEIEAIKEELVKIKNIDEA-EGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKD  634
            Q  Q  ++EI+ I EE++   N     + +++A   +      S Q A+ SK +M+G  D
Sbjct  115  QDLQLVLQEIDLIVEEVMMYMNSCRVYDCQRSAASPIS-----SSQRANSSKVRMVGLDD  169

Query  635  EFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            +   IK  L   G  + + I+I GMGGIGKTTLA+ +++D+ +  +FD+RAW+
Sbjct  170  DLMQIKARLCG-GSSQLQTISIVGMGGIGKTTLAKNIFDDASLGYYFDIRAWM  221


 Score = 29.6 bits (65),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +1

Query  262  DGVEAVKRLETKLRDLAYRVEDEIEILVAHLY-HEDEGFSRFRFEK  396
            +G E V+ LE ++RD AY+  D IE  +++ +  E      +R  K
Sbjct  53   NGGETVESLEIRIRDAAYKAADMIESRISNQFVSESASPGEWRLPK  98



>ref|XP_010312513.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312514.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312515.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312516.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=881

 Score = 62.4 bits (150),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 59/111 (53%), Gaps = 15/111 (14%)
 Frame = +2

Query  497  KEELVKI-KNIDE-----------AEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEF  640
            +EELVK+ K++D              G K+A      F     Q ++  +  ++G KD+F
Sbjct  100  EEELVKVEKDVDSLRKEVTVVEFNKHGTKSAELATTPFS--PDQKSTIVENTVVGMKDDF  157

Query  641  EIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             II   LT     E  VI I GMGGIGKTTLAR VY+DS I + FD  AW+
Sbjct  158  NIILDRLTAQ-TDELIVIPILGMGGIGKTTLARKVYDDSCIRSRFDKLAWV  207


 Score = 37.0 bits (84),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/105 (26%), Positives = 55/105 (52%), Gaps = 13/105 (12%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKEL-IQSFHQKLGFLISQHDEERID  264
            MA  A++SL+ T+E  F     +P    + + P + +  +++ +Q L  L    D+    
Sbjct  1    MAYAAISSLMYTLEQLF-----KP--NQSFVCPCSTQQHVENLNQNLSALQDFLDDTTTK  53

Query  265  GVEAVKRLETKLRDLAYRVEDEIE-----ILVAHLYHEDEGFSRF  384
             +E +K +E ++RD+ Y+ ED+++     I++A      EG ++F
Sbjct  54   DIETLKVVEKRIRDVVYKAEDKVDSSLRSIILADSTESREGAAKF  98



>ref|XP_009763644.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=353

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 14/136 (10%)
 Frame = +2

Query  392  KKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQR  571
            K EK QR+      E +C +L +  +S   +   + E +            +  + ++Q 
Sbjct  99   KNEKIQREA----YEKFCTRLQEASESIDSKCRKLTENM--------KSNLQVTNSLVQS  146

Query  572  FQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYE  751
            F +   +H+      M+G ++E E IK  L +    E++ +AITGMGGIGKTT AR +Y+
Sbjct  147  FDL--PEHSPQLGNCMVGHENELEDIKCKLMKISSDERETMAITGMGGIGKTTFARKIYD  204

Query  752  DSPISTHFDVRAWIVA  799
            D  I +HFD+ AW  A
Sbjct  205  DPEIKSHFDILAWATA  220



>gb|AAV88065.1| leucine-rich repeat protein [Ipomoea batatas]
Length=406

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 75/158 (47%), Gaps = 24/158 (15%)
 Frame = +2

Query  359  MKMRD------------LADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKE  502
            MK+RD            L++FVL           ++ +  C KLH + Q A E       
Sbjct  60   MKIRDFALEAEDRIEIQLSNFVLA-------NNAEDQQKACQKLHHILQEAAEN----AA  108

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEH-GPK  679
            EL+K+ +    E  K A         L    AS     M+G++ + ++I   LT+     
Sbjct  109  ELLKLSSSISKEAVKNARSEGSVISWLKHDSASEPSNVMVGRRHDRKVIMNDLTDSLWCN  168

Query  680  EKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            E KV++I GM GIGKTTLA  VYED  +++ FDVR W+
Sbjct  169  ELKVVSIVGMAGIGKTTLASSVYEDPEVASSFDVRRWV  206



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 70/116 (60%), Gaps = 10/116 (9%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVL--SIQHASHSKEQMI  622
            +L    +   E+I+ +++E  KI++    +G+K +++ L    VL  S +   + K  M+
Sbjct  67   RLGDCLKQVAEDIDRVRKETKKIQD----KGKKASNESL----VLDSSTKDIPNLKNNMV  118

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G+ DE + + + LT     E KVI I GMGGIGKTTLA+ V+ D+ I +HFDVRAW
Sbjct  119  GRDDERKRLLENLTRGFSGEPKVIPIVGMGGIGKTTLAKEVFNDASIRSHFDVRAW  174



>ref|XP_009786668.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana sylvestris]
Length=898

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = +2

Query  434  EPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKE  613
            E +C  L QV     E+I  +++E +KI++    +G++ +   L R    S +   + K+
Sbjct  99   EMFCDSLQQV----AEDISHLQKESMKIQH----KGKQASKKSLVRGSS-SAKDVLNVKK  149

Query  614  QMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             M+G+ D+ + + + LT     E KVI I GMGGIGKTTLA+ VY D  I +HFDVRAW
Sbjct  150  NMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAW  208



>ref|XP_009603167.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score = 66.6 bits (161),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 5/115 (4%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+E I++IKEEL K +   E    +  +  L     L   H S  +  M+G 
Sbjct  102  RLLKILQRAVEAIDSIKEELFKQR---ENNNMQAGNSSLGGSNSLG-SHVSTLENNMVGY  157

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             DE   + + LT    ++ +VI+I GMGGIGK+T A+ V+ D  +   FDVR WI
Sbjct  158  NDEQASMLRQLTGDS-RQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWI  211


 Score = 30.8 bits (68),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 12/83 (14%)
 Frame = +1

Query  91   ACVAVASLLRTIELEFLQYHPRPLVQYN-HLIPFNKELIQSFHQKLGFLISQHDEERIDG  267
            A  A+ SL+ TI L         + Q N  L+  +KE ++  ++K+  L+   D    D 
Sbjct  3    AYAALTSLMGTIHL---------ISQSNLDLLDGHKEHLKLLYEKVSSLLEFLDTNSDD-  52

Query  268  VEAVKRLETKLRDLAYRVEDEIE  336
             E +K L+ K++DLA+ VED++E
Sbjct  53   -EPMKDLQEKVKDLAHEVEDKVE  74



>dbj|BAD18094.1| NBS-LRR protein [Ipomoea batatas]
Length=255

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +2

Query  596  ASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHF  775
            +S  K  M+G  DEFE I   L  H  K+ +VI+I GMGGIGKTTL + VYE++ I +HF
Sbjct  21   SSEPKNVMVGCDDEFETIGHKLISHS-KKLEVISIVGMGGIGKTTLVQRVYENTSIVSHF  79

Query  776  DVRAW  790
            DVRAW
Sbjct  80   DVRAW  84



>ref|XP_009603166.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=913

 Score = 67.0 bits (162),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 5/115 (4%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+E I++IKEEL K +   E    +  +  L     L   H S  +  M+G 
Sbjct  102  RLLKILQRAVEAIDSIKEELFKQR---ENNNMQAGNSSLGGSNSLG-SHVSTLENNMVGY  157

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             DE   + + LT    ++ +VI+I GMGGIGK+T A+ V+ D  +   FDVR WI
Sbjct  158  NDEQASMLRQLTGDS-RQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWI  211


 Score = 30.8 bits (68),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 12/83 (14%)
 Frame = +1

Query  91   ACVAVASLLRTIELEFLQYHPRPLVQYN-HLIPFNKELIQSFHQKLGFLISQHDEERIDG  267
            A  A+ SL+ TI L         + Q N  L+  +KE ++  ++K+  L+   D    D 
Sbjct  3    AYAALTSLMGTIHL---------ISQSNLDLLDGHKEHLKLLYEKVSSLLEFLDTNSDD-  52

Query  268  VEAVKRLETKLRDLAYRVEDEIE  336
             E +K L+ K++DLA+ VED++E
Sbjct  53   -EPMKDLQEKVKDLAHEVEDKVE  74



>ref|XP_009762700.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana sylvestris]
Length=890

 Score = 64.7 bits (156),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 63/115 (55%), Gaps = 5/115 (4%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+E I++IKEEL K +  +  +   ++       +     H S  +  M+G 
Sbjct  92   RLLKILQRAIEAIDSIKEELFKQRENNNMQAGNSSLGGSNSPE----SHVSTLENNMVGY  147

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             DE   + + LT    ++ +VI+I GMGGIGK+T A+ V+ D  +   FDVR W+
Sbjct  148  NDEQASMLRQLTGDS-RQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWV  201


 Score = 32.7 bits (73),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +1

Query  193  KELIQSFHQKLGFLISQHDEERIDGVEAVKRLETKLRDLAYRVEDEIE  336
            KE ++  ++K+G L+   D    DG  ++K L+ K++DLA+ VED++E
Sbjct  19   KEHLKLLYEKVGSLLEFLDTNSDDG--SMKDLQEKVKDLAHEVEDKVE  64



>ref|XP_009802397.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
 ref|XP_009802398.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=898

 Score = 55.5 bits (132),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 8/119 (7%)
 Frame = +2

Query  443  CVKLHQVFQSAMEEIEAIKEELVKIKNID-EAEGRKTAHDVLQRFQVLSIQHASHSKEQM  619
            C KL ++ Q A +EI++ KEEL+K +N + + E   T+     R        AS  +  M
Sbjct  92   CAKLAKISQQATQEIDSFKEELIKQENNNLQGESSSTSGSSSPRLD------ASILENDM  145

Query  620  IGKKDEF-EIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             G   E   ++++L    G  +++V ++ GM GIGK+T A+ ++    I   F +R WI
Sbjct  146  EGYNVERGSMVQQLTRRSGSDQREVFSVVGMPGIGKSTFAKTIFLHPSIRRVFHIRGWI  204


 Score = 41.6 bits (96),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 10/93 (11%)
 Frame = +1

Query  91   ACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERIDGV  270
            A  A+ SLL TI+ + LQ +   L Q NH     K  ++S  +K G L  Q     +DG 
Sbjct  3    AYAALTSLLGTID-QLLQSNLSGL-QENH-----KRHLKSLKEKFGSL--QASFGNVDG-  52

Query  271  EAVKRLETKLRDLAYRVEDEIEILVAHLYHEDE  369
            E  K ++ +++D+A   EDE+E LV  L  +DE
Sbjct  53   EPTKEMQARIKDVARDTEDEVESLVKQLMEQDE  85



>ref|XP_009615718.1| PREDICTED: putative late blight resistance protein homolog R1B-12, 
partial [Nicotiana tomentosiformis]
Length=469

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 66/121 (55%), Gaps = 10/121 (8%)
 Frame = +2

Query  434  EPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKE  613
            E +C +L    Q A E I++   +L +        G +    ++Q F +   +H+     
Sbjct  269  EEFCKRL----QKASESIDSNSRKLTE----SMKSGLQATSSLVQSFDL--PEHSPQLGN  318

Query  614  QMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             M+G ++E E +K  L +    E++ +AITGMGGIGKTT AR +Y+D  I +HFD+ AW+
Sbjct  319  NMVGHENELEDVKCKLMKISSDERETMAITGMGGIGKTTFARKIYDDPEIKSHFDILAWV  378

Query  794  V  796
             
Sbjct  379  T  379



>ref|XP_011090484.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=757

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = +2

Query  356  IMKMRDLADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEA  535
            I  ++D+  F L   +    T  D    + ++    F+  ++E ++I E L KIK+  E 
Sbjct  91   ISSLQDMFSFALYPRQTFDYTHQD----FDLEFRGCFEKVIDEFDSILEALSKIKDGREE  146

Query  536  EGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGG  715
            E  +T +         S    +  K + +G   +   +K+ LT    K   +I+I GMGG
Sbjct  147  EASRTRNSSFAS----SSTFVAGVKREPVGLDQDLMCMKEWLTASLSK-LDIISIVGMGG  201

Query  716  IGKTTLARXVYEDSPISTHFDVRAWIV  796
            IGKTTLAR +Y DS I  +FD+RAW+V
Sbjct  202  IGKTTLARNLYSDSLIEYYFDIRAWVV  228



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score = 58.9 bits (141),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 58/114 (51%), Gaps = 2/114 (2%)
 Frame = +2

Query  449   KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
             KL +  Q   ++I+ ++EE  KI+    ++    +  +L+      I         M+G+
Sbjct  1076  KLRESLQRVAKDIDRVQEESQKIQQHKGSQASTLS--LLRDTSSSEILPNLDVSNNMVGR  1133

Query  629   KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
               E + + + L      E KVI I GMGGIGKTTLA+ V+    I + FDVRAW
Sbjct  1134  DKEKKRMLEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIKSRFDVRAW  1187


 Score = 37.7 bits (86),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 58/114 (51%), Gaps = 14/114 (12%)
 Frame = +1

Query  88    MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLIS--QHDEERI  261
             MA  ++ASL+RT+EL      P   + ++H     +E I   H+K+  + +  ++ E++I
Sbjct  976   MAYASIASLIRTMELLLTSDSPMLSLTFDH-----REEIIELHKKVSSIEAFLKNSEKQI  1030

Query  262   DGVEAVKRLETKLRDLAYRVEDEIEI-LVAHLYHEDEGFSRFRFEKGKTTEGHR  420
                 A+  LE +++  A  VED+IE  L   +  EDE       ++GK  E  R
Sbjct  1031  HNHMAMTELEARIKGFANVVEDKIEFGLREAMIAEDE------MQRGKAHEKLR  1078


 Score = 72.8 bits (177),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 52/142 (37%), Positives = 73/142 (51%), Gaps = 18/142 (13%)
 Frame = +2

Query  374  LADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTA  553
            L D ++ K + Q+       E  C  L QV     EEI+ +++E  KI+          A
Sbjct  177  LTDIIMAKNEMQKKKA---REMLCDSLKQV----AEEIDRVQKESTKIQ--------YKA  221

Query  554  HDVLQRFQVLSIQHAS---HSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGK  724
               L+ + V +   A    + K  M+G++DE E +   LT       KVI I GMGGIGK
Sbjct  222  KQSLEEYFVQASSSAKVILNGKNNMVGRRDEREKMMTELTRGFSGVLKVIPIVGMGGIGK  281

Query  725  TTLARXVYEDSPISTHFDVRAW  790
            TTLA+ V+ D+ I +HFDVRAW
Sbjct  282  TTLAKEVFNDAFIRSHFDVRAW  303


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 58/114 (51%), Gaps = 2/114 (2%)
 Frame = +2

Query  449   KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
             KL +  Q   ++I+ ++EE  KI+    ++    +  +L+      I         M+G+
Sbjct  1880  KLRESLQRVAKDIDRVQEESQKIQQHKGSQASTLS--LLRDTSSSEILPNLDVSNNMVGR  1937

Query  629   KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
               E + + + L      E KVI I GMGGIGKTTLA+ V+    I + FDVRAW
Sbjct  1938  DKEKKRMLEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIKSRFDVRAW  1991



>gb|ACE79493.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 12/84 (14%)
 Frame = +2

Query  539  GRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGI  718
            G  +A DVL            + K+ M+G+ D+ + + + LT     E KVI I GMGGI
Sbjct  15   GSSSAKDVL------------NVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGI  62

Query  719  GKTTLARXVYEDSPISTHFDVRAW  790
            GKTTLA+ VY D  I +HFDVRAW
Sbjct  63   GKTTLAKEVYNDVSIRSHFDVRAW  86



>ref|XP_009773240.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana sylvestris]
Length=675

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 64/115 (56%), Gaps = 5/115 (4%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            K+  + +   E+I++ ++   K+ ++         + V+Q F +    H+      M+G 
Sbjct  26   KIESLHRKVKEQIQSFRQ---KVGSLQALLYSLITNSVVQNFDL--PHHSVQLDNNMVGH  80

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            ++E E +K  L E    E +V+AI GMGGIGKTT AR +Y+D  I +HFD+ AW+
Sbjct  81   ENELEDMKSTLMETSSDETQVVAIVGMGGIGKTTFARRIYDDLEIKSHFDILAWV  135



>gb|ACE79495.1| NBS-coding resistance gene analog [Nicotiana sylvestris]
Length=249

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 12/84 (14%)
 Frame = +2

Query  539  GRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGI  718
            G  +A DVL            + K+ M+G+ D+ + + + LT     E KVI I GMGGI
Sbjct  14   GSSSAKDVL------------NVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGI  61

Query  719  GKTTLARXVYEDSPISTHFDVRAW  790
            GKTTLA+ VY D  I +HFDVRAW
Sbjct  62   GKTTLAKEVYNDVSIRSHFDVRAW  85



>gb|ACE79489.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=254

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 12/84 (14%)
 Frame = +2

Query  539  GRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGI  718
            G  +A DVL            + K+ M+G+ D+ + + + LT     E KVI I GMGGI
Sbjct  18   GSSSAKDVL------------NVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGI  65

Query  719  GKTTLARXVYEDSPISTHFDVRAW  790
            GKTTLA+ VY D  I +HFDVRAW
Sbjct  66   GKTTLAKEVYNDVSIRSHFDVRAW  89



>gb|ACE79487.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79494.1| NBS-coding resistance gene analog, partial [Nicotiana tabacum]
Length=256

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 12/84 (14%)
 Frame = +2

Query  539  GRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGI  718
            G  +A DVL            + K+ M+G+ D+ + + + LT     E KVI I GMGGI
Sbjct  18   GSSSAKDVL------------NVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGI  65

Query  719  GKTTLARXVYEDSPISTHFDVRAW  790
            GKTTLA+ VY D  I +HFDVRAW
Sbjct  66   GKTTLAKEVYNDVSIRSHFDVRAW  89



>gb|ACE79491.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=257

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 12/84 (14%)
 Frame = +2

Query  539  GRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGI  718
            G  +A DVL            + K+ M+G+ D+ + + + LT     E KVI I GMGGI
Sbjct  19   GSSSAKDVL------------NVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGI  66

Query  719  GKTTLARXVYEDSPISTHFDVRAW  790
            GKTTLA+ VY D  I +HFDVRAW
Sbjct  67   GKTTLAKEVYNDVSIRSHFDVRAW  90



>gb|ACE79492.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=250

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 12/84 (14%)
 Frame = +2

Query  539  GRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGI  718
            G  +A DVL            + K+ M+G+ D+ + + + LT     E KVI I GMGGI
Sbjct  15   GSSSAKDVL------------NVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGI  62

Query  719  GKTTLARXVYEDSPISTHFDVRAW  790
            GKTTLA+ VY D  I +HFDVRAW
Sbjct  63   GKTTLAKEVYNDVSIRSHFDVRAW  86



>gb|ACE79488.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=255

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 12/84 (14%)
 Frame = +2

Query  539  GRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGI  718
            G  +A DVL            + K+ M+G+ D+ + + + LT     E KVI I GMGGI
Sbjct  18   GSSSAKDVL------------NVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGI  65

Query  719  GKTTLARXVYEDSPISTHFDVRAW  790
            GKTTLA+ VY D  I +HFDVRAW
Sbjct  66   GKTTLAKEVYNDVSIRSHFDVRAW  89



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 51/150 (34%), Positives = 81/150 (54%), Gaps = 18/150 (12%)
 Frame = +2

Query  347  HTFIMKMRDLADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNI  526
            HT  +++ + A   ++  K Q++ + DE       L    Q A   I+ +++E  KI++ 
Sbjct  76   HTIQLRLTEAA---MENNKIQKE-KADEV------LCDSLQQAANNIDRLQKESTKIQDK  125

Query  527  DEAEGRKTA--HDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAI  700
             +    K++   D      +L++      K+ M+G+ DE + + + LT     E KVI I
Sbjct  126  GKLASNKSSLVQDSSSTKDILNV------KKNMMGRDDERKRLLEDLTRGFSSECKVIPI  179

Query  701  TGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            TGMGGIGKTTLA+ V+ D  I +HFDVRAW
Sbjct  180  TGMGGIGKTTLAKDVFNDVSIRSHFDVRAW  209



>ref|XP_009773239.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=908

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 11/132 (8%)
 Frame = +2

Query  401  KPQRDTEGDEA-EPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQ  577
            K Q +    EA E +C +L    Q A E I++   +L +        G +    ++Q F 
Sbjct  96   KAQNEKVSREAYEEFCKRL----QKASESIDSNSRKLTE----SMKSGLQATSSLIQSFD  147

Query  578  VLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDS  757
            +   +H+      M+G ++E E +K  L +    E++ +AITGMGGIGKTT AR +Y+D 
Sbjct  148  L--PEHSPQLGNSMVGHENELEDVKCKLMKISSDERETMAITGMGGIGKTTFARKIYDDP  205

Query  758  PISTHFDVRAWI  793
             I +HFD+ AW+
Sbjct  206  EIKSHFDILAWV  217



>gb|ACE79490.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 12/84 (14%)
 Frame = +2

Query  539  GRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGI  718
            G  +A DVL            + K+ M+G+ D+ + + + LT     E KVI I GMGGI
Sbjct  18   GSSSAKDVL------------NVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGI  65

Query  719  GKTTLARXVYEDSPISTHFDVRAW  790
            GKTTLA+ VY D  I +HFDVRAW
Sbjct  66   GKTTLAKEVYNDVSIRSHFDVRAW  89



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score = 63.2 bits (152),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 59/113 (52%), Gaps = 12/113 (11%)
 Frame = +2

Query  488  EAIKEELVKI-KNID--EAEGRKTAHDVLQRFQVLSIQHASHSKE---------QMIGKK  631
            E ++E L ++ K+ID  + E +K  H    +   LS+   + S E          M+G+ 
Sbjct  100  EELRESLQRVAKDIDCVQKESKKIQHHKGNQASTLSLLRDTSSSEMLPNLDVSNNMVGRD  159

Query  632  DEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             E E + + L      E KVI I GMGGIGKTTLA+ V+    I + FDVRAW
Sbjct  160  KEKERMLEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIQSRFDVRAW  212


 Score = 32.0 bits (71),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 57/111 (51%), Gaps = 14/111 (13%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLIS--QHDEERI  261
            MA  ++ASL+RT+EL      P   + ++      +E+I+  H+K+  + +  ++ E++I
Sbjct  1    MAYASIASLIRTMELLLTSDSPMLSLTFD----LREEIIE-LHKKVSSIEAFLKNSEKQI  55

Query  262  DGVEAVKRLETKLRDLAYRVEDEIEI-LVAHLYHEDEGFSRFRFEKGKTTE  411
                A+  LE +++  A   ED+IE  L   +  EDE       ++GK  E
Sbjct  56   HNHMAMTELEARIKGFANVAEDKIEFGLREAMITEDE------MQRGKAHE  100



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009760414.1| PREDICTED: disease susceptibility protein LOV1-like [Nicotiana 
sylvestris]
Length=223

 Score = 67.8 bits (164),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 67/115 (58%), Gaps = 8/115 (7%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKN-IDEAEGRKTAHDVLQRFQVLSI-QHASHSKEQMI  622
            KL    + A+E I++I ++ + I++     +G K      Q+F + SI + A   +  M+
Sbjct  91   KLCCCLEQAIECIDSIMKQWMAIRDWYTNIKGLKA-----QKFSLASIPERAVEPENIMV  145

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            G + EFE+++  L   G  E +V++I GMGGIGKTTLA  +Y D  I +HFD+R 
Sbjct  146  GHESEFEMMQDQLA-RGSSELEVVSIIGMGGIGKTTLANKLYTDPFIMSHFDIRG  199


 Score = 26.9 bits (58),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 22/85 (26%), Positives = 40/85 (47%), Gaps = 17/85 (20%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFL--ISQHDEERI  261
            MA  A+ S + TI             Q   L   N   +QSF++KL  L  I +      
Sbjct  1    MAYAAITSFMSTIN------------QSMQLTGCN---LQSFYEKLESLRSIMEKPCNIT  45

Query  262  DGVEAVKRLETKLRDLAYRVEDEIE  336
            + +EA+  LE +++++ +  ED+++
Sbjct  46   EDIEALTSLEAEIKEVVFNAEDKVD  70



>gb|EYU28481.1| hypothetical protein MIMGU_mgv1a018543mg [Erythranthe guttata]
Length=940

 Score = 57.8 bits (138),  Expect(2) = 7e-11, Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 62/112 (55%), Gaps = 8/112 (7%)
 Frame = +2

Query  464  FQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQ-HASHSKEQMIGKKDEF  640
             +  +E++++IK+++++ ++    E     HD+       S     +  K  M+G  ++ 
Sbjct  138  LEKVIEDMDSIKKKVMEFRD----ESGSNEHDMQPTSTTSSSTPRITTDKNTMVGFDEQL  193

Query  641  -EIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              ++ KL  +     +++I I GMGGIGKTTLA+  YE S I+ HFD+R W+
Sbjct  194  ISLLDKLTGQR--SNRQIIPIVGMGGIGKTTLAKNAYEHSLIAHHFDIRTWV  243


 Score = 36.6 bits (83),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 21/112 (19%)
 Frame = +1

Query  94   CVAVASLLRTIEL-EFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERIDGV  270
            C A A+L+  + + + +Q HPR        I F+K  I+S  +K+GFL+    E    GV
Sbjct  13   CFAYAALVSVLTIIDQIQNHPR------FSISFDKNQIESLGEKVGFLL-DFIETDTHGV  65

Query  271  --EAVKRLETKLRDLAYRVEDEIEILVAHLYHEDEGFSRFRFEKGKTTEGHR  420
              E  + LE ++   AY  ED IE   +H+  +         +   + EGHR
Sbjct  66   IIEHARVLERRIASAAYAAEDVIE---SHVVDQ--------IQAAGSVEGHR  106



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 23/156 (15%)
 Frame = +2

Query  353  FIMKMRDLADFVLKKEKPQRDTEGDEA----------EPYCVKLHQVFQSAMEEIEAIKE  502
            F   ++++ADFV +     R TE  EA          E  C  L QV Q    EI+ +++
Sbjct  63   FEAHIKEVADFV-ELTIQLRLTESLEAYDEMQKEKAHERLCDSLQQVAQ----EIDRVQK  117

Query  503  ELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKE  682
            E  KIK  D+ +       ++Q   + ++++       M+G+ DE + + + LT     E
Sbjct  118  ESTKIK--DKGKQASNKPSLVQDSSLANVEN------NMLGRDDERKRLLEDLTRGFSGE  169

Query  683  KKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             KVI I GMGGIGKTTLA+ V++D  I +HFDVR+W
Sbjct  170  PKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSW  205



>ref|XP_009612031.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009612039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=872

 Score = 59.3 bits (142),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 7/110 (6%)
 Frame = +2

Query  467  QSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFE-  643
            Q A +EI+ +K +L+K K     +   ++ D     +     HAS  ++ M+G+  E + 
Sbjct  99   QQATQEIDYVKAQLIKQKENKNLQAGNSSTDGSSSLR----PHASILEDDMVGRTIERDR  154

Query  644  IIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            II KL       E  VI++ GM GIGK+TLA+ +++D+ I  +F +R WI
Sbjct  155  IINKLKRRSNKLE--VISVVGMAGIGKSTLAKDIFQDTFIKQYFHIRKWI  202


 Score = 34.3 bits (77),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 3/60 (5%)
 Frame = +1

Query  190  NKELIQSFHQKLGFLISQHDEERIDGVEAVKRLETKLRDLAYRVEDEIEILVAHLYHEDE  369
            +K+ ++  ++K G L  Q   E IDG E    L+ K++ +AY  EDE+E L      ++E
Sbjct  28   HKQHLKLLYEKFGSL--QESLENIDG-EPTTDLQVKVKGVAYEAEDEVESLAKQFAEKNE  84



>ref|XP_011072557.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=891

 Score = 62.4 bits (150),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 12/119 (10%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHS----KEQM  619
             +Q  Q+ + E++ IK+E+++IK        +   D L R  + +   +S +    K+ M
Sbjct  103  FYQDLQNEIAEMDLIKKEVIEIKG-----KMRLIQDQLHRDSLAAGSLSSSTSMVQKQAM  157

Query  620  IGKKDEF-EIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            +G  D   EI+ KL  +H     ++I I GMGGIGKTTLAR V ++  I  +FD+RAW+
Sbjct  158  VGIDDVLIEIMDKLTGQH--SSSRIIPIVGMGGIGKTTLARNVCQNPLIVQYFDIRAWV  214


 Score = 30.8 bits (68),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 45/98 (46%), Gaps = 21/98 (21%)
 Frame = +1

Query  91   ACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLIS-------QHD  249
            A  A+ SL+ TIE   +Q+HPRP V        ++  +QS  +K+ FL         +  
Sbjct  4    AYAALVSLVHTIEQ--IQHHPRPPVS------LDENQVQSLQEKVAFLQDFLEDYSHRLS  55

Query  250  EERIDGVEAVKRLETKLRDLAYRVEDEIEILVAHLYHE  363
            +E  DG      L  ++ D A+  ED IE  +    H+
Sbjct  56   QEHGDG------LMVRIADAAHAAEDVIESRIVDQIHD  87



>ref|XP_009779880.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=862

 Score = 68.6 bits (166),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+++I+++ +EL+K++  +   G  +           S  HAS  + +M+G 
Sbjct  48   RLLKILQRAIKDIDSVNKELMKLRENNMRPGNCSLGA-----STSSQSHASTLENEMVGY  102

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWIV  796
              E E+I   L  H   + +VI+I GMGGIGK+T A+ ++ D  I + FDVR WIV
Sbjct  103  NIEQELILGQLRGHS-SQLEVISIFGMGGIGKSTFAKRIFSDPSIVSFFDVRGWIV  157


 Score = 25.0 bits (53),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +1

Query  277  VKRLETKLRDLAYRVEDEIE  336
            +K L  K++D+A++VEDE+E
Sbjct  1    MKDLLKKVKDVAHKVEDEVE  20



>ref|XP_009631206.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=905

 Score = 62.8 bits (151),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 38/116 (33%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L  + Q A+++I+++  EL+K++     E    A +        S  +AS  +++++G 
Sbjct  103  RLLMILQRAIKDIDSVNRELLKLR-----ENNMRAGNCSLGASTSSQSNASTLEKEIVGY  157

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWIV  796
              E E++   L  H   + +VI+I GMGGIGK+T A+ ++ D  I + FD+RAWIV
Sbjct  158  NIEQELMLGQLRGHS-SQLEVISIFGMGGIGKSTFAKRIFFDPSILSFFDIRAWIV  212


 Score = 30.4 bits (67),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 12/85 (14%)
 Frame = +1

Query  88   MACV--AVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERI  261
            MA V  AV SL+ TI+L          +Q +H     KE ++  + K+G ++   D    
Sbjct  1    MATVYAAVTSLMGTIQL---ISQSTSDLQEDH-----KEHLKLLYDKVGSMLEFLDTNSD  52

Query  262  DGVEAVKRLETKLRDLAYRVEDEIE  336
            D  E +K L   ++D+A++VEDE+E
Sbjct  53   D--EPMKDLLKNVKDVAHKVEDEVE  75



>ref|XP_009777083.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=868

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 6/124 (5%)
 Frame = +2

Query  422  GDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHAS  601
            GD+ E  C   ++  Q   +E++++K+E+++I+      G K+A   L      S ++AS
Sbjct  92   GDDRERACKAFNEELQEVEKEVDSLKKEVMQIEF--NKRGSKSAE--LATTSSSSRRYAS  147

Query  602  HSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDV  781
              +  ++G +D+F  I   LT     E  VI + GMGGIGKTTLAR  Y+DS I   FD+
Sbjct  148  E-QNTVVGMEDDFNAILDRLTAQ-THELTVIPVVGMGGIGKTTLARKAYDDSSIRYRFDI  205

Query  782  RAWI  793
             +W+
Sbjct  206  HSWV  209



>ref|XP_009769811.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=147

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            ++E+ +G +D+ + I KLLT  G +E+ V++I GM G+GKTTLA+ +++DS + +HFDVR
Sbjct  20   TEEEPVGLEDDADKIIKLLT-RGIRERDVVSIFGMPGLGKTTLAKKIFKDSSVVSHFDVR  78

Query  785  AWI  793
            AW+
Sbjct  79   AWV  81



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 14/115 (12%)
 Frame = +2

Query  464  FQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHS----KEQMIGKK  631
             Q A+EE+E IK+E+ KIK      G K +     + QVL  +H S S    +++ +G +
Sbjct  105  LQVAIEEMEFIKKEVTKIK------GDKISTLKFHK-QVLPARHISTSSPDVQQKPVGFQ  157

Query  632  DEFE-IIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            ++ E II +L    GP E  +I I GM GIGKTTLA+  Y D  +   FDVRAW+
Sbjct  158  EDLEKIIDRL--RGGPSELDIICIVGMAGIGKTTLAKRAYNDISVVNRFDVRAWV  210



>ref|XP_009777085.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=547

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 6/124 (5%)
 Frame = +2

Query  422  GDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHAS  601
            GD+ E  C   ++  Q   +E++++K+E+++I+      G K+A   L      S ++AS
Sbjct  92   GDDRERACKAFNEELQEVEKEVDSLKKEVMQIEF--NKRGSKSAE--LATTSSSSRRYAS  147

Query  602  HSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDV  781
              +  ++G +D+F  I   LT     E  VI + GMGGIGKTTLAR  Y+DS I   FD+
Sbjct  148  E-QNTVVGMEDDFNAILDRLTAQT-HELTVIPVVGMGGIGKTTLARKAYDDSSIRYRFDI  205

Query  782  RAWI  793
             +W+
Sbjct  206  HSWV  209



>ref|XP_009777084.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=838

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 6/124 (5%)
 Frame = +2

Query  422  GDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHAS  601
            GD+ E  C   ++  Q   +E++++K+E+++I+      G K+A   L      S ++AS
Sbjct  92   GDDRERACKAFNEELQEVEKEVDSLKKEVMQIEF--NKRGSKSAE--LATTSSSSRRYAS  147

Query  602  HSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDV  781
              +  ++G +D+F  I   LT     E  VI + GMGGIGKTTLAR  Y+DS I   FD+
Sbjct  148  E-QNTVVGMEDDFNAILDRLTAQ-THELTVIPVVGMGGIGKTTLARKAYDDSSIRYRFDI  205

Query  782  RAWI  793
             +W+
Sbjct  206  HSWV  209



>gb|ACF22006.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=186

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +2

Query  590  QHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPIST  769
            +H    +++M+G ++EFE+++  L   G +E +V++I GMGGIGKTTLA  +Y D  I +
Sbjct  3    RHGLEPEDKMVGLENEFEMMQDQLA-RGARELEVVSIVGMGGIGKTTLANKIYSDPFIMS  61

Query  770  HFDVRA  787
            HFD+RA
Sbjct  62   HFDIRA  67



>gb|ACE79413.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    + +MIG ++EFE+++  L+  G +E +V
Sbjct  6    KLKNIQDLKAQNLSL-------VSTSRHGVGPQSKMIGLENEFEMMQDQLS-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            +++ GMGGIGKTTLA  +Y D  I +HFD+RA
Sbjct  58   VSVVGMGGIGKTTLANKLYSDPFIMSHFDIRA  89



>ref|XP_009606269.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=312

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +2

Query  614  QMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             M+G+ D+ + + + LT+    E KVI I GMGGIGKTTLAR VY D+ I  HFDVR W
Sbjct  126  NMVGRDDQRKKLLEDLTKGFTSESKVIPIVGMGGIGKTTLAREVYNDASIRLHFDVREW  184



>gb|ACE79400.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V   +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQNLSL-------VSPSRHGLEPEDKMVGLENEFEMMQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  I +HFD+RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFIMSHFDIRA  89



>ref|XP_006361239.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
Length=992

 Score = 59.7 bits (143),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 15/129 (12%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAE-------GRKTAHDVLQRFQVLSIQHAS--  601
            +L  + + A+E+I+++KEEL K +  ++ +       G  +   ++   +   + H+   
Sbjct  183  RLLIILKQAIEDIDSVKEELSKPRKNNKLQAGNGSVGGTCSPRSLVSTLENDMVGHSDEQ  242

Query  602  ----HSKEQ-MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPIS  766
                HS EQ M+G  DE E ++  LT     + +VI+ITGMGGIGK+T A+ ++ D  I 
Sbjct  243  DMVGHSDEQDMVGHSDEQERVRGELTGDS-SQLEVISITGMGGIGKSTFAKKMFSDPSIV  301

Query  767  THFDVRAWI  793
              F+V  WI
Sbjct  302  GFFNVCGWI  310


 Score = 32.0 bits (71),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 35/66 (53%), Gaps = 7/66 (11%)
 Frame = +1

Query  190  NKELIQSFHQKLGFLISQHDEERIDGVEAVKRLETKLRDLAYRVEDEIEILVAHLYHEDE  369
            NK+ ++S + K G L+     E +D  +    L+ K++DLA  VEDE++  V  +  + E
Sbjct  99   NKKHLKSLYDKFGSLL-----EILDNSD--NELQKKVKDLANEVEDEVKPQVVRIMEKKE  151

Query  370  GFSRFR  387
               R R
Sbjct  152  ANERLR  157



>ref|XP_009592156.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=888

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            ++E+ +G +DE + I KLLT  G +E+ +++I GM G+GKTTLAR +++DS I +HFDVR
Sbjct  20   TEEEPVGLEDEADKIIKLLT-RGIRERDIVSIFGMPGLGKTTLARKIFKDSSIVSHFDVR  78

Query  785  AWI  793
            AW+
Sbjct  79   AWL  81



>gb|ACE79448.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V   +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQNLSL-------VSPSRHGLEPEDKMVGLENEFEMMQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  I +HFD+RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFIMSHFDIRA  89



>ref|XP_009780985.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=881

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            ++E+ +G +D+ E I KLLT  G +E+ +++I GM G+GKTTLA+ +++DS I +HFDVR
Sbjct  17   TEEEPLGLEDDAEKIIKLLT-RGIRERDIVSIFGMPGLGKTTLAKKIFKDSSIVSHFDVR  75

Query  785  AWIV  796
            AW++
Sbjct  76   AWVI  79



>gb|ACE79429.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF22013.1| NBS-coding resistance gene protein, partial [Nicotiana tabacum]
 gb|ACF22015.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V   +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQNLSL-------VSPSRHGLEPEDKMVGLENEFEMMQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  I +HFD+RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFIMSHFDIRA  89



>gb|ACE79449.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V   +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQNLSL-------VSPSRHGLEPEDKMVGLENEFEMMQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  I +HFD+RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFIMSHFDIRA  89



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 12/114 (11%)
 Frame = +2

Query  464  FQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHS----KEQMIGKK  631
             Q A+EE+E IK+E++KIK      G K +  +  R +V   +H S S    +++ +G +
Sbjct  105  LQVAIEEMEFIKKEVMKIK------GEKIS-TLKFRSKVSPARHVSTSSPNVQQKPVGFQ  157

Query  632  DEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            D+ E I   L    P E  +I I GM GIGKTTLA+  Y D  +   FDVRAWI
Sbjct  158  DDLEKIIDRLNGR-PSELDIITIVGMAGIGKTTLAKRAYNDPSVVNRFDVRAWI  210



>ref|XP_009780928.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009780934.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=935

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 68/115 (59%), Gaps = 8/115 (7%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKN-IDEAEGRKTAHDVLQRFQVLSI-QHASHSKEQMI  622
            KL    + A+E I++I ++ + I++     +G K      Q+F + SI + A   +  M+
Sbjct  92   KLCCCLEKAVERIDSIMKQWMAIRDWYTNIKGLKA-----QKFSLASIPERAVEPENIMV  146

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            G + EFE+++  L   G  E +V++ITGMGGIGKTTLA  +Y D  I + FD+RA
Sbjct  147  GHESEFEMMQDRLAR-GSSELEVVSITGMGGIGKTTLANKLYSDPFIMSRFDIRA  200



>ref|XP_009786584.1| PREDICTED: disease resistance RPP13-like protein 4 [Nicotiana 
sylvestris]
Length=219

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 66/122 (54%), Gaps = 11/122 (9%)
 Frame = +2

Query  434  EPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKE  613
            E  C   ++  Q   +E++++++EL++I+ I+   G K A          S     ++ E
Sbjct  77   EQACKSFNEELQKVQKEVDSLRKELMEIEFIEH--GSKFAE------ASTSTSSKRYATE  128

Query  614  Q--MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            Q  ++G KD+F+ I   LT     E  VI + GMGGIGKTTLAR VY+DS I   F   A
Sbjct  129  QHTVVGMKDDFDTILDRLTAQ-TDELTVIPVVGMGGIGKTTLARKVYDDSTIRYRFGKHA  187

Query  788  WI  793
            W+
Sbjct  188  WV  189



>ref|XP_010040374.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Eucalyptus 
grandis]
Length=448

 Score = 61.2 bits (147),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 66/127 (52%), Gaps = 11/127 (9%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKNI---DEAEGRKTAHDVLQRFQVLSIQHASHS  607
            P    L    +S MEE++   + ++  KNI    E  G ++A+  + +     +   +  
Sbjct  117  PRAFMLDHTMRSKMEEMDNRLKGIINQKNIMQLRENNGNQSANRQMDK----PLPTTNLP  172

Query  608  KEQMIGKKDEFEIIKKLLT----EHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHF  775
            +   + ++DE   I +LLT    +    + KVI I GMGG+GKT LA+ VY D  ++ +F
Sbjct  173  EPCFVSREDEKMDILELLTKEENDGACVDPKVIPIVGMGGLGKTALAQQVYHDDRVANYF  232

Query  776  DVRAWIV  796
            DV+AW+ 
Sbjct  233  DVKAWVC  239


 Score = 29.6 bits (65),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +1

Query  193  KELIQSFHQKLGFLISQHDEERIDGVEAVKRLETKLRDLAYRVEDEIE  336
            KE++ S  Q    ++   ++++++GV  V      LRDLAY +ED +E
Sbjct  41   KEMLVSISQ----VLDDAEDKQLNGVLEVNSWLKNLRDLAYDIEDLLE  84



>ref|XP_009794810.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=345

 Score = 65.5 bits (158),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 64/115 (56%), Gaps = 11/115 (10%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+++I+++KE  +K +  + + G  ++             H S  +  M+G 
Sbjct  78   RLLKIMQQAIKDIDSVKEWFIKQRENNISAGASSSAQY----------HVSTIENDMVGY  127

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              E E+++  L  H   + +VI+I GMGGIGK+T A+ ++ D  I + FDVR WI
Sbjct  128  NIEQELMRDQLRGHS-SQLEVISIVGMGGIGKSTFAKKMFSDPSIMSFFDVRGWI  181


 Score = 25.4 bits (54),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +1

Query  271  EAVKRLETKLRDLAYRVEDEIE  336
            E  K L+ K++DLA  VED++E
Sbjct  29   EPTKDLQEKVKDLAQEVEDKVE  50



>ref|XP_011101277.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101278.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101279.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101280.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101281.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=879

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  614  QMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            +M+G +DE   +K LL +  P E+KV+ + GM GIGKT LAR VYED  IS+ F+ R W+
Sbjct  149  KMVGLEDEISEMKNLLIQQLPSERKVVVLAGMPGIGKTALARQVYEDPSISSIFECRLWV  208



>ref|XP_010659191.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis 
vinifera]
Length=1376

 Score = 63.9 bits (154),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 14/127 (11%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKN----IDEAEGRKTAHDVLQRFQVLSIQHASH  604
            P  +K +   +S +E I A  E +   KN     ++  G+++A    +  ++L     S 
Sbjct  117  PSAIKFNDEMRSKIENITARLEHISSRKNNLLSTEKNSGKRSA----KPREILPT--TSL  170

Query  605  SKEQMI-GKKDE-FEIIKKLLTEHGPKEK--KVIAITGMGGIGKTTLARXVYEDSPISTH  772
              E ++ G++ E   I+  LL  HGP +   +VIAITGM G+GKTTLA+  Y    + +H
Sbjct  171  VDEPIVYGRETEKAAIVDSLLHYHGPSDDSVRVIAITGMAGVGKTTLAQFAYNHYKVKSH  230

Query  773  FDVRAWI  793
            FD+RAW+
Sbjct  231  FDLRAWV  237


 Score = 26.9 bits (58),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +1

Query  250  EERIDGVEAVKRLETKLRDLAYRVEDEIEILVAH  351
            EE+    +AVK+    LRDLAY VED ++ L   
Sbjct  56   EEKQMEKQAVKKWLDDLRDLAYDVEDILDDLATQ  89



>emb|CAN67336.1| hypothetical protein VITISV_004414 [Vitis vinifera]
Length=1363

 Score = 63.9 bits (154),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 14/127 (11%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKN----IDEAEGRKTAHDVLQRFQVLSIQHASH  604
            P  +K +   +S +E I A  E +   KN     ++  G+++A    +  ++L     S 
Sbjct  117  PSAIKFNDEMRSKIENITARLEHISSRKNNLLSTEKNSGKRSA----KPREILPT--TSL  170

Query  605  SKEQMI-GKKDE-FEIIKKLLTEHGPKEK--KVIAITGMGGIGKTTLARXVYEDSPISTH  772
              E ++ G++ E   I+  LL  HGP +   +VIAITGM G+GKTTLA+  Y    + +H
Sbjct  171  VDEPIVYGRETEKAAIVDSLLHYHGPSDDSVRVIAITGMAGVGKTTLAQFAYNHYKVKSH  230

Query  773  FDVRAWI  793
            FD+RAW+
Sbjct  231  FDLRAWV  237


 Score = 26.9 bits (58),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +1

Query  250  EERIDGVEAVKRLETKLRDLAYRVEDEIEILVAH  351
            EE+    +AVK+    LRDLAY VED ++ L   
Sbjct  56   EEKQMEKQAVKKWLDDLRDLAYDVEDILDDLATQ  89



>ref|XP_009786702.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=928

 Score = 65.1 bits (157),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 65/115 (57%), Gaps = 11/115 (10%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L ++ Q A+++I+++KE  +K +  + + G  ++          +  H S  +  M+G 
Sbjct  149  RLLKIMQQAIKDIDSVKEWFIKQRENNISAGASSS----------AQYHVSTIENDMVGY  198

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              E E+++  L  H   + +VI+I GMGGIGK+T A+ ++ D  I + FDVR WI
Sbjct  199  NIEQELMRDQLRGHS-SQLEVISIVGMGGIGKSTFAKKMFSDPSIMSFFDVRGWI  252


 Score = 25.4 bits (54),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 23/102 (23%)
 Frame = +1

Query  52   QKSCSFRSR-DRRMAC-VAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQ--  219
            ++S   R R  R MA   AV SLL TI                HLI  +   +Q  H+  
Sbjct  36   ERSLKVRPRVAREMAAYAAVTSLLGTI----------------HLISQSSLKLQEGHKEH  79

Query  220  -KLGFLISQHDEERIDGV--EAVKRLETKLRDLAYRVEDEIE  336
             +L +   +  +E +D    E  K L+ K++DLA  VED++E
Sbjct  80   LRLLYKKVRSLQELLDNSDDEPTKDLQEKVKDLAQEVEDKVE  121



>gb|ACF22012.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V   +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQNLSL-------VSPSRHGLEPEDKMVGLENEFEMMQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  + +HFD+RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFVMSHFDIRA  89



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 61.6 bits (148),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 65/117 (56%), Gaps = 14/117 (12%)
 Frame = +2

Query  455  HQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVL--QRFQVL-SIQHASHSKEQMIG  625
            +Q     + EI+++ EEL+          R    D+L  Q   VL S + A   K  M+G
Sbjct  105  YQELDEVLVEIDSLVEELLN--------DRCGLKDLLPRQHLPVLGSSRDARVGKNVMVG  156

Query  626  KKDEFEIIKKLLTEHGPKEK-KVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              ++   +K  LT  G + K +VI ITGMGG+GKTTLAR +Y+DS +  HFD+ AW+
Sbjct  157  FDEDVMELKHRLT--GWESKLQVIPITGMGGVGKTTLARNLYDDSLVKDHFDLCAWV  211


 Score = 28.9 bits (63),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 31/59 (53%), Gaps = 1/59 (2%)
 Frame = +1

Query  193  KELIQSFHQKLGFLISQ-HDEERIDGVEAVKRLETKLRDLAYRVEDEIEILVAHLYHED  366
            K  I S ++K+ FL +   D  +    E V  LE ++RD A  +ED +E  V+   +ED
Sbjct  28   KHYIISIYRKVRFLQTLFEDSPQKSSQEEVDSLEIRIRDSASVIEDLVEFYVSEQVYED  86



>ref|XP_009622812.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=932

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/106 (37%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = +2

Query  470  SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEII  649
            S M++  AI+    K+KNI + + +  +        V   +H    +++M+G ++EFE++
Sbjct  105  STMKKWMAIQN---KLKNIQDLKAQNLS-------LVSPSRHGLEPEDKMVGLENEFEMM  154

Query  650  KKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            +  L   G +E +V++I GMGGIGKTTLA  +Y D  I +HFD+RA
Sbjct  155  QDQLAR-GARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFDIRA  199



>ref|XP_009614996.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009614997.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1313

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVF--QSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQM-I  622
            LH +F    A+E+I  IKEE   + N+ E   +  +  V++      ++  S S EQ+ +
Sbjct  526  LHLIFLLPFAIEKINLIKEE---VSNLLEKIPKNRSLIVVKS-PPKPVESKSSSAEQITV  581

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G K+E   I + LT  GPK   VI+ITGM G GKTTLA  VY D  +S+HFD+RAW
Sbjct  582  GFKEETNWIIRNLTS-GPKMLDVISITGMPGSGKTTLAYKVYSDKSVSSHFDIRAW  636



>ref|XP_009769771.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=771

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +2

Query  590  QHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPIST  769
            Q    ++E+ +G +D+ E I KLLT  G +E+ +++I GM G+GKTTLA+ +++DS I +
Sbjct  12   QSTQVTEEEPVGLEDDAEKIIKLLT-RGIRERDIVSIFGMPGLGKTTLAKKIFKDSSIVS  70

Query  770  HFDVRAWI  793
            HFDVRAW+
Sbjct  71   HFDVRAWL  78



>ref|XP_009614991.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009614992.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1360

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVF--QSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQM-I  622
            LH +F    A+E+I  IKEE   + N+ E   +  +  V++      ++  S S EQ+ +
Sbjct  573  LHLIFLLPFAIEKINLIKEE---VSNLLEKIPKNRSLIVVKS-PPKPVESKSSSAEQITV  628

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G K+E   I + LT  GPK   VI+ITGM G GKTTLA  VY D  +S+HFD+RAW
Sbjct  629  GFKEETNWIIRNLTS-GPKMLDVISITGMPGSGKTTLAYKVYSDKSVSSHFDIRAW  683



>ref|XP_009609961.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Nicotiana 
tomentosiformis]
Length=299

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 64/123 (52%), Gaps = 12/123 (10%)
 Frame = +2

Query  455  HQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI----  622
            HQ     +E+++  K+EL++I + D +     A D L     L  +  + S+  ++    
Sbjct  94   HQDLLPIVEKMDITKKELMEIVS-DFSTSTHDADDNLILESTLDSRIGTSSRSNLMLGNL  152

Query  623  ------GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
                  G  D+ EII K LT   P +  ++ I+GMG IGKTTL R  Y++ PI  HFD+R
Sbjct  153  EDDIVQGLDDDLEIIVKRLT-GPPSDLDIVTISGMGCIGKTTLGRKAYDNLPIRYHFDIR  211

Query  785  AWI  793
             W+
Sbjct  212  VWV  214



>dbj|BAD26260.1| putative disease related protein 2 [Oryza sativa Japonica Group]
 gb|EEE69316.1| hypothetical protein OsJ_28604 [Oryza sativa Japonica Group]
Length=935

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 12/127 (9%)
 Frame = +2

Query  440  YCVKLHQVFQSAMEEIEAIKEELVKIKNI---------DEAEGRKTAHDVLQRFQVLSIQ  592
            +C K    +     ++  IK  L  + N+         D  +G  ++H+ L+  ++ S  
Sbjct  110  HCSKTTSDWHIIATQLSQIKSRLQNLTNMKARYGISANDSEDGSTSSHESLK--ELTSDS  167

Query  593  HASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTH  772
                +++ M+G K+E E + KLL  HG + + VI+I GMGG+GKTTLAR +Y+ + I  +
Sbjct  168  AYFDTEDDMVGNKEESEKVMKLLI-HGEETRTVISICGMGGLGKTTLARAIYKKNEIRKN  226

Query  773  FDVRAWI  793
            FD  +WI
Sbjct  227  FDCFSWI  233



>gb|EAZ08369.1| hypothetical protein OsI_30626 [Oryza sativa Indica Group]
Length=935

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 12/127 (9%)
 Frame = +2

Query  440  YCVKLHQVFQSAMEEIEAIKEELVKIKNI---------DEAEGRKTAHDVLQRFQVLSIQ  592
            +C K    +     ++  IK  L  + N+         D  +G  ++H+ L+  ++ S  
Sbjct  110  HCSKTTSDWHIIATQLSQIKSRLQNLTNMKARYGISANDSEDGSTSSHESLK--ELTSDS  167

Query  593  HASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTH  772
                +++ M+G K+E E + KLL  HG + + VI+I GMGG+GKTTLAR +Y+ + I  +
Sbjct  168  AYFDTEDDMVGNKEESEKVMKLLI-HGEETRTVISICGMGGLGKTTLARAIYKKNEIRKN  226

Query  773  FDVRAWI  793
            FD  +WI
Sbjct  227  FDCFSWI  233



>ref|XP_009614998.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1176

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVF--QSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQM-I  622
            LH +F    A+E+I  IKEE   + N+ E   +  +  V++      ++  S S EQ+ +
Sbjct  389  LHLIFLLPFAIEKINLIKEE---VSNLLEKIPKNRSLIVVKS-PPKPVESKSSSAEQITV  444

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G K+E   I + LT  GPK   VI+ITGM G GKTTLA  VY D  +S+HFD+RAW
Sbjct  445  GFKEETNWIIRNLTS-GPKMLDVISITGMPGSGKTTLAYKVYSDKSVSSHFDIRAW  499



>ref|XP_009614993.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1351

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVF--QSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQM-I  622
            LH +F    A+E+I  IKEE   + N+ E   +  +  V++      ++  S S EQ+ +
Sbjct  564  LHLIFLLPFAIEKINLIKEE---VSNLLEKIPKNRSLIVVKS-PPKPVESKSSSAEQITV  619

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G K+E   I + LT  GPK   VI+ITGM G GKTTLA  VY D  +S+HFD+RAW
Sbjct  620  GFKEETNWIIRNLTS-GPKMLDVISITGMPGSGKTTLAYKVYSDKSVSSHFDIRAW  674



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 39/115 (34%), Positives = 69/115 (60%), Gaps = 6/115 (5%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHS-KEQMIGK  628
            LH++    +E++ ++ E+++KI++  EA+ +K   ++       +   +  S K  ++G 
Sbjct  174  LHKI----IEKVGSVVEKMIKIRDESEADDQKPMRNLSSAGSSPTGDFSVGSGKNVVVGF  229

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            + + E ++  LT    K + +++I GMGGIGKTTLAR  Y+DS I  HFD RAW+
Sbjct  230  ESDLEEMRTRLTGASSK-RDIVSIVGMGGIGKTTLARQAYDDSYIVYHFDTRAWV  283



>ref|XP_009614999.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1167

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVF--QSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQM-I  622
            LH +F    A+E+I  IKEE   + N+ E   +  +  V++      ++  S S EQ+ +
Sbjct  380  LHLIFLLPFAIEKINLIKEE---VSNLLEKIPKNRSLIVVKS-PPKPVESKSSSAEQITV  435

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G K+E   I + LT  GPK   VI+ITGM G GKTTLA  VY D  +S+HFD+RAW
Sbjct  436  GFKEETNWIIRNLTS-GPKMLDVISITGMPGSGKTTLAYKVYSDKSVSSHFDIRAW  490



>ref|XP_009803728.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=1076

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +2

Query  563  LQRFQVLSI-QHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLAR  739
            +Q F ++ I QHA   +  M+G ++EFEII+  +   G +E +V++I GMGGIGKTTLA 
Sbjct  293  IQNFSLVDISQHALEMENMMVGHENEFEIIQDQIAR-GARELEVVSIVGMGGIGKTTLAN  351

Query  740  XVYEDSPISTHFDVRA  787
             +Y D  I + FD+RA
Sbjct  352  RIYCDPFIVSRFDIRA  367



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/114 (36%), Positives = 60/114 (53%), Gaps = 4/114 (4%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +  Q  Q   E+++ I +E  KI++    +G++ + + L      S       K  M+G+
Sbjct  100  RFRQSLQQVAEDMDHIWKESTKIQD----KGKQVSKESLVHDFSSSTNDILKVKNNMVGR  155

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             D+ + + + LT     E KVI I GMGGIGKTTLA+ VY D  I   FDV AW
Sbjct  156  DDQRKQLLEDLTRSYSGEPKVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHAW  209



>ref|XP_009780986.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana sylvestris]
Length=803

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            ++E+ +G +D+ E I KLLT  G +E+ +++I GM G+GKTTLA+ +++DS I +HFDVR
Sbjct  17   TEEEPLGLEDDAEKIIKLLTR-GIRERDIVSIFGMPGLGKTTLAKKIFKDSSIVSHFDVR  75

Query  785  AWIV  796
            AW++
Sbjct  76   AWVI  79



>ref|XP_011072560.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=903

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 61/118 (52%), Gaps = 10/118 (8%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQV----LSIQHASHSKEQM  619
             +Q  Q  + +++ IK E+++IK     E     HD L R  V    LS    +  K+ M
Sbjct  105  FYQDLQKVIADMDLIKNEVIEIK-----ESMGIVHDQLHRNSVPAGSLSSSPLTGQKQAM  159

Query  620  IGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            +G  D    I   LT       +++ I GMGGIGKTTLAR VYE+  I  +FD RAW+
Sbjct  160  VGVDDILNDIMDKLTRQ-QSGCQIVPIIGMGGIGKTTLARHVYENPLIVEYFDFRAWV  216



>ref|XP_009761661.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=770

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            ++E+ +G +D+ + I KLLT  G +E+ V++I GM G+GKTTLA+ +++DS + +HFDVR
Sbjct  20   TEEEPVGLEDDADKIIKLLT-RGIRERDVVSIFGMPGLGKTTLAKKIFKDSSVVSHFDVR  78

Query  785  AWI  793
            AW+
Sbjct  79   AWV  81



>ref|XP_009598609.1| PREDICTED: putative late blight resistance protein homolog R1A-10, 
partial [Nicotiana tomentosiformis]
Length=610

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            ++E+ +G +D+ E I KLLT  G +E+ +++I GM G+GKTTLA+ +++DS I +HFD+R
Sbjct  20   TEEEPVGLEDDAEEIIKLLT-RGIRERDIVSIFGMPGLGKTTLAKKIFKDSSIVSHFDIR  78

Query  785  AWI  793
            AW+
Sbjct  79   AWL  81



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 68/126 (54%), Gaps = 10/126 (8%)
 Frame = +2

Query  422  GDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHAS  601
            GD+ E  C   ++  Q   +E++++K+E+++I+      G K+A          S     
Sbjct  92   GDDRERACKAFNEELQEVEKEVDSLKKEVIQIEF--NKHGSKSAE-----LATTSSSSRR  144

Query  602  HSKEQ--MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHF  775
            ++ EQ  ++G +D+F  I   LT     +  VI++ GMGGIGKTTLAR  Y+DS I   F
Sbjct  145  YAIEQYTVVGMEDDFINILDRLTAQ-THDLTVISVVGMGGIGKTTLARKAYDDSSIRYRF  203

Query  776  DVRAWI  793
            D  AW+
Sbjct  204  DTHAWV  209



>ref|XP_009803726.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=935

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 11/106 (10%)
 Frame = +2

Query  470  SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEII  649
            S M++  AI++   K+KNI + + +  +        V + +H    +++M+G ++EFE++
Sbjct  105  STMKKWMAIQK---KLKNIQDLKAQDLS-------LVSTSRHGIEPEDKMVGLENEFEMM  154

Query  650  KKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            +  L   G KE +V++I GMGGIGKTTLA  +Y D  I +HF +RA
Sbjct  155  QDQLAR-GAKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGIRA  199



>gb|ACE79399.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G KE +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGIEPEDKMVGLENEFEMMQDQLA-RGAKELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  I +HF +RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFIMSHFGIRA  89



>emb|CDP05557.1| unnamed protein product [Coffea canephora]
Length=424

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 11/121 (9%)
 Frame = +2

Query  446  VKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHAS---HSKEQ  616
            + LH   +  + EI +IK+ L KI    +A   K       R +  S++HAS    ++E+
Sbjct  98   LSLHHHMREVLSEINSIKDMLTKIYQESDAAATKVP-----RARNHSVEHASGWSSTQEE  152

Query  617  --MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
              ++G  ++   +K+ LT   P +  ++ I GMGGIGKTTLAR V+ D  I  HF VRAW
Sbjct  153  TLVVGIDNDLLKVKEKLTG-LPHKLDILTIVGMGGIGKTTLARKVFNDPLIEYHFYVRAW  211

Query  791  I  793
            +
Sbjct  212  V  212



>gb|ACE79434.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G KE +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGIEPEDKMVGLENEFEMMQDQLA-RGAKELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  I +HF +RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFIMSHFGIRA  89



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score = 60.8 bits (146),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 67/116 (58%), Gaps = 3/116 (3%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKIK-NIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI-G  625
            L+++    +E+I+ +K E+++   + D+  G     +   +    S Q A+ + E ++ G
Sbjct  96   LYEILPPFVEKIDLLKREVMESSFSTDKIHGYGDPMNENLQLGHSSRQVANLNLETIVVG  155

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             +D+  IIK+ LT   P  ++++ I GMGGIGKTTLA+  Y+DS I   FDV  W+
Sbjct  156  LEDDLMIIKRRLT-GPPSTREIVPILGMGGIGKTTLAKKAYDDSEIRHRFDVHVWV  210


 Score = 28.1 bits (61),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 5/93 (5%)
 Frame = +1

Query  88   MACVAVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERIDG  267
            MA VAV SLLRT+E + +Q  P  +     ++     L+ S      FL  ++  +R   
Sbjct  1    MAYVAVISLLRTLE-QLVQLQPHWISAETRIMA--NSLLVSLEYFQNFL--ENTSKRSQD  55

Query  268  VEAVKRLETKLRDLAYRVEDEIEILVAHLYHED  366
               +K LE  +R +    ED IE+ +  +   D
Sbjct  56   HGQIKELERYIRTVVNEAEDVIELKIYEINQLD  88



>ref|XP_006352021.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=890

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = +2

Query  584  SIQHASHSKEQ---MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYED  754
            S QHA    ++   M+G ++EFE+++  LT  G +E KV++I GMGGIGKTTLA  +Y D
Sbjct  55   SSQHALLEPDENMNMVGDENEFEMMQGRLTRGG-RELKVVSIVGMGGIGKTTLANKIYSD  113

Query  755  SPISTHFDVRA  787
              I +HFD+R 
Sbjct  114  PFIMSHFDIRG  124



>ref|XP_009603168.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=1128

 Score = 62.4 bits (150),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 65/115 (57%), Gaps = 7/115 (6%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            +L +  Q  +E+I+++KEEL+K +  +  +     H V      LS  H S  +  +I  
Sbjct  95   RLLENLQQVIEDIDSVKEELIKQRKNNNLQAGN--HSVGGSSSPLS--HVSALENDVISI  150

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            ++E   ++  LT  G  E +VI+I GMGGIGK+T AR +Y D  I +  DVRAWI
Sbjct  151  EEER--MRDQLTR-GSSELEVISIVGMGGIGKSTFARKMYSDPSIVSFHDVRAWI  202


 Score = 26.2 bits (56),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (47%), Gaps = 12/96 (13%)
 Frame = +1

Query  88   MACV--AVASLLRTIELEFLQYHPRPLVQYNHLIPFNKELIQSFHQKLGFLISQHDEERI  261
            MA V  AV SL+ TI+L          +Q  H     +E ++  + K+G L    D    
Sbjct  1    MATVYAAVTSLMGTIQL---ISQSTSDLQEGH-----REHLKLLYDKVGSLQELLDTNSD  52

Query  262  DGVEAVKRLETKLRDLAYRVEDEIEILVAHLYHEDE  369
            D  + +K L  K+ DL +  EDE+E  +  +  EDE
Sbjct  53   D--KPMKDLRKKVIDLTHEAEDEVESQLRLVMEEDE  86


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 5/84 (6%)
 Frame = +2

Query  542  RKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIG  721
            ++T  +  +  Q+LSI    + +  M+G KDE E ++  LT H   + +VI+I GMGGIG
Sbjct  354  KRTVDEWREVAQILSI----NLETDMVGYKDEQESMRGKLTGHS-SQLEVISIAGMGGIG  408

Query  722  KTTLARXVYEDSPISTHFDVRAWI  793
            K+T A+ ++ D  I   FDVR WI
Sbjct  409  KSTFAKKMFSDPSILEFFDVRGWI  432



>ref|XP_009608888.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana tomentosiformis]
Length=538

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 68/126 (54%), Gaps = 10/126 (8%)
 Frame = +2

Query  422  GDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHAS  601
            GD+ E  C   ++  Q   +E++++K+E+++I+      G K+A          S     
Sbjct  92   GDDRERACKAFNEELQEVEKEVDSLKKEVIQIEF--NKHGSKSAE-----LATTSSSSRR  144

Query  602  HSKEQ--MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHF  775
            ++ EQ  ++G +D+F  I   LT     +  VI++ GMGGIGKTTLAR  Y+DS I   F
Sbjct  145  YAIEQYTVVGMEDDFINILDRLTAQT-HDLTVISVVGMGGIGKTTLARKAYDDSSIRYRF  203

Query  776  DVRAWI  793
            D  AW+
Sbjct  204  DTHAWV  209



>gb|ACE79422.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G KE +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGIEPEDKMVGLENEFEMMQDQLA-RGAKELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  I +HF +RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFIMSHFGIRA  89



>ref|XP_009590018.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana tomentosiformis]
Length=488

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 10/116 (9%)
 Frame = +2

Query  452  LHQVFQ--SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI-  622
            LH +F    A+E+I+ IKEE++ +K I +       +   +      ++    S EQ+I 
Sbjct  195  LHLIFSLPFAIEKIKLIKEEIL-LKKIPKNRSVIVVNSPNK-----PVESKPSSTEQIIV  248

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G ++E   I + LT  GPK   VI+ITGM G GKTTLA  VY D  +S+HFD+RAW
Sbjct  249  GFEEETNWIIRNLT-GGPKMLDVISITGMPGSGKTTLAYKVYNDKSVSSHFDIRAW  303



>ref|XP_006362539.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006362540.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X4 [Solanum tuberosum]
Length=749

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +2

Query  593  HASHSKEQMIG-KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPIST  769
            + S + E+ +G K+D  +IIKKL    G KE++VI+I GM G+GKTTLAR VY +  ++ 
Sbjct  12   YFSSNDEEFVGFKEDVKQIIKKL--TRGTKEREVISIVGMAGLGKTTLARKVYNNHSVAD  69

Query  770  HFDVRAWIVA  799
            HFDVRA+ + 
Sbjct  70   HFDVRAFCIV  79



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVFQ--SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI-  622
            LH +F    A+E+I  IK+E   + N+ E   + T+  V+       ++  S S EQ+I 
Sbjct  547  LHLIFSLPFAIEKINLIKKE---VSNLLEKIPKNTSLIVVNSPNK-PVESTSSSAEQIIV  602

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G ++E + I + LT  GPK   VI ITGM G GKTTLA  VY D  +S HFD+RAW
Sbjct  603  GFEEETDWIIRNLT-GGPKMLDVILITGMPGSGKTTLAYKVYNDKSVSNHFDIRAW  657



>ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=876

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 62/117 (53%), Gaps = 2/117 (2%)
 Frame = +2

Query  446  VKLHQVFQSAMEEIEAIKEELVKIKN-IDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI  622
            +K   V +    +I++I+  +  + N I   +GR T    +        Q  S  K+ ++
Sbjct  87   IKFLGVNRVLFRKIKSIEAAITSVYNDISAIKGRSTPSSSVNGCSRDVTQTLSSQKDVVV  146

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            G  D+F +I   LT + P +  V+ I GMGGIGKTTLA+ ++ D  I  HF VRAWI
Sbjct  147  GLDDDFLLIADKLTGY-PDKLDVVVIFGMGGIGKTTLAKRIFHDKLIEEHFYVRAWI  202



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVFQ--SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI-  622
            LH +F    A+E+I  IK+E   + N+ E   + T+  V+       ++  S S EQ+I 
Sbjct  563  LHLIFSLPFAIEKINLIKKE---VSNLLEKIPKNTSLIVVNSPNK-PVESTSSSAEQIIV  618

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G ++E + I + LT  GPK   VI ITGM G GKTTLA  VY D  +S HFD+RAW
Sbjct  619  GFEEETDWIIRNLT-GGPKMLDVILITGMPGSGKTTLAYKVYNDKSVSNHFDIRAW  673



>ref|XP_009608039.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=1307

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVFQ--SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI-  622
            LH +F    A+E+I  IK+E   + N+ E   + T+  V+       ++  S S EQ+I 
Sbjct  516  LHLIFSLPFAIEKINLIKKE---VSNLLEKIPKNTSLIVVNSPNK-PVESTSSSAEQIIV  571

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G ++E + I + LT  GPK   VI ITGM G GKTTLA  VY D  +S HFD+RAW
Sbjct  572  GFEEETDWIIRNLT-GGPKMLDVILITGMPGSGKTTLAYKVYNDKSVSNHFDIRAW  626



>gb|ACE79438.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V   +H    +++M+G +DEFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQNLS-------LVSPSRHGLEPEDKMVGLEDEFEMMQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  + +HF +RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFMMSHFGIRA  89



>gb|KJB49315.1| hypothetical protein B456_008G112600 [Gossypium raimondii]
Length=1393

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 10/124 (8%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAE--GRKTAHDVLQRFQVLSIQHASHSK  610
            P+ +K     +S ++EI A  +ELV  KN    E  GR  +  V Q     S   +   +
Sbjct  125  PHAIKFDGKMKSRIQEITAKFDELVARKNDFSLEEIGRGRSEKVFQ-----SCTTSLVDE  179

Query  611  EQMIGKKDEFEIIKKLLT---EHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDV  781
             ++ G+K + + I  LL    E    +  V++I GMGG+GKTTLA+ VY+D  I T F++
Sbjct  180  SRVYGRKSDKDAIVNLLIDGREMNKGDIGVVSIVGMGGVGKTTLAQLVYKDVRIKTSFEL  239

Query  782  RAWI  793
            RAW+
Sbjct  240  RAWV  243



>ref|XP_009772438.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772439.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=877

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 61/116 (53%), Gaps = 9/116 (8%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKI--KNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            L ++ Q  +E ++++KEEL+K    N  +A           R       HAS  +  M+G
Sbjct  98   LFEILQRGIENVDSLKEELIKHSHNNTSQAGNSSLGDSSSPRL------HASTLENDMVG  151

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
               E E +   LT   P E +VI++TGMGGIGK+T A+ ++    I + FD+R WI
Sbjct  152  YNIEQENMLSQLTSGSP-ELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWI  206



>ref|XP_009757156.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=886

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  599  SHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFD  778
            + S + M+G+ D+ + +   LT     E KVI I GMGGIGKTTLA+ V++D  I +HFD
Sbjct  117  NESSKDMVGRADQRKTLLDDLTRGFNDEPKVIPIVGMGGIGKTTLAKDVFDDVTIRSHFD  176

Query  779  VRAW  790
            VRAW
Sbjct  177  VRAW  180



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 55/99 (56%), Gaps = 0/99 (0%)
 Frame = +2

Query  494  IKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHG  673
            I E +V    I E +  K     LQ+      +  + S + M+G+ D+ + +   LT   
Sbjct  125  ITEMVVANDEIQEEKAHKRFCYSLQQVAQHIDRVLNESSKDMVGRADQRKRLLDDLTRGF  184

Query  674  PKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
              E KVI I GMGGIGKTTLA+ V++D  I +HFDVRAW
Sbjct  185  NDEPKVIPIVGMGGIGKTTLAKDVFDDVTIRSHFDVRAW  223



>emb|CDP19195.1| unnamed protein product [Coffea canephora]
Length=1549

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  608  KEQMIGK-KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            +  ++G+ +DE EI+KKLLTE       VI++TGMGG+GKTTLA+ VY +S    HFD +
Sbjct  167  RRDVLGRDEDESEIVKKLLTESESDSISVISVTGMGGLGKTTLAKAVYNNSQFDNHFDKK  226

Query  785  AWI  793
             W+
Sbjct  227  IWV  229



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 55/99 (56%), Gaps = 0/99 (0%)
 Frame = +2

Query  494  IKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHG  673
            I E +V    I E +  K     LQ+      +  + S + M+G+ D+ + +   LT   
Sbjct  125  ITEMVVANDEIQEEKAHKRFCYSLQQVAQHIDRVLNESSKDMVGRADQRKRLLDDLTRGF  184

Query  674  PKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
              E KVI I GMGGIGKTTLA+ V++D  I +HFDVRAW
Sbjct  185  NDEPKVIPIVGMGGIGKTTLAKDVFDDVTIRSHFDVRAW  223



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 55/99 (56%), Gaps = 0/99 (0%)
 Frame = +2

Query  494  IKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHG  673
            I E +V    I E +  K     LQ+      +  + S + M+G+ D+ + +   LT   
Sbjct  125  ITEMVVANDEIQEEKAHKRFCYSLQQVAQHIDRVLNESSKDMVGRADQRKRLLDDLTRGF  184

Query  674  PKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
              E KVI I GMGGIGKTTLA+ V++D  I +HFDVRAW
Sbjct  185  NDEPKVIPIVGMGGIGKTTLAKDVFDDVTIRSHFDVRAW  223



>ref|XP_009608040.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1208

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVFQ--SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI-  622
            LH +F    A+E+I  IK+E   + N+ E   + T+  V+       ++  S S EQ+I 
Sbjct  417  LHLIFSLPFAIEKINLIKKE---VSNLLEKIPKNTSLIVVNSPNK-PVESTSSSAEQIIV  472

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G ++E + I + LT  GPK   VI ITGM G GKTTLA  VY D  +S HFD+RAW
Sbjct  473  GFEEETDWIIRNLT-GGPKMLDVILITGMPGSGKTTLAYKVYNDKSVSNHFDIRAW  527



>ref|XP_008777037.1| PREDICTED: putative disease resistance protein At1g50180 [Phoenix 
dactylifera]
Length=481

 Score = 60.1 bits (144),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 17/115 (15%)
 Frame = +2

Query  482  EIEAIKEELVKIKNIDEAE--------GRKTAHDVLQRFQVL--SIQHASHSKEQMIG-K  628
            EIE IKE   KI+ I ++         G  +A D  + +Q L  S  H+      +IG +
Sbjct  115  EIEKIKE---KIRGISDSRATYGIANLGESSAVD--ESWQSLRESSPHSHDDDIDVIGFE  169

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             D+ +I+ +LL +   K + VI+I GMGG+GKTTLAR VY D  I  HF+  AW+
Sbjct  170  NDKKKIVSQLL-DRNKKARCVISIVGMGGLGKTTLARKVYNDPAIREHFNTFAWV  223


 Score = 27.7 bits (60),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 29/52 (56%), Gaps = 4/52 (8%)
 Frame = +1

Query  226  GFLISQHDEERIDGVEAVKRLETKLRDLAYRVEDEIE--ILVAHLYHEDEGF  375
            GFL  +  E R  G E V+    ++RD+AY VED I+  + +A +  +  GF
Sbjct  43   GFL--KDAESRRRGDERVENWIREIRDVAYEVEDIIDRVMFMAEMQRQRRGF  92



>ref|XP_008350664.1| PREDICTED: putative disease resistance protein RGA1 [Malus domestica]
Length=1051

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 41/114 (36%), Positives = 70/114 (61%), Gaps = 10/114 (9%)
 Frame = +2

Query  467  QSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHS---KEQMIGK-KD  634
            Q    +I+ I+E L    N+ E + R    + LQ  +VL+ +  SHS   KE++IG+ +D
Sbjct  90   QMMGHKIKEIRETL----NVIETDRRFHLDERLQEARVLTRERESHSFVRKEEIIGRDRD  145

Query  635  EFEIIKKLLTEHGPKEK-KVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            + EI++ L+ +  PKE   +I++ G+GG+GKT LA+ V+ D  +  HF+++ WI
Sbjct  146  KREIVQ-LMLDPIPKENVSIISLVGIGGLGKTALAQLVFNDETVQKHFELKIWI  198



>ref|XP_011091330.1| PREDICTED: putative inactive disease susceptibility protein LOV1 
[Sesamum indicum]
Length=1004

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +2

Query  464  FQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG-KKDEF  640
            FQ    +I A++ +L +I NI +   R   + V QR       ++ + +E  +G  +D  
Sbjct  111  FQVIESKISALQSDL-RISNI-KPRQRGLTNPVSQRHLEQRRSYSHYVEEDFVGLDEDVK  168

Query  641  EIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWIVA  799
            +++ +L+ E G K  +V++ITGMGGIGKTT+A+ +Y    I +HFD  AW+  
Sbjct  169  DLVARLVQEDGDKSCQVVSITGMGGIGKTTIAKKIYHHKDIRSHFDAFAWVCV  221



>ref|XP_009612837.1| PREDICTED: putative late blight resistance protein homolog R1A-10, 
partial [Nicotiana tomentosiformis]
Length=845

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            ++E+ +G +D+ E I KLLT  G +E+ +++I GM G+GKTTLA+ +++DS I +HFD+R
Sbjct  20   TEEEPVGLEDDAEEIIKLLTR-GIRERDIVSIFGMPGLGKTTLAKKIFKDSSIVSHFDIR  78

Query  785  AWI  793
            AW+
Sbjct  79   AWL  81



>ref|XP_009769147.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1335

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVF--QSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI-  622
            LH +F    A+E+I  IKEE   + N+ +   +  +  VL       ++  S S EQ+I 
Sbjct  547  LHLIFLLPFAIEKINIIKEE---VSNLLKKIPKNMSLIVLNSPNK-PVESKSSSAEQIIV  602

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G K+E + I + LT  GPK   VI+ITGM G GKTTLA  VY D  +S++FD+RAW
Sbjct  603  GFKEETDWIIRNLTS-GPKMLDVISITGMPGSGKTTLAYKVYNDKSVSSYFDIRAW  657



>ref|XP_008363331.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=991

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 11/117 (9%)
 Frame = +2

Query  461  VFQSAM-EEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHS---KEQMIGK  628
            VF+  M  +I+ I+E L    N+ E + R    + LQ  +VL+ +  SHS   KE++IG+
Sbjct  112  VFRLKMGHKIKEIRETL----NVIETDRRFHLDERLQEARVLTRERESHSFVRKEEIIGR  167

Query  629  -KDEFEIIKKLLTEHGPKEK-KVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             +D+ EI++ L+ +  PKE   +I++ G+GG+GKT LA+ V+ D  +  HF+++ WI
Sbjct  168  DRDKREIVQ-LMLDPIPKENVSIISLVGIGGLGKTALAQLVFNDETVQKHFELKIWI  223



>gb|ACE79412.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGLEPEDKMVGLENEFEMVQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  + +HF +RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFMMSHFGIRA  89



>gb|ACE79442.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF22007.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGLEPEDKMVGLENEFEMVQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  + +HF +RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFMMSHFGIRA  89



>ref|XP_009758245.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009758246.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=873

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 61/116 (53%), Gaps = 9/116 (8%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVK--IKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            L ++ Q  +E ++++KEEL+K    N  +A           R       HAS  +  M+G
Sbjct  98   LFEILQRGIENVDSLKEELIKHSDNNTSQAGNSSLGDSSSPRL------HASTLENDMVG  151

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
               E E +   LT   P E +VI++TGMGGIGK+T A+ ++    I + FD+R WI
Sbjct  152  YNIEQENMLSQLTSGSP-ELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWI  206



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +2

Query  590  QHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPIST  769
            QH   S+  M+G ++ FEI++  L   G  E +VI+I GMGGIGK+TLA  +Y D  I +
Sbjct  131  QHDFQSENMMVGHENAFEIMQDQLAR-GATELQVISIVGMGGIGKSTLAIKLYNDPFIMS  189

Query  770  HFDVRAWIV  796
            HFD+RA ++
Sbjct  190  HFDIRAKVI  198



>ref|XP_011083960.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Sesamum indicum]
Length=805

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 9/118 (8%)
 Frame = +2

Query  440  YCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQM  619
            +C +L +V    +E  ++ K ++++ +N+    G K        F   S++ AS  K  M
Sbjct  23   FCEELQRV----VENFDSAKLQVMEFRNM----GSKNLAPK-NSFSAGSLRLASGGKNSM  73

Query  620  IGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            +G  DE   IK  LT     +  VI+I GMGG GKTTLAR +Y+D+ I  HF  RAW+
Sbjct  74   VGFVDEMLQIKDRLTGQPSYKLDVISIVGMGGSGKTTLARSMYDDAFIVYHFYTRAWV  131



>gb|ACE79424.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGLEPEDKMVGLENEFEMVQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  + +HF +RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFMMSHFGIRA  89



>ref|XP_009759015.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=921

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +2

Query  590  QHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPIST  769
            Q A   +  M+G + EFE+++  LT  G  E +V++I GMGGIGKTTLA  +Y D  I +
Sbjct  136  QPALELENTMVGHETEFEMLQDQLTR-GASELEVVSIVGMGGIGKTTLANKIYSDPFIMS  194

Query  770  HFDVRA  787
            HFD+RA
Sbjct  195  HFDIRA  200



>gb|ACE79425.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVNTSRHGLEPEDKMVGLENEFEMVQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  + +HF +RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFMMSHFGIRA  89



>ref|XP_009758244.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=883

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 61/116 (53%), Gaps = 9/116 (8%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVK--IKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            L ++ Q  +E ++++KEEL+K    N  +A           R       HAS  +  M+G
Sbjct  108  LFEILQRGIENVDSLKEELIKHSDNNTSQAGNSSLGDSSSPRL------HASTLENDMVG  161

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
               E E +   LT   P E +VI++TGMGGIGK+T A+ ++    I + FD+R WI
Sbjct  162  YNIEQENMLSQLTSGSP-ELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWI  216



>ref|XP_006367915.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Solanum tuberosum]
Length=383

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 66/114 (58%), Gaps = 9/114 (8%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG-K  628
             HQ  + A+EEI  I++E++K   +++    K +H      +  S Q     K+ +IG  
Sbjct  102  FHQNLEYAIEEIGLIQKEVMKKIKVNKFNS-KISHS-----RDTSSQIPMDQKDVIIGLD  155

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            +D  +I  +L+ +    E  V+ I GMGGIGKTTLAR VY+DS I+ HF VRAW
Sbjct  156  EDLLKIKDRLIVQSSRLE--VVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAW  207



>ref|XP_009759016.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana sylvestris]
Length=883

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +2

Query  590  QHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPIST  769
            Q A   +  M+G + EFE+++  LT  G  E +V++I GMGGIGKTTLA  +Y D  I +
Sbjct  136  QPALELENTMVGHETEFEMLQDQLTR-GASELEVVSIVGMGGIGKTTLANKIYSDPFIMS  194

Query  770  HFDVRA  787
            HFD+RA
Sbjct  195  HFDIRA  200



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score = 57.4 bits (137),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 43/128 (34%), Positives = 65/128 (51%), Gaps = 15/128 (12%)
 Frame = +2

Query  416  TEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIK-NID-EAEGRKTAHDVLQRFQVLSI  589
            TE DE      +L  +   A+E  +++ +ELVK+K NI+ +A  R        R      
Sbjct  89   TEADE------RLLAILHQAIEGADSVTKELVKLKENINMQAANRSLEGSSSPR------  136

Query  590  QHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPIST  769
             H S  +  M+G   E E ++  L      + +VI+I GMGGIGK+T A+ ++ D  I +
Sbjct  137  SHVSILENDMVGYNIEQECMRGQLIGRS-SQLEVISIAGMGGIGKSTFAKKMFYDPSILS  195

Query  770  HFDVRAWI  793
             FD R WI
Sbjct  196  FFDFRGWI  203


 Score = 29.6 bits (65),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 49/94 (52%), Gaps = 12/94 (13%)
 Frame = +1

Query  91   ACVAVASLLRTIELEFLQYHPRPLVQYN-HLIPFNKELIQSFHQKLGFLISQHDEERIDG  267
            A  A+ SL+ TI L         + Q    L+  +KE ++  ++K+G ++   D    D 
Sbjct  3    AYAALTSLMGTIHL---------ISQSTLDLLEGHKEHLKLLYEKVGSMLEFLDTNSDD-  52

Query  268  VEAVKRLETKLRDLAYRVEDEIEILVAHLYHEDE  369
             E +K L  K++D+A+ VEDE+E  +  +  +DE
Sbjct  53   -EPMKDLLKKVKDVAHNVEDEVESQLRLVSEKDE  85



>gb|ACE79401.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    + +MIG ++EFE+++  L+  G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGVGPQSKMIGLENEFEMMQDRLS-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            + I GMGGIGKTTLA  +Y D  + +HF +RA
Sbjct  58   VLIVGMGGIGKTTLANKIYSDPFMMSHFGIRA  89



>ref|XP_009796570.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=557

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = +2

Query  470  SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEII  649
            S M++  AI+    K+KNI + + +  +        V + +H    +++M+G ++EFE++
Sbjct  270  STMKKWMAIQN---KLKNIQDLKAQDLS-------LVSTSRHGLEPEDKMVGLENEFEMV  319

Query  650  KKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            +  L   G +E +V++I GMGGIGKTTLA  +Y D  + +HF +RA
Sbjct  320  QDQLA-RGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFGIRA  364



>emb|CDP19356.1| unnamed protein product [Coffea canephora]
Length=1140

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  608  KEQMIGK-KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            +  ++G+ +DE +I+KKLLTE       VI++TGMGG+GKTTLA+ VY +S    HFD +
Sbjct  156  RSDVLGRDEDESKIVKKLLTESESDSISVISVTGMGGLGKTTLAKAVYNNSQFDNHFDKK  215

Query  785  AWI  793
             W+
Sbjct  216  IWV  218



>gb|ACF22008.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGLEPEDKMVGLENEFEMMQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  + +HF +RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFMMSHFGIRA  89



>ref|XP_008797616.1| PREDICTED: putative disease resistance protein At1g50180 [Phoenix 
dactylifera]
Length=924

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 64/114 (56%), Gaps = 15/114 (13%)
 Frame = +2

Query  482  EIEAIKEELVKIKNIDEAEGR---------KTAHDVLQRFQVLSIQHASHSKEQMIG-KK  631
            EI  IKE   KIKNI E++ R           A++  Q  +  S  H+     ++IG + 
Sbjct  118  EIGKIKE---KIKNISESKDRYGIANLGESSAANESSQSLRE-SSPHSYDDNIEVIGFEN  173

Query  632  DEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            D+ EI+ +LL +   K + VI+I GMGG+GKTTLAR VY D  I  HFD  AW+
Sbjct  174  DKKEIMSQLL-DGNEKTRCVISIVGMGGLGKTTLARKVYNDPAIGKHFDTFAWV  226



>gb|EYU17666.1| hypothetical protein MIMGU_mgv1a021453mg, partial [Erythranthe 
guttata]
Length=690

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 66/119 (55%), Gaps = 7/119 (6%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQ  616
            P+ +KL    +  +E++++IK+++++IK I +       H         S       K +
Sbjct  118  PWRLKLG--LRKVIEKMDSIKKKVIEIKQI-KGNAVNLTH---SPSPTSSTAFMGAEKSK  171

Query  617  MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            M+G +D+   + + LT   P  +++I I GMGGIGKTTLAR VYE+  I  HFD+  W+
Sbjct  172  MVGFEDDLLQLMERLTGRQPN-RQIIPIVGMGGIGKTTLARNVYENPLIVQHFDICCWV  229



>gb|KCW72272.1| hypothetical protein EUGRSUZ_E00733, partial [Eucalyptus grandis]
Length=879

 Score = 61.6 bits (148),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 39/126 (31%), Positives = 70/126 (56%), Gaps = 20/126 (16%)
 Frame = +2

Query  443  CVKLHQVFQSAMEEIEAIKEELVKI---------KNIDEAEGRKTAHDVLQRFQVLSIQH  595
            CV++H+V      EIE +K  +  I         + ++E E RK A  ++ +     + +
Sbjct  104  CVQVHKV----GTEIEGLKSRISDIGRRMQEYGIQPLNEGE-RKCARALMPK-----LTY  153

Query  596  ASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHF  775
            A   +E  +G++D  +++   L + G ++ +VI+I GMGG+GKTTLA+ V+    ++ HF
Sbjct  154  AHFEEEDFVGREDSIKVLVNELLKDG-EQHRVISICGMGGLGKTTLAKKVFAHDKVNNHF  212

Query  776  DVRAWI  793
            D  AW+
Sbjct  213  DGFAWV  218


 Score = 25.0 bits (53),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 17/30 (57%), Gaps = 2/30 (7%)
 Frame = +1

Query  271  EAVKRLETKLRDLAYRVEDEIE--ILVAHL  354
            EAV     +LRD AY  ED IE  IL A L
Sbjct  56   EAVGECVAQLRDFAYDAEDVIERYILKASL  85



>gb|EAY96750.1| hypothetical protein OsI_18670 [Oryza sativa Indica Group]
Length=912

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 68/114 (60%), Gaps = 10/114 (9%)
 Frame = +2

Query  470  SAMEEIEAIKEELVKIKN-----IDEAE-GRKTAHDVLQRFQVLSIQHASHSKEQMIGKK  631
            + +++IEA  ++L  +K+     I E + G   +HD L+   ++S     +S++ ++G +
Sbjct  122  TQLKQIEARLQKLTAMKDRYDILISEQKVGSNPSHDDLK---LMSDSLYFYSQDDIVGNE  178

Query  632  DEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            +E   + + L  HG K + VI+I GMGG+GKTTLAR +Y ++ I   FD  AWI
Sbjct  179  EELAWVTQRLI-HGRKSRTVISICGMGGLGKTTLARVIYRNNDIKKQFDCCAWI  231



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 67/122 (55%), Gaps = 10/122 (8%)
 Frame = +2

Query  446  VKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            V L++     ++++  IK+++++IK+I+   GR   HD+       ++  A+ S+  +  
Sbjct  123  VDLYRDLDKVIQDMGLIKKDVMEIKDINI--GRIEDHDL--HINSSTLAGAASSRSHLTT  178

Query  626  KKDEFEIIKKLLTEHGPK------EKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++D    + +LL E   K         +I I GMGGIGKTTLAR VY    I  HFD+RA
Sbjct  179  RRDAVVGLDELLIEVMDKLTGQQSNLHIIPIVGMGGIGKTTLARNVYAKPLIMQHFDIRA  238

Query  788  WI  793
            W+
Sbjct  239  WV  240



>ref|XP_009624115.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=902

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 65/115 (57%), Gaps = 12/115 (10%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVL--SIQHASHSKEQMI  622
            KL  +   A+ +I++  ++ +         G +T+ D+  +  +L  + + A   +  M+
Sbjct  97   KLRSLLNQAIRDIDSTTKKWI---------GTQTSLDLKAQNTILASTSERALEPENMMV  147

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            G ++EFE+++  L   G  E +V++I GMGGIGKTTLA  ++ D  I  HFD+RA
Sbjct  148  GHENEFEMMQVQLAR-GASELEVVSIVGMGGIGKTTLANKIFSDPLIMYHFDIRA  201



>ref|XP_011102162.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=997

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 46/125 (37%), Positives = 64/125 (51%), Gaps = 11/125 (9%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLS--IQHASHSK  610
            P    LH   +S +EE     E  +  + I+E     +A        V+S  I   S  K
Sbjct  217  PQSQHLHGAERSYLEE-----EINLFTQKIEEQLNNTSAQPEEDESAVVSSGIVQFSEKK  271

Query  611  EQMIGKKDEFEIIKKLLTEH-GPKE---KKVIAITGMGGIGKTTLARXVYEDSPISTHFD  778
             +M+G  DE   +KK +  H GP E   +K+++I GM GIGKT LAR VY+D  IST FD
Sbjct  272  AKMVGLDDELRNVKKAIIHHKGPSEDSKRKIVSIVGMAGIGKTALARKVYDDIFISTAFD  331

Query  779  VRAWI  793
             + W+
Sbjct  332  FKYWL  336



>gb|AFD18780.1| putative resistance protein, partial [Solanum bulbocastanum]
Length=189

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVFQS--AMEEIEAIKEELVKI-KNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI  622
            LH +F     +++++ IKEE+  + +NI +  G    +   +  +  S+     + + ++
Sbjct  23   LHLIFSLPITIKKMKLIKEEVSDLHENISKNRGLIVVNSPKKPVESKSLT----TDKIIV  78

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            G ++E  +I + LT  GP +  VI+ITGM G GKTTLA  VY D  +S HFD+RAW
Sbjct  79   GFEEETNLILRKLTS-GPADLDVISITGMPGSGKTTLAYKVYNDKSVSFHFDLRAW  133



>ref|XP_009793286.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
 ref|XP_009793288.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=493

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 66/116 (57%), Gaps = 7/116 (6%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVK-IKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
            L ++ Q A+E ++++KEEL+  I+N +   G  +  D       L + H+S  +  M+G 
Sbjct  152  LFKISQRAIENVDSLKEELITHIQNNNLQAGNSSRGDS----SSLRL-HSSTLENDMVGY  206

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWIV  796
              E   +   LT  G  E +VI++TGMGGIGK+T A+ ++    + + FD+R WI+
Sbjct  207  NIEQSNMMSQLT-GGSTELEVISVTGMGGIGKSTFAKRLFSHPSVLSFFDIRGWII  261



>ref|XP_010046117.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Eucalyptus 
grandis]
Length=1388

 Score = 63.5 bits (153),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 71/126 (56%), Gaps = 11/126 (9%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKN---IDEAEGRKTAHDVLQRFQVLSIQHASHS  607
            P  +  +   +S M E++A   E++  KN   + + EG + A+  L +     I   +  
Sbjct  117  PRALMFNHKMRSEMVELDARLGEIIARKNGLGLRKNEGERLAYRQLDK----PIPTTNLR  172

Query  608  KEQMIGKKDE-FEIIKKLLTEHGPK---EKKVIAITGMGGIGKTTLARXVYEDSPISTHF  775
            +   + ++DE  EI+K L+ E   +   + +VIAI GMGG+GKTTLA+ +Y D+ ++ +F
Sbjct  173  EPCFVSREDEKREILKLLVREEDDRTCADLEVIAIVGMGGVGKTTLAQQIYNDAGVTHYF  232

Query  776  DVRAWI  793
            DV+ W+
Sbjct  233  DVKVWV  238


 Score = 22.7 bits (47),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 10/35 (29%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = +1

Query  232  LISQHDEERIDGVEAVKRLETKLRDLAYRVEDEIE  336
            +++  +++++ G   VK     L +LAY +ED +E
Sbjct  50   VLNDAEDKQLTGYHDVKSWLEDLENLAYDIEDLLE  84



>ref|XP_011091448.1| PREDICTED: putative disease resistance protein At1g50180 [Sesamum 
indicum]
Length=653

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +2

Query  602  HSKEQ-MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFD  778
            H  EQ  +G K+E ++++ LLT       +VI+I GMGG+GKT+LAR VY+   + T F+
Sbjct  200  HGIEQYFVGMKEETQLLESLLTNDDHSSNQVISICGMGGLGKTSLARKVYQGEAVQTWFE  259

Query  779  VRAWIV  796
             RAWI 
Sbjct  260  ARAWIC  265



>ref|XP_010273761.1| PREDICTED: putative disease resistance protein RGA3 [Nelumbo 
nucifera]
Length=557

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +2

Query  632  DEFEIIKKLLTEHGPKEKK--VIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            D+  II+KLL  +GP E+   V+AI G+GG+GKTTLA+ VY D  +  HF++RAW+
Sbjct  180  DKSSIIEKLLRSNGPDEETLGVLAIVGIGGLGKTTLAQSVYNDENVKIHFNLRAWV  235



>gb|EYU23518.1| hypothetical protein MIMGU_mgv1a019595mg [Erythranthe guttata]
Length=901

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 70/133 (53%), Gaps = 14/133 (11%)
 Frame = +2

Query  425  DEAEPYCVKLHQV---------FQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQ  577
            D+ +P C +L ++          Q+ ++++++IK+++++ K  DE               
Sbjct  82   DQIQPACHRLQKIVKDEIAMLDLQAVIQDMDSIKKKVLEFK--DEIGSNDDDIHPTSTTT  139

Query  578  VLSIQHASHSKEQMIGKKDE-FEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYED  754
              S    +  K  M+G ++  F+++ KL  +     ++VI I GMGGIGKTTLA+  YED
Sbjct  140  SSSTPLITTGKNTMVGFEEHLFQLLDKLTVQQ--SNRQVIPIVGMGGIGKTTLAQNAYED  197

Query  755  SPISTHFDVRAWI  793
              I  HFD+R W+
Sbjct  198  PLIVQHFDIRTWV  210



>ref|XP_006362537.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362538.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006362541.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X5 [Solanum tuberosum]
 ref|XP_006362542.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X6 [Solanum tuberosum]
Length=749

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +2

Query  593  HASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTH  772
            + S + E+ +G K++ E I + LT+ G KE+KVI+I GM G+GKTTLAR VY +  ++ H
Sbjct  12   YFSSNDEEFVGFKEDVEQIIQKLTK-GTKERKVISIVGMAGLGKTTLARKVYNNHSVADH  70

Query  773  FDVRAWIVA  799
            FDV A+ + 
Sbjct  71   FDVCAFCIV  79



>ref|XP_009772441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=872

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 5/114 (4%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKK  631
            L ++ Q  +E ++++KEEL+K  + + ++    + D      +    HAS  +  M+G  
Sbjct  98   LFEILQRGIENVDSLKEELIKHSHNNTSQAGNASLDDSSSPGL----HASTLENDMVGYN  153

Query  632  DEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             E   +   LT   P E +VI++TGMGGIGK+T A+ ++    I + FD+R WI
Sbjct  154  IEQANMMSQLTSGSP-ELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWI  206



>ref|XP_008461342.1| PREDICTED: disease resistance protein RGA2-like isoform X3 [Cucumis 
melo]
Length=1042

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRK--TAHDVLQRFQVLSIQHASHSKEQMI  622
            K+ +  +   E ++ I +E   + +    +GR+      +  R  +    H+S +KE++I
Sbjct  117  KMARRVKRIRERLDVIDKEKSYLWSHSFVQGRQQDVPSPIRMRMSLSRETHSSLNKERVI  176

Query  623  GKKDEFEIIKKLLTEHGPKEK---KVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            G+ D+   +K LL       K    +IAI GMGGIGKTTLA+ +Y D  +S HF+++ WI
Sbjct  177  GRDDDKRYLKSLLLVDDMSLKDNVSLIAIVGMGGIGKTTLAKSLYNDGDVSKHFEIKMWI  236



>ref|XP_008461339.1| PREDICTED: disease resistance protein RGA2-like isoform X2 [Cucumis 
melo]
Length=1061

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRK--TAHDVLQRFQVLSIQHASHSKEQMI  622
            K+ +  +   E ++ I +E   + +    +GR+      +  R  +    H+S +KE++I
Sbjct  117  KMARRVKRIRERLDVIDKEKSYLWSHSFVQGRQQDVPSPIRMRMSLSRETHSSLNKERVI  176

Query  623  GKKDEFEIIKKLLTEHGPKEK---KVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            G+ D+   +K LL       K    +IAI GMGGIGKTTLA+ +Y D  +S HF+++ WI
Sbjct  177  GRDDDKRYLKSLLLVDDMSLKDNVSLIAIVGMGGIGKTTLAKSLYNDGDVSKHFEIKMWI  236



>ref|XP_008461338.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Cucumis 
melo]
Length=1068

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query  449  KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRK--TAHDVLQRFQVLSIQHASHSKEQMI  622
            K+ +  +   E ++ I +E   + +    +GR+      +  R  +    H+S +KE++I
Sbjct  117  KMARRVKRIRERLDVIDKEKSYLWSHSFVQGRQQDVPSPIRMRMSLSRETHSSLNKERVI  176

Query  623  GKKDEFEIIKKLLTEHGPKEK---KVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            G+ D+   +K LL       K    +IAI GMGGIGKTTLA+ +Y D  +S HF+++ WI
Sbjct  177  GRDDDKRYLKSLLLVDDMSLKDNVSLIAIVGMGGIGKTTLAKSLYNDGDVSKHFEIKMWI  236



>gb|ACE79441.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGLEPEDKMVGLENEFEMVQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTLA  +Y D  + +HF  RA
Sbjct  58   VSIVGMGGIGKTTLANKIYSDPFMMSHFGTRA  89



>ref|XP_006367920.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X5 [Solanum tuberosum]
Length=476

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 64/113 (57%), Gaps = 7/113 (6%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKK  631
             HQ  + A+EEI  I++E++K   +++    K +H      +  S Q     K+ ++G  
Sbjct  98   FHQNLEYAIEEIGLIQKEVMKKIKVNKFNS-KISHS-----RDTSSQIPLDQKDIIVGLD  151

Query  632  DEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            ++   IK  L     +  +V+ I GMGGIGKTTLAR VY+DS I+ HF VRAW
Sbjct  152  EDLLRIKDRLIVQSSR-LEVVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAW  203



>ref|XP_009777473.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009777474.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009777475.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009777476.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=1253

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 69/113 (61%), Gaps = 11/113 (10%)
 Frame = +2

Query  470  SAMEEIEAIKEELVKI--KNIDEAEGRKTAHDVLQRFQVLSIQHAS-HSKEQMIGKKDEF  640
            S +EE++ I+ E+ K+  +NID          V++  + LSIQH++  + E+++G +++ 
Sbjct  486  SIIEEVKHIRTEVTKMWSENID-----LRPCTVVEPSKHLSIQHSNPMNDEEIVGFENDM  540

Query  641  E-IIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWIV  796
            + II+ L+   G     VI I GMGG GKTT AR +Y D  I +HFDVRAW +
Sbjct  541  KRIIRHLI--QGTNGLDVIPIVGMGGQGKTTCARKLYNDDIIVSHFDVRAWCI  591



>ref|XP_006367916.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006367917.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006367918.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006367919.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X4 [Solanum tuberosum]
Length=493

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 64/113 (57%), Gaps = 7/113 (6%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKK  631
             HQ  + A+EEI  I++E++K   +++    K +H      +  S Q     K+ ++G  
Sbjct  98   FHQNLEYAIEEIGLIQKEVMKKIKVNKFNS-KISHS-----RDTSSQIPLDQKDIIVGLD  151

Query  632  DEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            ++   IK  L     +  +V+ I GMGGIGKTTLAR VY+DS I+ HF VRAW
Sbjct  152  EDLLRIKDRLIVQSSR-LEVVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAW  203



>ref|XP_009782023.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana sylvestris]
Length=743

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 65/115 (57%), Gaps = 6/115 (5%)
 Frame = +2

Query  452  LHQVFQ--SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            LH +F    A+E+I  IKEE   + N+ E   +     V+        + +S + + ++G
Sbjct  221  LHLIFSLPVAIEKINFIKEE---VSNLLEKIPKNRGVIVVNSLNKPVDRKSSIAGKIIVG  277

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             K+E ++I + LT  G K   VI+ITG  G GKTTLA  +Y D  +S+HFD+RAW
Sbjct  278  FKEETDLIIRNLTR-GSKMLDVISITGTPGSGKTTLAHKMYNDKVVSSHFDIRAW  331



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 67/115 (58%), Gaps = 11/115 (10%)
 Frame = +2

Query  464  FQSAMEEIEAIKEELVKIKN-----IDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGK  628
             ++  +EIE+IK ++ +I +     I    G +++H    + +V  ++     +E ++G 
Sbjct  105  LRNVAKEIESIKVKVKEIYDKKMFGIQSLHGGESSHRSPPQKRVPMVE-----EENVVGF  159

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             DE   I   LT +G +E ++I+I GMGG+GKTTLA+ VY DS I  HF  RAWI
Sbjct  160  DDEARKISSRLT-NGSEELEIISIVGMGGLGKTTLAKKVYTDSSIEFHFYNRAWI  213



>ref|XP_009622529.1| PREDICTED: putative late blight resistance protein homolog R1A-4, 
partial [Nicotiana tomentosiformis]
Length=727

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 64/116 (55%), Gaps = 8/116 (7%)
 Frame = +2

Query  452  LHQVFQS--AMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            LH +F    A+E+I  IKE   ++ N+ E   +     V+        + +S   + ++G
Sbjct  157  LHLIFSLPLAIEKINLIKE---RVSNLFEKIPKNMGVIVVNSPNKPVERKSSIDGKIIVG  213

Query  626  KKDE-FEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             K+E + II+KL +  GPK   VI ITGM G GKTTLA  VY D  +  HFD+RAW
Sbjct  214  FKEETYLIIRKLTS--GPKTLDVILITGMPGSGKTTLAYKVYNDKSVFGHFDIRAW  267



>ref|XP_011086979.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=870

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  602  HSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDV  781
            + + +M+G +DE   IK LL      E KV  I GM GIGKTTLAR VYE   IS+ FD 
Sbjct  142  NDQSKMVGLEDEVSGIKNLLINRLSSELKVFVIEGMAGIGKTTLARQVYEHPSISSTFDC  201

Query  782  RAWI  793
            R W+
Sbjct  202  RLWV  205



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +2

Query  452   LHQVFQS--AMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
             LH +F    A+E+I  IKE   ++ N+ E   +     V+        + +S + + ++G
Sbjct  962   LHLIFSLPLAIEKINLIKE---RVSNLFEKIPKNMGVIVVNSPNKPVERKSSIAGKIIVG  1018

Query  626   KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
              K+E  +I + LT  GPK   VI+ITGM G GKTTLA  VY D  +  HFD+RAW
Sbjct  1019  FKEETYLIIRKLTS-GPKTLDVISITGMPGSGKTTLAYKVYNDKSVYGHFDIRAW  1072



>ref|XP_006356564.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=758

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +2

Query  602  HSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDV  781
            +  ++++G +   EI+ K LT+ G KE+ VI+I GM G+GKTTLAR VY +  I +HFDV
Sbjct  20   YDDDEVVGFEKHAEIMMKKLTQ-GTKERDVISIYGMPGLGKTTLARKVYYNPSIVSHFDV  78

Query  782  RAW  790
            +AW
Sbjct  79   KAW  81



>ref|XP_009589053.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009589054.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=635

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = +2

Query  443  CVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMI  622
            C   ++  Q   +E++++++EL++I+ I        A       +  + QH       ++
Sbjct  98   CKSFNEELQKVEKEVDSLRKELMEIEFIKHGTKSAEASTSTSSKRYATEQHT------VV  151

Query  623  GKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            G KD+F  I   LT     +  VI + GMGGIGKTTLAR VY+DS I   FD  AW+
Sbjct  152  GMKDDFNTILDRLTAQ-TDQLTVIPVVGMGGIGKTTLARKVYDDSTIRYRFDKHAWV  207



>gb|KCW72458.1| hypothetical protein EUGRSUZ_E00908 [Eucalyptus grandis]
Length=886

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 12/125 (10%)
 Frame = +2

Query  431  AEPYCVKLHQV---FQSAMEEIEAIKEELVK--IKNIDEAEGRKTAHDVLQRFQVLSIQH  595
            A+  CV++H+V    +S    I  I +E+ K  I+ ++E+E         +R       +
Sbjct  100  AKCSCVQVHEVGTEIESLKSRISEIGDEMQKYGIQPLNESECETARASTPER------TY  153

Query  596  ASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHF  775
            A   +E  +G++D  E++   L + G ++++VI+I GMGG+GKTTLA+ V+    +  HF
Sbjct  154  AHFEEEDFVGREDYIEVLVNELLKDG-EQQRVISICGMGGLGKTTLAKKVFAHDKVKNHF  212

Query  776  DVRAW  790
            D  AW
Sbjct  213  DGFAW  217



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score = 61.6 bits (148),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 65/117 (56%), Gaps = 14/117 (12%)
 Frame = +2

Query  455  HQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVL--QRFQVL-SIQHASHSKEQMIG  625
            +Q     + EI+++ EEL+          R    D+L  Q   VL S + A   K  M+G
Sbjct  105  YQELDEVLVEIDSLVEELLN--------DRCGLKDLLPRQHLPVLGSSRDARVGKNVMVG  156

Query  626  KKDEFEIIKKLLTEHGPKEK-KVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              ++   +K  LT  G + K +VI ITGMGG+GKTTLAR +Y+DS +  HFD+ AW+
Sbjct  157  FDEDVMELKHRLT--GWESKLQVIPITGMGGVGKTTLARNLYDDSLVKDHFDLCAWV  211


 Score = 23.9 bits (50),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query  202  IQSFHQKLGFLISQ-HDEERIDGVEAVKRLETKLRDLAYRVEDEIEILVA  348
            I S ++K+ FL +   D  +    E +  LE ++RD A  +ED +E  V+
Sbjct  31   IISIYRKVRFLQTLFEDSPQKSSQEEMDSLEIRIRDSASVIEDLVEFYVS  80



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +2

Query  452  LHQVFQS--AMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            LH +F    A+E+I  IKE   ++ N+ E   +     V+        + +S + + ++G
Sbjct  828  LHLIFSLPLAIEKINLIKE---RVSNLFEKIPKNMGVIVVNSPNKPVERKSSIAGKIIVG  884

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             K+E  +I + LT  GPK   VI+ITGM G GKTTLA  VY D  +  HFD+RAW
Sbjct  885  FKEETYLIIRKLTS-GPKTLDVISITGMPGSGKTTLAYKVYNDKSVYGHFDIRAW  938



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +2

Query  452   LHQVFQS--AMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
             LH +F    A+E+I  IKE   ++ N+ E   +     V+        + +S + + ++G
Sbjct  964   LHLIFSLPLAIEKINLIKE---RVSNLFEKIPKNMGVIVVNSPNKPVERKSSIAGKIIVG  1020

Query  626   KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
              K+E  +I + LT  GPK   VI+ITGM G GKTTLA  VY D  +  HFD+RAW
Sbjct  1021  FKEETYLIIRKLTS-GPKTLDVISITGMPGSGKTTLAYKVYNDKSVYGHFDIRAW  1074



>gb|EYU23616.1| hypothetical protein MIMGU_mgv1a025793mg [Erythranthe guttata]
Length=744

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  632  DEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            DEF  IK LLT+H   E KV+A+ GM GIGKT  A+ ++ED  IS+ FD RA++
Sbjct  163  DEFSKIKDLLTDHFYWEIKVVALFGMAGIGKTYFAKKIFEDPSISSRFDCRAFV  216



>ref|XP_009604795.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 43/146 (29%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  362  KMRDLADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEG  541
            K  D  D  L++     D+E  +    C KL+      +E +++I+ E++K KN D    
Sbjct  13   KAEDTIDLCLRRIHVA-DSEKVQNNARC-KLYDELLQIIEVMDSIQGEVMKFKN-DRHNN  69

Query  542  RKTAHDV--LQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGG  715
            ++   D+  +    + S       +  ++G +D+F II+  L    P E  V++I GMGG
Sbjct  70   QQDIKDLSAITSSPLRSSGRVWDEENSLVGMEDDFNIIRDQLFRQTP-ELNVVSIVGMGG  128

Query  716  IGKTTLARXVYEDSPISTHFDVRAWI  793
            IGK+TLAR ++    +S  FD+ +W+
Sbjct  129  IGKSTLARSLFNHPSVSPRFDISSWV  154



>gb|ACF22011.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGLEPEDKMVGLENEFEMVQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTL   +Y D  + +HF +RA
Sbjct  58   VSIVGMGGIGKTTLTNKIYSDPFMMSHFGIRA  89



>ref|XP_009759467.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=161

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = +2

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            KD   I+KKL    G KE  VI+I GM G+GKTTLAR VY ++ I  HFDV+AW
Sbjct  68   KDAEHIMKKL--TGGSKELDVISIFGMAGLGKTTLARKVYNNTSIINHFDVKAW  119



>gb|ACF22014.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGLEPEDKMVGLENEFEMVQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGKTTL   +Y D  + +HF +RA
Sbjct  58   VSIVGMGGIGKTTLVNKIYSDPFMMSHFGIRA  89



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 43/146 (29%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  362  KMRDLADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEG  541
            K  D  D  L++     D+E  +    C KL+      +E +++I+ E++K KN D    
Sbjct  71   KAEDTIDLCLRRIHVA-DSEKVQNNARC-KLYDELLQIIEVMDSIQGEVMKFKN-DRHNN  127

Query  542  RKTAHDV--LQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGG  715
            ++   D+  +    + S       +  ++G +D+F II+  L    P E  V++I GMGG
Sbjct  128  QQDIKDLSAITSSPLRSSGRVWDEENSLVGMEDDFNIIRDQLFRQTP-ELNVVSIVGMGG  186

Query  716  IGKTTLARXVYEDSPISTHFDVRAWI  793
            IGK+TLAR ++    +S  FD+ +W+
Sbjct  187  IGKSTLARSLFNHPSVSPRFDISSWV  212



>ref|XP_008811538.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Phoenix 
dactylifera]
Length=929

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 13/123 (11%)
 Frame = +2

Query  446  VKLHQVFQSAMEEIEAIKEELVKI------KNIDEAEGRKTAHDVLQRFQVLSIQHASHS  607
            + LH++      EI  IKE++  I        I +  G  T  ++ Q  +  S  H+   
Sbjct  112  ITLHKI----GSEIRKIKEKIQNIFASKDTYGITDLGGSSTVDEISQSLR-QSSPHSDDD  166

Query  608  KEQMIG-KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
               +IG + D+ +I+ +LL E+  K + VI+I GMGG+GKTTLAR VY D  I  HFD  
Sbjct  167  DIDVIGFENDKKKIVSQLLDEN-KKARCVISIVGMGGLGKTTLARKVYNDPAIKKHFDTF  225

Query  785  AWI  793
            AW+
Sbjct  226  AWV  228



>ref|XP_010058328.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Eucalyptus 
grandis]
Length=923

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 12/125 (10%)
 Frame = +2

Query  431  AEPYCVKLHQV---FQSAMEEIEAIKEELVK--IKNIDEAEGRKTAHDVLQRFQVLSIQH  595
            A+  CV++H+V    +S    I  I +E+ K  I+ ++E+E         +R       +
Sbjct  100  AKCSCVQVHEVGTEIESLKSRISEIGDEMQKYGIQPLNESECETARASTPER------TY  153

Query  596  ASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHF  775
            A   +E  +G++D  E++   L + G ++++VI+I GMGG+GKTTLA+ V+    +  HF
Sbjct  154  AHFEEEDFVGREDYIEVLVNELLKDG-EQQRVISICGMGGLGKTTLAKKVFAHDKVKNHF  212

Query  776  DVRAW  790
            D  AW
Sbjct  213  DGFAW  217



>emb|CDP21009.1| unnamed protein product [Coffea canephora]
Length=1184

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +2

Query  608  KEQMIGK-KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            +  ++G+ KDE EI+KKLLTE       VI ITGMGG+GKTTLA+ VY  S I  HFD +
Sbjct  157  RRDVLGRDKDESEIVKKLLTE-TESVISVIPITGMGGLGKTTLAKAVYNKSQIHKHFDKK  215

Query  785  AWI  793
             W+
Sbjct  216  IWV  218



>gb|KDO39612.1| hypothetical protein CISIN_1g043855mg [Citrus sinensis]
Length=946

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 68/120 (57%), Gaps = 5/120 (4%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQ  616
            P  ++      S ++EI    ++++ +K++ ++  R+T  D  +  +  S+ + +H   +
Sbjct  130  PQSIQFDYAMMSKIKEINKRFQDILLLKDLMDSNTRRTTIDRQRLEETCSLVNEAHVYGR  189

Query  617  MIGKKDEFEIIKK--LLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             I KK+  E++ +  L+ + G     V+ I GMGG+GKTTLA+ VY D  +  HFD++AW
Sbjct  190  EIEKKEIVELLLRDDLMNDGG---FSVLPIVGMGGLGKTTLAQLVYNDDRVRDHFDLKAW  246



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +2

Query  452   LHQVFQS--AMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
             LH +F    A+E+I  IKE   ++ N+ E   +     V+        + +S + + ++G
Sbjct  1032  LHLIFSLPLAIEKINLIKE---RVSNLFEKIPKNMGVIVVNSPNKPVERKSSIAGKIIVG  1088

Query  626   KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
              K+E  +I + LT  GPK   VI+ITGM G GKTTLA  VY D  +  HFD+RAW
Sbjct  1089  FKEETYLIIRKLTS-GPKTLDVISITGMPGSGKTTLAYKVYNDKSVYGHFDIRAW  1142



>ref|XP_009603187.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=677

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 72/147 (49%), Gaps = 7/147 (5%)
 Frame = +2

Query  356  IMKMRDLADFVLKK-EKPQRDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDE  532
            + K  D  D  LK+      D+  D A      L+   Q   + +++I+EEL+K KN ++
Sbjct  69   VYKAEDTVDLCLKRIHVADIDSNQDNARR---MLYDELQQIGKVMDSIQEELMKFKNENQ  125

Query  533  AEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMG  712
                  A   +  F + S  H    +   +G ++ F  +   L     +E  V+++ GMG
Sbjct  126  HIKDLPA---INFFPLRSSGHVVDEENAFVGMENVFNKVLNQLIGGNARELNVVSVVGMG  182

Query  713  GIGKTTLARXVYEDSPISTHFDVRAWI  793
            GIGK+TLA  ++ ++ +  HFDV +W+
Sbjct  183  GIGKSTLAGSIFRNTSVFYHFDVSSWV  209



>ref|XP_009770862.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770863.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770864.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770865.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770866.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1328

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +2

Query  452  LHQVFQ--SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            LH +F    A+E+I  IK+E   + N+ +   +     V+        + +S S + ++G
Sbjct  540  LHLIFSLPFAIEKISLIKKE---VSNLHKKIPKNMGVIVVNSANKPVARKSSISSKIIVG  596

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             ++E  +I + LT  GPK   VI+ITGM G GKTTLA  VY D  +  HFD+RAW
Sbjct  597  FEEETYLIIRKLTS-GPKTLDVISITGMPGSGKTTLAHKVYNDKSVFCHFDIRAW  650



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +2

Query  602  HSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDV  781
            + +  ++G  ++ +I+K  LT+  P   + I I GMGG+GKTTLAR +YED  I  HF V
Sbjct  146  YMENHVVGLNNDLQIVKDRLTQ-SPLRLETIPIVGMGGVGKTTLARRLYEDPSIVLHFHV  204

Query  782  RAWI  793
            R W+
Sbjct  205  RLWV  208



>ref|XP_007010985.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
 gb|EOY19795.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
Length=1466

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +2

Query  566  QRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXV  745
            +R Q  S++  +H    + G+  + E I +LL E   + K VI I GMGGIGKTTLAR V
Sbjct  169  ERLQPTSVEIETH----VYGRDKDKEKILELLFESDDEGKVVIPIVGMGGIGKTTLARLV  224

Query  746  YEDSPISTHFDVRAWI  793
            Y D+ ++ +FD++AW+
Sbjct  225  YNDNRVNDYFDLKAWV  240



>ref|XP_007052454.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX96611.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative isoform 1 [Theobroma cacao]
Length=1381

 Score = 62.8 bits (151),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 64/123 (52%), Gaps = 8/123 (7%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKNI----DEAEGRKTAHDVLQRFQVLSIQHASH  604
            P  VK      S ++EI A  +E++  K      +   G  T+  V++R    S+ + S 
Sbjct  118  PSAVKFDVKMGSKIKEITARFQEIIDQKECLELRERGAGGSTSDRVVRRLPSTSLVNES-  176

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
                + G++ +   I +LL ++      VI+I GMGGIGKTTLA+ VY D  +   FD++
Sbjct  177  ---SVFGREKDKNTILELLLKNEESGVGVISIVGMGGIGKTTLAQLVYNDVSVEGFFDLK  233

Query  785  AWI  793
            AW+
Sbjct  234  AWV  236


 Score = 22.7 bits (47),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  274  AVKRLETKLRDLAYRVEDEIE  336
            +VK    +LRDLAY V+D ++
Sbjct  64   SVKLWLAELRDLAYDVDDLLD  84



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 69/116 (59%), Gaps = 11/116 (9%)
 Frame = +2

Query  461  VFQSAMEEIEAIKEELVKIKN-----IDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            + +S  E+I++IK ++ +I +     I+  +  + +H    R +   ++     +E ++G
Sbjct  104  MLRSVSEDIKSIKVKVKEIYDKKMFGIESLQSGEPSHKPSARKRAPIVE-----EENVVG  158

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              +E   + + LT+ GP++ +VI++ GMGG+GKTTLA+ VY D  I  HF +RAW+
Sbjct  159  FDEEARTVVERLTD-GPEQLEVISVVGMGGLGKTTLAKKVYSDPSIEYHFYIRAWV  213



>ref|XP_010645145.1| PREDICTED: putative disease resistance protein RGA4 isoform X1 
[Vitis vinifera]
Length=1358

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +2

Query  548  TAHDVLQRFQVLSIQHASHS---KEQMIGKKD-EFEIIKKLLTEHGPKEKKVIAITGMGG  715
            T  D++   +V +    +HS   K +M+G+++ + EII KLL+ +G ++  V+AI G+GG
Sbjct  139  TPRDIVLHTRVENSGRDTHSFVLKSEMVGREENKEEIIGKLLSSNGEEKLSVVAIVGIGG  198

Query  716  IGKTTLARXVYEDSPISTHFDVRAW  790
            +GKTTLA+ VY D  +  HF+ + W
Sbjct  199  LGKTTLAQLVYNDERVVNHFEFKIW  223



>gb|ABR29793.1| CC-NBS-LRR protein, partial [Solanum tuberosum]
Length=711

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +2

Query  617  MIGKKDEFE-IIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            ++G+++E E +I +LL+E G K+  V+ I GM GIGKTTLAR VY D  +  HF ++AWI
Sbjct  177  ILGRQNEIEGLIDRLLSEDG-KKLTVVPIVGMAGIGKTTLARAVYNDEKVKNHFGLKAWI  235

Query  794  VA  799
              
Sbjct  236  CV  237



>ref|XP_006356563.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=1174

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 40/115 (35%), Positives = 64/115 (56%), Gaps = 7/115 (6%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKIKNIDE--AEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            L Q+      +   +KE+L +   + E  A+G  ++ +   +  + SI    +  ++++G
Sbjct  385  LEQLISVCHNQQRKVKEQLTQSMEVVETCAKGTLSSGEPSNKPGITSI----YDDDEVVG  440

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             + E EII   L   G KE+ +I+I GM G+GKTTLAR VY +  I  HFDV+AW
Sbjct  441  FEKEAEIIMMKLIR-GTKERDLISIYGMAGLGKTTLARKVYNNPYIVNHFDVKAW  494



>gb|ACE79420.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=323

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 69/121 (57%), Gaps = 5/121 (4%)
 Frame = +2

Query  425  DEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASH  604
            D+   +C  L +     +EEI  I+ E+ +I+  +  E  +T ++  +     S+  ++ 
Sbjct  1    DDCPLWC--LERWLLDIIEEIAHIRNEVAEIRRKEIVE--ETMNNTGKTQTPSSLARSTI  56

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
              ++++G KD  E ++  L   G K + VI+ITGM G+GKTTLAR +Y D  + +HFD+R
Sbjct  57   MNDEVVGFKDVIERLRDKLV-RGTKGRDVISITGMPGLGKTTLARRLYFDKLVVSHFDIR  115

Query  785  A  787
            A
Sbjct  116  A  116



>ref|XP_010644910.1| PREDICTED: putative disease resistance protein RGA4 isoform X4 
[Vitis vinifera]
Length=1286

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +2

Query  548  TAHDVLQRFQVLSIQHASHS---KEQMIGKKD-EFEIIKKLLTEHGPKEKKVIAITGMGG  715
            T  D++   +V +    +HS   K +M+G+++ + EII KLL+  G ++  V+AI G+GG
Sbjct  139  TPRDIVLHTRVENSGRDTHSFVLKSEMVGREENKEEIIGKLLSSKGEEKLSVVAIVGIGG  198

Query  716  IGKTTLARXVYEDSPISTHFDVRAW  790
            +GKTTLA+ VY D  +  HF+ + W
Sbjct  199  LGKTTLAQLVYNDERVVNHFEFKIW  223



>emb|CAN81911.1| hypothetical protein VITISV_042289 [Vitis vinifera]
Length=1466

 Score = 62.8 bits (151),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 42/124 (34%), Positives = 66/124 (53%), Gaps = 10/124 (8%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKN---IDEAEGRKTAHDVLQRFQVLSIQHASHS  607
            P  V+ +    S +EEI A  +E+   KN   + E  G  +++ +  R    S+   S  
Sbjct  119  PSTVRFNVKMGSKIEEITARLQEISGQKNDLHLRENAG-GSSYTMKSRLPTTSLVDES--  175

Query  608  KEQMIGKKDEFEIIKKLLTEHGPKEKKV--IAITGMGGIGKTTLARXVYEDSPISTHFDV  781
              ++ G++ + E I  LL +  P + +V  I I GMGGIGKTTLA+  + D  +  HFD+
Sbjct  176  --RVYGRETDKEAILNLLLKDEPSDDEVCVIPIVGMGGIGKTTLAQLAFNDCKVEDHFDL  233

Query  782  RAWI  793
            RAW+
Sbjct  234  RAWV  237


 Score = 22.3 bits (46),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  277  VKRLETKLRDLAYRVED  327
            VK    +LRDLAY VED
Sbjct  65   VKIWLDELRDLAYDVED  81



>ref|XP_010645146.1| PREDICTED: putative disease resistance protein RGA4 isoform X2 
[Vitis vinifera]
Length=1252

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +2

Query  548  TAHDVLQRFQVLSIQHASHS---KEQMIGKKD-EFEIIKKLLTEHGPKEKKVIAITGMGG  715
            T  D++   +V +    +HS   K +M+G+++ + EII KLL+ +G ++  V+AI G+GG
Sbjct  139  TPRDIVLHTRVENSGRDTHSFVLKSEMVGREENKEEIIGKLLSSNGEEKLSVVAIVGIGG  198

Query  716  IGKTTLARXVYEDSPISTHFDVRAW  790
            +GKTTLA+ VY D  +  HF+ + W
Sbjct  199  LGKTTLAQLVYNDERVVNHFEFKIW  223



>ref|XP_010644907.1| PREDICTED: putative disease resistance protein RGA4 isoform X1 
[Vitis vinifera]
Length=1081

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +2

Query  548  TAHDVLQRFQVLSIQHASHS---KEQMIGKKD-EFEIIKKLLTEHGPKEKKVIAITGMGG  715
            T  D++   +V +    +HS   K +M+G+++ + EII KLL+  G ++  V+AI G+GG
Sbjct  25   TPRDIVLHTRVENSGRDTHSFVLKSEMVGREENKEEIIGKLLSSKGEEKLSVVAIVGIGG  84

Query  716  IGKTTLARXVYEDSPISTHFDVRAW  790
            +GKTTLA+ VY D  +  HF+ + W
Sbjct  85   LGKTTLAQLVYNDERVVNHFEFKIW  109



>ref|XP_010659153.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis 
vinifera]
 ref|XP_010659154.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis 
vinifera]
 ref|XP_010659155.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis 
vinifera]
 ref|XP_002268909.3| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis 
vinifera]
 ref|XP_010659156.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis 
vinifera]
 ref|XP_010659157.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis 
vinifera]
 ref|XP_010659158.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis 
vinifera]
Length=1329

 Score = 62.8 bits (151),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 42/124 (34%), Positives = 66/124 (53%), Gaps = 10/124 (8%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKN---IDEAEGRKTAHDVLQRFQVLSIQHASHS  607
            P  V+ +    S +EEI A  +E+   KN   + E  G  +++ +  R    S+   S  
Sbjct  119  PSTVRFNVKMGSKIEEITARLQEISGQKNDLHLRENAG-GSSYTMKSRLPTTSLVDES--  175

Query  608  KEQMIGKKDEFEIIKKLLTEHGPKEKKV--IAITGMGGIGKTTLARXVYEDSPISTHFDV  781
              ++ G++ + E I  LL +  P + +V  I I GMGGIGKTTLA+  + D  +  HFD+
Sbjct  176  --RVYGRETDKEAILNLLLKDEPSDDEVCVIPIVGMGGIGKTTLAQLAFNDCKVKDHFDL  233

Query  782  RAWI  793
            RAW+
Sbjct  234  RAWV  237


 Score = 22.3 bits (46),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  277  VKRLETKLRDLAYRVED  327
            VK    +LRDLAY VED
Sbjct  65   VKIWLDELRDLAYDVED  81



>ref|XP_008354961.1| PREDICTED: putative disease resistance protein RGA4 [Malus domestica]
Length=1133

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 52/181 (29%), Positives = 96/181 (53%), Gaps = 16/181 (9%)
 Frame = +2

Query  278  LNAWKPSSGI*LTEWKMKSKS**HTFIMKMRDLADFVLKKEKPQRDTEGDEAEPYCVKLH  457
            L+A K  +   +TEW +KS       I  + DL D    + + ++   G++   +  K+ 
Sbjct  50   LDAEKKKANHGVTEW-LKSL---EDVIYDVDDLLDEFYTEARWRQMVTGNK---FSKKVR  102

Query  458  QVFQSAMEEIEAIK-----EELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHS---KE  613
              F S+ + I  +K     +E+ +  N+ EA+ R    + L+  + +S +  SHS   KE
Sbjct  103  LFFSSSNQLIFRLKIGHKIKEIRETLNVIEADKRFQFDERLEEARFVSKERESHSFVRKE  162

Query  614  QMIGK-KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            ++IG+ KD+ EI+  LL     +   +I++ G+GG+GKT LA+ V+ D  +  HF+++ W
Sbjct  163  EIIGRDKDKREIVGLLLDPIPIENVSIISLVGIGGLGKTALAQLVFNDETVQKHFELKIW  222

Query  791  I  793
            +
Sbjct  223  V  223



>ref|XP_010319246.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=879

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 66/115 (57%), Gaps = 3/115 (3%)
 Frame = +2

Query  455  HQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHD-VLQRFQVLSIQHASHSKEQMI-GK  628
            HQ     +E+++ IK+++++  + D  +  +   D ++     ++   +  S++ ++ G 
Sbjct  91   HQDLLPVVEKMDTIKKQVMETVSHDADQVHELVGDSLIDTSSTINPMRSDKSEDDIVQGI  150

Query  629  KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             D+ EII K L    P + +++ ITGMGGIGKTTLAR  Y+   I  HFD+ AW+
Sbjct  151  DDDLEIIVKRLI-GPPSDLEIVTITGMGGIGKTTLARKAYDHLQIRYHFDILAWV  204



>gb|EYU21437.1| hypothetical protein MIMGU_mgv1a020693mg [Erythranthe guttata]
Length=916

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = +2

Query  470  SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEII  649
            + ++E+ +I EE++KIK     + + T H + Q  ++ S +  S  K  M+G  ++   I
Sbjct  157  NVVDEVCSIVEEVMKIK-----QSQNTEH-IFQVTRIFSAEVNSPRKTTMVGFDEDLMEI  210

Query  650  KKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            K  L     K  ++I + GMGGIGKTTLA  ++ D  I  HF +RAWI
Sbjct  211  KDQLCGDSSK-LQIIPLVGMGGIGKTTLATNIFHDPLIEYHFHIRAWI  257



>emb|CAN83380.1| hypothetical protein VITISV_040727 [Vitis vinifera]
Length=1317

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  644  IIKKLLTEHGPKEK--KVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            I+  LL  HGP +   +VIAITGMGG+GKTTLA+  Y    + +HFD+RAW+
Sbjct  165  IVDSLLHYHGPSDDSVRVIAITGMGGVGKTTLAQFAYNHYKVKSHFDLRAWV  216



>ref|XP_006356910.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
Length=365

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 65/115 (57%), Gaps = 8/115 (7%)
 Frame = +2

Query  452  LHQVF--QSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            LH +F     +E I+ IKEE+     I +++G    +      + + I+ +S + + ++G
Sbjct  191  LHLIFLLPDTIENIKLIKEEVPA--RISKSKGLTVGN---APSKPVEIKKSSTTGQIIVG  245

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             ++E E I + LT  GP E  VI+I GM G GKTTLA  V+ D  +  HFDVRAW
Sbjct  246  FEEETEWIIRKLTS-GPAEVDVISIVGMPGPGKTTLAYKVFNDKSVVDHFDVRAW  299



>ref|XP_004491239.1| PREDICTED: putative disease resistance protein At3g14460-like 
isoform X2 [Cicer arietinum]
Length=1260

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 57/110 (52%), Gaps = 8/110 (7%)
 Frame = +2

Query  476  MEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKK  655
            +E I A  E ++K+K+I   +   T H    R    S+ H S+    + G+  + E I K
Sbjct  125  LEVIVARLESILKLKDILNLQHIATHHHSSWRTPSTSLDHGSN----IFGRNQDIEAILK  180

Query  656  LLTEHG----PKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            LL   G      +  VI I GMGG+GKTTLA+ +Y    I   FDV+AW+
Sbjct  181  LLLHDGDDGDSDKISVIPIVGMGGVGKTTLAQSLYNHDTIKKKFDVQAWV  230



>ref|XP_004491238.1| PREDICTED: putative disease resistance protein At3g14460-like 
isoform X1 [Cicer arietinum]
Length=1269

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 57/110 (52%), Gaps = 8/110 (7%)
 Frame = +2

Query  476  MEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKK  655
            +E I A  E ++K+K+I   +   T H    R    S+ H S+    + G+  + E I K
Sbjct  125  LEVIVARLESILKLKDILNLQHIATHHHSSWRTPSTSLDHGSN----IFGRNQDIEAILK  180

Query  656  LLTEHG----PKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            LL   G      +  VI I GMGG+GKTTLA+ +Y    I   FDV+AW+
Sbjct  181  LLLHDGDDGDSDKISVIPIVGMGGVGKTTLAQSLYNHDTIKKKFDVQAWV  230



>ref|XP_009792722.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009792723.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009792725.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=1207

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 63/115 (55%), Gaps = 6/115 (5%)
 Frame = +2

Query  452  LHQVFQ--SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            LH +F     +E+I  IKE    I N+ E   +     V+        + +S + + ++G
Sbjct  427  LHLIFSLPFTIEKINLIKE---GISNLFEKIPKNMGVIVVNSPNKPVDRKSSITGKIIVG  483

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             K+E  +I + L+  GPK   VI+ITGM G GKTTLA  VY D  IS HFD+RAW
Sbjct  484  FKEETHLIIRKLSS-GPKTLDVISITGMPGSGKTTLAYKVYNDESISGHFDIRAW  537



>ref|XP_009770867.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=1228

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +2

Query  452  LHQVFQ--SAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            LH +F    A+E+I  IK+E   + N+ +   +     V+        + +S S + ++G
Sbjct  440  LHLIFSLPFAIEKISLIKKE---VSNLHKKIPKNMGVIVVNSANKPVARKSSISSKIIVG  496

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
             ++E  +I + LT  GPK   VI+ITGM G GKTTLA  VY D  +  HFD+RAW
Sbjct  497  FEEETYLIIRKLTS-GPKTLDVISITGMPGSGKTTLAHKVYNDKSVFCHFDIRAW  550



>ref|XP_009596957.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana tomentosiformis]
 ref|XP_009596958.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana tomentosiformis]
 ref|XP_009596959.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana tomentosiformis]
Length=772

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = +2

Query  605  SKEQMIG-KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDV  781
            + ++++G +KD   I+KKL    G KE  VI+I GM G+GKTTLAR VY +S I  HFDV
Sbjct  26   TDDEVVGFEKDAESIMKKL--AGGAKELDVISIFGMPGLGKTTLARKVYNNSSIVNHFDV  83

Query  782  RAWI  793
            +AWI
Sbjct  84   KAWI  87



>ref|XP_007052448.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
 gb|EOX96605.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
Length=1390

 Score = 62.0 bits (149),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 66/126 (52%), Gaps = 13/126 (10%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKN----IDEAEGRKTAHDVLQRFQVLSIQHASH  604
            P  +K      S +EEI    + +  +KN    +++A  R+    VL+R    S+ + SH
Sbjct  122  PSVIKFSSKIGSKIEEITGRLQYIAALKNDFNLVEDAGERR--QKVLRRLPTTSLVNESH  179

Query  605  SKEQMIGKKDEFEIIKKLLTEHGP---KEKKVIAITGMGGIGKTTLARXVYEDSPISTHF  775
                + G+  + + I +LL + G        V+ I GMGG+GKTTLA+ VY D+ + + F
Sbjct  180  ----IYGRDRDKQAIVELLVDSGEVGVGRIGVVPIVGMGGVGKTTLAQLVYNDARVESWF  235

Query  776  DVRAWI  793
            ++R WI
Sbjct  236  ELRVWI  241


 Score = 23.1 bits (48),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 12/31 (39%), Positives = 18/31 (58%), Gaps = 0/31 (0%)
 Frame = +1

Query  250  EERIDGVEAVKRLETKLRDLAYRVEDEIEIL  342
            EE+     AVK   + L+D+AY  +D I+ L
Sbjct  60   EEKQTTSPAVKHWLSDLKDVAYDADDVIDEL  90



>ref|XP_010644908.1| PREDICTED: putative disease resistance protein RGA4 isoform X2 
[Vitis vinifera]
 ref|XP_010644909.1| PREDICTED: putative disease resistance protein RGA4 isoform X3 
[Vitis vinifera]
Length=1073

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +2

Query  548  TAHDVLQRFQVLSIQHASHS---KEQMIGKKD-EFEIIKKLLTEHGPKEKKVIAITGMGG  715
            T  D++   +V +    +HS   K +M+G+++ + EII KLL+  G ++  V+AI G+GG
Sbjct  25   TPRDIVLHTRVENSGRDTHSFVLKSEMVGREENKEEIIGKLLSSKGEEKLSVVAIVGIGG  84

Query  716  IGKTTLARXVYEDSPISTHFDVRAW  790
            +GKTTLA+ VY D  +  HF+ + W
Sbjct  85   LGKTTLAQLVYNDERVVNHFEFKIW  109



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 52/164 (32%), Positives = 85/164 (52%), Gaps = 12/164 (7%)
 Frame = +2

Query  302  GI*LTEWKMKSKS**HTFIMKMRDLADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAME  481
            G+ L E K+K K+       ++ D+ D  L+K    ++ + D  + Y V L +  Q A+E
Sbjct  96   GLKLLEEKIKEKT------YQVEDIVDSKLRKYFLAKNAK-DRKKAYSV-LCRRLQVAIE  147

Query  482  EIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFE-IIKKL  658
            E+E +K+E + IK  D+   R     V    + +S    +  ++  +G +D+ + II +L
Sbjct  148  EMELVKKEAMTIKG-DKIRTRNFHTRVSPARRDVSTSSPNLQQQTPVGFQDDLKKIIDRL  206

Query  659  LTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
              +    E  +I I GM GIGKTTLA+  + D  +   FDVRAW
Sbjct  207  RGD--SSELDIITIVGMAGIGKTTLAKRAFNDPSVVYRFDVRAW  248



>ref|XP_006451769.1| hypothetical protein CICLE_v10007328mg [Citrus clementina]
 ref|XP_006464819.1| PREDICTED: putative disease resistance protein RGA3-like [Citrus 
sinensis]
 gb|ESR65009.1| hypothetical protein CICLE_v10007328mg [Citrus clementina]
Length=1024

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 17/121 (14%)
 Frame = +2

Query  464  FQSAME---EIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQ--VLSIQHASHS---KEQM  619
            F  A+E   +I+AI+E L  IKN       +  H + Q ++  V + +  +HS   KE +
Sbjct  113  FAYALEMGRKIKAIRERLESIKN------DRQFHLLQQPYERRVENTRRETHSFVHKEDI  166

Query  620  IGKK-DEFEIIKKLL--TEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            IG+  D+ EII +LL  +E   +   VI I G+GG+GKT +A+ VY D  + THF++R W
Sbjct  167  IGRDGDKNEIIDRLLDSSESEIESVAVIPIVGIGGLGKTAVAQLVYNDEDVKTHFNLRMW  226

Query  791  I  793
            +
Sbjct  227  V  227



>ref|XP_006367243.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=1322

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = +2

Query  425  DEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASH  604
            D+ +  C   ++      +++  + +E++ I+      G K+A   L R    S++ ++ 
Sbjct  90   DKRQKACTSFYEELLKVEQQVYFLNKEVMLIEF--NNHGSKSAE--LARISS-SLEKSTI  144

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
             +  ++G +D+F II   +T     E  VI I GMGGIGKTTLAR VY+DS I + FD +
Sbjct  145  EENTIVGMEDDFNIILDRVTTQ-TDELTVIPIFGMGGIGKTTLARKVYDDSYIRSRFDKQ  203

Query  785  AWI  793
            AW+
Sbjct  204  AWV  206



>ref|XP_010046361.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Eucalyptus 
grandis]
Length=1113

 Score = 60.5 bits (145),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 61/122 (50%), Gaps = 5/122 (4%)
 Frame = +2

Query  437  PYCVKLHQVFQSAMEEIEAIKEELVKIKNI----DEAEGRKTAHDVLQRFQVLSIQHASH  604
            P         +S MEE+++  ++++  K+I    +  E R     V +     ++     
Sbjct  117  PRAFMFDHTMRSKMEEMDSRLKDIITHKDILHLRENNEKRSAYRQVDKPLHTTNLPEPCF  176

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
               + + KK+  E++ K   +    + KVI I GMGG+GKT LA+ VY D  ++ +FDV+
Sbjct  177  VSRE-VEKKEILELLTKEENDRACVDPKVIPIVGMGGLGKTALAQHVYNDDRVTDYFDVK  235

Query  785  AW  790
            AW
Sbjct  236  AW  237


 Score = 24.3 bits (51),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +1

Query  232  LISQHDEERIDGVEAVKRLETKLRDLAYRVED  327
            ++   ++ +++G   V      LRDLAY +ED
Sbjct  50   VLDDAEDRQLNGDLGVNSWLKNLRDLAYDIED  81



>gb|AEW48210.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=904

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +2

Query  578  VLSIQHASHSKEQ-MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYED  754
            V S +HA    E  M+G+++EFE++   L   G +E +V++I GMGGIGKTTLA  +Y D
Sbjct  128  VSSPEHAVEQPENIMVGRENEFEVMLDQLVRGG-RELEVVSIVGMGGIGKTTLATKLYSD  186

Query  755  SPISTHFDVRA  787
              I + FD+RA
Sbjct  187  PYIMSRFDIRA  197



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 52/164 (32%), Positives = 85/164 (52%), Gaps = 12/164 (7%)
 Frame = +2

Query  302  GI*LTEWKMKSKS**HTFIMKMRDLADFVLKKEKPQRDTEGDEAEPYCVKLHQVFQSAME  481
            G+ L E K+K K+       ++ D+ D  L+K    ++ + D  + Y V L +  Q A+E
Sbjct  111  GLKLLEEKIKEKT------YQVEDIVDSKLRKYFLAKNAK-DRKKAYSV-LCRRLQVAIE  162

Query  482  EIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFE-IIKKL  658
            E+E +K+E + IK  D+   R     V    + +S    +  ++  +G +D+ + II +L
Sbjct  163  EMELVKKEAMTIKG-DKIRTRNFHTRVSPARRDVSTSSPNLQQQTPVGFQDDLKKIIDRL  221

Query  659  LTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
              +    E  +I I GM GIGKTTLA+  + D  +   FDVRAW
Sbjct  222  RGD--SSELDIITIVGMAGIGKTTLAKRAFNDPSVVYRFDVRAW  263



>ref|XP_006365680.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X1 [Solanum tuberosum]
Length=881

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = +2

Query  425  DEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASH  604
            D+ +  C   +Q      E++  + +E+++I+      G K+A   L R    S++ ++ 
Sbjct  89   DKRQKACTSFYQELLKVEEQVYFLNKEVMQIEF--NNHGSKSAE--LARISS-SLEKSTI  143

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
             +  ++G +D+F  I   +T     E  VI I GMGGIGKTTLAR  Y+DS I + FD  
Sbjct  144  EENTVVGMEDDFNTILDRVTAQ-TDELTVIPIFGMGGIGKTTLARKAYDDSYIQSRFDKH  202

Query  785  AWI  793
            AW+
Sbjct  203  AWV  205



>gb|EYU31457.1| hypothetical protein MIMGU_mgv1a017859mg, partial [Erythranthe 
guttata]
Length=810

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 57/116 (49%), Gaps = 7/116 (6%)
 Frame = +2

Query  446  VKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            V+        M +I++I  E+ ++K +              RFQ      +S  KE M+G
Sbjct  91   VEFRSQLSGLMMQIDSISGEVDRMKRVPLGNYESNVVTSSLRFQ------SSRKKEAMVG  144

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
              D+   I ++L     K  +V+ I GMGGIGKTTLA   Y D  I+ HF +RAW+
Sbjct  145  FDDDLMAIYEMLCGQSSK-LQVLPIVGMGGIGKTTLAAHAYNDPLITEHFHIRAWV  199



>gb|ACE79451.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  512  KIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKV  691
            K+KNI + + +  +        V + +H    +++M+G ++EFE+++  L   G +E +V
Sbjct  6    KLKNIQDLKAQDLS-------LVSTSRHGLEPEDKMVGLENEFEMVQDQLA-RGARELEV  57

Query  692  IAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++I GMGGIGK TLA  +Y D  + +HF +RA
Sbjct  58   VSIVGMGGIGKITLANKIYSDPFMMSHFGIRA  89



>ref|XP_007009923.1| NBS type disease resistance protein, putative [Theobroma cacao]
 gb|EOY18733.1| NBS type disease resistance protein, putative [Theobroma cacao]
Length=1263

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 43/113 (38%), Positives = 60/113 (53%), Gaps = 13/113 (12%)
 Frame = +2

Query  470  SAMEEIEAIKEELVKIKNI---DEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEF  640
            S +EEI    E LV  K+I    E+ G K+    +QR    S+   S     + G+ DE 
Sbjct  124  SKLEEILETLERLVNQKDILGLKESTGEKS----IQRLPATSLVDES----GVYGRHDEK  175

Query  641  EIIKKLLTEH--GPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
            E I +LL        +  VI I GMGG+GKTTLA+ +Y D  ++  FDV+AW+
Sbjct  176  EAIMELLNPEYASANQIDVIPIVGMGGVGKTTLAQLIYNDKRVAEWFDVKAWV  228



>gb|ABB00481.1| I2, partial [Solanum tuberosum]
Length=228

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +2

Query  617  MIGKKDEFE-IIKKLLTEHGP-KEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            ++G+++E E +I +LL+  G  K   VI + GMGG+GKTTLA+ VY D  +  HFD++AW
Sbjct  14   ILGRQNETEDLIGRLLSGDGNGKNLTVIPVVGMGGVGKTTLAKAVYNDESVEKHFDLKAW  73

Query  791  IVA  799
            I  
Sbjct  74   ICV  76



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 56/106 (53%), Gaps = 1/106 (1%)
 Frame = +2

Query  476  MEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIGKKDEFEIIKK  655
            ME++ +I  E++K+K+   A       +VL    +         K  ++G   + E IK 
Sbjct  316  MEDVISITREVIKVKDTFGAGEGLWHSNVLPGASLSRRDSGGVRKNVVVGFDKDLEQIKT  375

Query  656  LLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
               +   K  ++I+I GMGGIGKTTLAR VY+D  I  HFD R W+
Sbjct  376  QWIDDSSK-LEIISIVGMGGIGKTTLARQVYDDPSIFYHFDTRGWV  420



>ref|XP_011072647.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=541

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  608  KEQMIGKKDEF-EIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            K+ M+G+ D   EI+ KL  +    +  +I I GMGGIGKTTLAR VYE+  I  +FD+R
Sbjct  157  KQAMVGRDDALNEIMDKLTRQQS--DCLIIPIVGMGGIGKTTLARNVYENPLIVEYFDIR  214

Query  785  AWI  793
            AW+
Sbjct  215  AWV  217



>ref|XP_008350673.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=543

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 11/117 (9%)
 Frame = +2

Query  461  VFQSAM-EEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHS---KEQMIGK  628
            VF+  M  +I+ I+E L    N+ E + R    + LQ  +VL+ +  SHS   KE++IG+
Sbjct  112  VFRLKMGHKIKEIRETL----NVIETDRRFHLDERLQEARVLTRERESHSFVRKEEIIGR  167

Query  629  -KDEFEIIKKLLTEHGPKEK-KVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             +D+ EI++ L+ +  PKE   +I++ G+GG+GKT LA+ V+ D  +  HF+++ WI
Sbjct  168  DRDKREIVQ-LMLDPIPKENVSIISLVGIGGLGKTALAQLVFNDETVQKHFELKIWI  223



>ref|XP_011091324.1| PREDICTED: probable disease resistance protein At1g58602 [Sesamum 
indicum]
Length=926

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 41/122 (34%), Positives = 64/122 (52%), Gaps = 6/122 (5%)
 Frame = +2

Query  440  YCV---KLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRK--TAHDVLQRFQVLSIQHASH  604
            YC     LH+        I+ +K  +  +  +  A  R+  ++ ++ ++ QV+   +  H
Sbjct  103  YCFTGRSLHKDLYIFRSRIDQLKHFMDAVNPVARAGARQISSSSNLDEQEQVIG-ANIDH  161

Query  605  SKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            S   +IG ++  E ++  L   G  E  VIAI GMGGIGKTTLA+ +Y D  +  HFD R
Sbjct  162  SPPVLIGMEENKERLRSYLLGGGKPELSVIAIRGMGGIGKTTLAKLLYNDPLLVKHFDNR  221

Query  785  AW  790
            AW
Sbjct  222  AW  223



>gb|ACF22032.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=289

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 66/118 (56%), Gaps = 15/118 (13%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVKI---KNIDEAE---GRKTAHDVLQRFQVLSIQHASHSKE  613
            L +     +EEI  I+ E+V+I   K ++EA    G+      L R  +++        +
Sbjct  6    LERWLLDIIEEIAHIRNEVVEIQGKKIVEEARNNTGKTQTPSSLARSTIMN--------D  57

Query  614  QMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            +++G KD  E ++  L   G K + VI+ITGM G+GKTTLAR +Y D  + +HFD+RA
Sbjct  58   EVVGFKDVIEKLRDKLI-RGTKGRDVISITGMPGLGKTTLARRLYSDKLVVSHFDIRA  114



>ref|XP_010101172.1| Putative disease resistance protein [Morus notabilis]
 gb|EXB87533.1| Putative disease resistance protein [Morus notabilis]
Length=376

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  611  EQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            ++++G     + + K LTE GP  + VI++ G GGIGKTTLAR VY D  +  HFD RAW
Sbjct  167  DEIVGIDGPLKELIKGLTE-GPSMRSVISLVGQGGIGKTTLARKVYNDEVVKAHFDCRAW  225

Query  791  I  793
            I
Sbjct  226  I  226



>emb|CDP17557.1| unnamed protein product [Coffea canephora]
Length=1174

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +2

Query  608  KEQMIGK-KDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVR  784
            +  ++G+ KDE EI+KKLLTE       VI +TGMGG+GKTTLA+ +YE+  I  HFD +
Sbjct  150  RRDVLGRDKDESEIVKKLLTE-SESVISVIPVTGMGGLGKTTLAKAIYENEQIVGHFDKK  208

Query  785  AWI  793
             W+
Sbjct  209  IWV  211



>gb|KDO47604.1| hypothetical protein CISIN_1g036079mg [Citrus sinensis]
Length=1399

 Score = 60.1 bits (144),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 67/137 (49%), Gaps = 22/137 (16%)
 Frame = +2

Query  425  DEAEPYCVKLHQVFQSAMEEIEAIKE------------ELVKIKNIDEAEGRKTAHDVLQ  568
            DE E   ++   + Q      +A+KE             L+K+KN+       T+  + Q
Sbjct  82   DEFETEALRREMLLQGPAAADQAVKEVTARLQDIERDINLLKLKNVISG---GTSRSIAQ  138

Query  569  RFQVLSIQHASHSKEQMIGKKDEFEIIKKLLTEHGPKEK---KVIAITGMGGIGKTTLAR  739
            R    S+ + +    ++ G++ + E I +LL     +      VI+I GMGG+GKTTLA+
Sbjct  139  RLPTTSLVNEA----KVYGREKDKEAIVELLLRDDLRADDGFSVISINGMGGVGKTTLAQ  194

Query  740  XVYEDSPISTHFDVRAW  790
             VY D  +  HF+++AW
Sbjct  195  LVYNDDRVQRHFEIKAW  211


 Score = 24.6 bits (52),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +1

Query  250  EERIDGVEAVKRLETKLRDLAYRVED  327
            E+R    ++VK+   KL++LAY VED
Sbjct  54   EDRQTKDKSVKKWLDKLQNLAYDVED  79



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 46/116 (40%), Positives = 66/116 (57%), Gaps = 13/116 (11%)
 Frame = +2

Query  455  HQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLS--IQHASHSKEQMIGK  628
            HQ F   +EEI++IK E+V++        +K+  D  ++F + S     A     +++G 
Sbjct  105  HQSFSQIVEEIKSIKSEVVQLFE------KKSISD--RKFTMPSDFTPIAEEDSNKLVGL  156

Query  629  KDEFEIIKKLLTEHG-PKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
             D + I+K L    G P +++VI I GMGGIGKTTLA  +Y D  I  HF VRAWI
Sbjct  157  -DAY-ILKLLHQLSGFPLDRQVIPIVGMGGIGKTTLAERIYNDPFIIYHFYVRAWI  210



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 61/116 (53%), Gaps = 9/116 (8%)
 Frame = +2

Query  452  LHQVFQSAMEEIEAIKEELVK--IKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG  625
            L ++ Q  +E ++++KEEL+K    N  +A           R   L++++       M+G
Sbjct  98   LSEILQRGIENVDSLKEELIKDSQNNTSQAGNSALGDSSSPRLHALTLEN------DMVG  151

Query  626  KKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAWI  793
               E   +   LT   P E +VI++TGMGGIGK+T A+ ++    I + FD+R WI
Sbjct  152  YNIEQANMLSRLTSGSP-ELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWI  206



>gb|ABB00515.1| I2, partial [Solanum demissum]
Length=239

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +2

Query  614  QMIGKKDEFE-IIKKLLTEHG-PKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++ G+++E E +I +LL+E G  K   VI + GMGG+GKTTLA+ VY D  +  HF ++A
Sbjct  13   EIFGRQNEIEELIDRLLSEDGHGKNLTVIPVVGMGGVGKTTLAKSVYNDEKVKKHFGLKA  72

Query  788  WI  793
            WI
Sbjct  73   WI  74



>gb|ABB00490.1| I2, partial [Solanum demissum]
 gb|ABB00516.1| I2, partial [Solanum demissum]
Length=239

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +2

Query  614  QMIGKKDEFE-IIKKLLTEHG-PKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++ G+++E E +I +LL+E G  K   VI + GMGG+GKTTLA+ VY D  +  HF ++A
Sbjct  13   EIFGRQNEIEELIDRLLSEDGHGKNLTVIPVVGMGGVGKTTLAKSVYNDEKVKKHFGLKA  72

Query  788  WI  793
            WI
Sbjct  73   WI  74



>gb|ABB00524.1| I2, partial [Solanum demissum]
Length=239

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +2

Query  614  QMIGKKDEFE-IIKKLLTEHG-PKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRA  787
            ++ G+++E E +I +LL+E G  K   VI + GMGG+GKTTLA+ VY D  +  HF ++A
Sbjct  13   EIFGRQNEIEELIDRLLSEDGHGKNLTVIPVVGMGGVGKTTLAKSVYNDEKVKKHFGLKA  72

Query  788  WI  793
            WI
Sbjct  73   WI  74



>gb|KDO49259.1| hypothetical protein CISIN_1g001955mg [Citrus sinensis]
Length=991

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 17/121 (14%)
 Frame = +2

Query  464  FQSAME---EIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQ--VLSIQHASHS---KEQM  619
            F  A+E   +I+AI+E L  IKN       +  H + Q ++  V + +  +HS   KE +
Sbjct  113  FAYALEMGRKIKAIRERLESIKN------DRQFHLLQQPYERRVENTRRETHSFVHKEDI  166

Query  620  IGKK-DEFEIIKKLL--TEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            IG+  D+ EII +LL  +E   +   VI I G+GG+GKT +A+ VY D  + THF++R W
Sbjct  167  IGRDGDKNEIIDRLLDSSESEIESVAVIPIVGIGGLGKTAVAQLVYNDEDVKTHFNLRMW  226

Query  791  I  793
            +
Sbjct  227  V  227



>ref|XP_010321918.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Solanum lycopersicum]
Length=515

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +2

Query  617  MIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            ++G ++E  +I + LT +GP +  VI ITGM G GKTTLA  VY D  +S+HFD+RAW
Sbjct  42   IVGFEEETNLILRKLT-NGPADLDVIWITGMPGSGKTTLAYKVYNDKSVSSHFDLRAW  98



>gb|KJB75066.1| hypothetical protein B456_012G021900 [Gossypium raimondii]
Length=780

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 71/133 (53%), Gaps = 12/133 (9%)
 Frame = +2

Query  410  RDTEGDEAEPYCVKLHQVFQSAMEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSI  589
            +D E  + +   V+L  V   A++ ++    E+++ K     E R   + +L++F  +  
Sbjct  50   QDAEEKQTKNTSVRLEDVAYEAVDVLDEFAYEILRRK----VEIR---NQILRKFLRMED  102

Query  590  QHASHSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIA---ITGMGGIGKTTLARXVYEDSP  760
            Q   H    ++G+K +   +  LL    PK+K+V++   I GM G+GKTTLA+ VY+D  
Sbjct  103  QRWRHDHSNIVGRKHDVSKVVNLLV--NPKDKQVVSVVPIVGMAGLGKTTLAKLVYDDMN  160

Query  761  ISTHFDVRAWIVA  799
            + T FDV+ W+  
Sbjct  161  VKTLFDVKFWVCV  173



>ref|XP_006356561.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=767

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +2

Query  602  HSKEQMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDV  781
            +  +Q++G + + EII   L   G KE+ VI+I GM G+GKTTLAR VY +  I  HFDV
Sbjct  27   YDNDQVVGFEKDAEIIMMKLIR-GTKERDVISIYGMPGLGKTTLARKVYNNPYIVNHFDV  85

Query  782  RAW  790
            +AW
Sbjct  86   KAW  88



>gb|AGX27504.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=373

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 59/106 (56%), Gaps = 7/106 (7%)
 Frame = +2

Query  476  MEEIEAIKEELVKIKNIDEAEGRKTAHDVLQRFQVLSIQHASHSKEQMIG-KKDEFEIIK  652
            MEEI +I E ++ I+N    E  + ++       V S   A +   +M+G  +D  E+  
Sbjct  107  MEEINSIVERVMNIQNNCAVEDVQCSYTS----AVPSSGGAPNDGNKMVGFNEDLLELKA  162

Query  653  KLLTEHGPKEKKVIAITGMGGIGKTTLARXVYEDSPISTHFDVRAW  790
            +L  E    + ++I+I GMGGIGKTTLA  ++ DS ++ HF VR W
Sbjct  163  RLCGE--SSKLQIISIVGMGGIGKTTLATNIFNDSLVAYHFHVRVW  206



>ref|XP_008652942.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Zea 
mays]
 tpg|DAA62316.1| TPA: hypothetical protein ZEAMMB73_797089 [Zea mays]
Length=352

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 6/74 (8%)
 Frame = +2

Query  590  QHASHSKE------QMIGKKDEFEIIKKLLTEHGPKEKKVIAITGMGGIGKTTLARXVYE  751
            +H  HS E       +IG+ D+   + K+L        +V+++ GMGG+GK++LAR V+ 
Sbjct  157  EHYEHSAELAFQVSDIIGRDDDINAVAKMLLSRNNGALRVLSVWGMGGMGKSSLARMVHN  216

Query  752  DSPISTHFDVRAWI  793
            DS +   FD RAWI
Sbjct  217  DSDVLAEFDCRAWI  230



>ref|XP_003599591.1| NBS-LRR type disease resistance protein [Medicago truncatula]
 gb|AES69842.1| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=540

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 3/67 (4%)
 Frame = +2

Query  605  SKEQMIGKKDEFE-IIKKLLTEHGPKEKK--VIAITGMGGIGKTTLARXVYEDSPISTHF  775
            +K  M+G+KD+ E +I  L+++ G       V+AI GMGG+GKTTLA+ +Y D  +  HF
Sbjct  166  NKSVMVGRKDDKERLISMLISDSGTTNSSIGVVAILGMGGVGKTTLAQLLYNDKEVQDHF  225

Query  776  DVRAWIV  796
            D++ W+ 
Sbjct  226  DLKVWVC  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876