BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2118

Length=1236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010266382.1|  PREDICTED: uncharacterized protein LOC104603913    107   3e-25   
gb|KHN26122.1|  hypothetical protein glysoja_019446                     107   7e-25   Glycine soja [wild soybean]
ref|XP_010272947.1|  PREDICTED: uncharacterized protein LOC104608609    106   8e-25   
ref|XP_011077451.1|  PREDICTED: uncharacterized protein LOC105161457    105   1e-24   
ref|XP_009383576.1|  PREDICTED: uncharacterized protein LOC103971311    103   6e-24   
gb|ERN02911.1|  hypothetical protein AMTR_s00135p00067350               103   6e-24   Amborella trichopoda
ref|XP_006386421.1|  hypothetical protein POPTR_0002s10360g             103   7e-24   
ref|XP_007141245.1|  hypothetical protein PHAVU_008G179600g             103   8e-24   Phaseolus vulgaris [French bean]
ref|XP_008782188.1|  PREDICTED: uncharacterized protein LOC103701792    103   8e-24   
ref|XP_006596366.1|  PREDICTED: uncharacterized protein LOC102666651    103   8e-24   
ref|XP_006578267.1|  PREDICTED: uncharacterized protein LOC102668102    103   1e-23   
ref|XP_006575346.1|  PREDICTED: uncharacterized protein LOC100812109    102   1e-23   
ref|XP_009380229.1|  PREDICTED: uncharacterized protein LOC103968664    102   1e-23   
ref|XP_009393555.1|  PREDICTED: uncharacterized protein LOC103979216    102   2e-23   
ref|XP_009413584.1|  PREDICTED: uncharacterized protein LOC103994862    102   3e-23   
ref|XP_006581498.1|  PREDICTED: uncharacterized protein LOC100795187    101   3e-23   
gb|KJB27526.1|  hypothetical protein B456_005G224400                    101   5e-23   Gossypium raimondii
ref|XP_008795183.1|  PREDICTED: uncharacterized protein LOC103711002    101   5e-23   
gb|KGN43769.1|  hypothetical protein Csa_7G066260                       100   6e-23   Cucumis sativus [cucumbers]
ref|XP_011092444.1|  PREDICTED: uncharacterized protein LOC105172623  99.8    2e-22   
ref|XP_007148379.1|  hypothetical protein PHAVU_006G203500g           99.0    4e-22   Phaseolus vulgaris [French bean]
gb|KJB64180.1|  hypothetical protein B456_010G035900                    106   4e-22   Gossypium raimondii
ref|XP_010094825.1|  hypothetical protein L484_011398                   105   1e-21   
gb|KJB58933.1|  hypothetical protein B456_009G231400                    105   1e-21   Gossypium raimondii
ref|XP_009389558.1|  PREDICTED: uncharacterized protein LOC103976096  97.1    2e-21   
gb|KGN53735.1|  hypothetical protein Csa_4G113180                     97.1    2e-21   Cucumis sativus [cucumbers]
ref|XP_006597359.1|  PREDICTED: uncharacterized protein LOC100778385  95.9    4e-21   
ref|XP_008219386.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    103   7e-21   
ref|XP_003529257.1|  PREDICTED: uncharacterized protein LOC100790...  95.1    8e-21   
gb|KHG02368.1|  hypothetical protein F383_26115                         103   1e-20   Gossypium arboreum [tree cotton]
ref|XP_007159129.1|  hypothetical protein PHAVU_002G211300g           94.7    1e-20   Phaseolus vulgaris [French bean]
ref|XP_003531022.1|  PREDICTED: uncharacterized protein LOC100817...  94.7    1e-20   
ref|XP_007018175.1|  Transcription factor, putative isoform 1           102   2e-20   
ref|XP_006420846.1|  hypothetical protein CICLE_v10006528mg           93.2    5e-20   
ref|XP_007042873.1|  Sequence-specific DNA binding transcription ...  99.0    3e-19   
ref|NP_001119403.1|  conserved peptide upstream open reading fram...  86.3    1e-17   
ref|XP_003615245.1|  Transcription factor bHLH143                     94.0    2e-17   
gb|AES98203.2|  transcription factor                                  94.0    2e-17   Medicago truncatula
gb|EPS71309.1|  hypothetical protein M569_03455                       85.1    4e-17   Genlisea aurea
ref|XP_006399425.1|  hypothetical protein EUTSA_v10015558mg           85.1    4e-17   
emb|CDY46795.1|  BnaC02g43030D                                        84.7    6e-17   Brassica napus [oilseed rape]
ref|XP_006394164.1|  hypothetical protein EUTSA_v10005432mg           83.2    2e-16   
ref|NP_001119196.1|  conserved peptide upstream open reading fram...  82.4    5e-16   
ref|XP_002873402.1|  expressed protein                                82.4    5e-16   
ref|XP_010098655.1|  hypothetical protein L484_026030                 83.2    5e-16   
emb|CDY58273.1|  BnaAnng15160D                                        81.3    1e-15   Brassica napus [oilseed rape]
ref|NP_001119490.1|  conserved peptide upstream open reading fram...  77.4    3e-14   
emb|CAN73178.1|  hypothetical protein VITISV_039910                   83.2    5e-14   Vitis vinifera
emb|CDX69901.1|  BnaA10g22500D                                        76.6    7e-14   
ref|XP_010230140.1|  PREDICTED: uncharacterized protein LOC104582358  79.7    8e-14   
ref|XP_002514013.1|  transcription factor, putative                   81.3    3e-13   
ref|XP_011023035.1|  PREDICTED: transcription factor bHLH143-like...  80.5    4e-13   Populus euphratica
ref|XP_004490481.1|  PREDICTED: uncharacterized protein LOC101514416  73.2    1e-12   
ref|XP_011043085.1|  PREDICTED: transcription factor bHLH143-like...  78.6    2e-12   Populus euphratica
ref|XP_002522619.1|  transcription factor, putative                   78.6    2e-12   
gb|KHF99744.1|  Transcription factor protein                          78.6    2e-12   Gossypium arboreum [tree cotton]
emb|CDX84516.1|  BnaC03g49840D                                        77.8    2e-12   
emb|CDY21584.1|  BnaC09g47080D                                        75.1    2e-11   Brassica napus [oilseed rape]
ref|XP_006433862.1|  hypothetical protein CICLE_v10003720mg           67.0    1e-10   
ref|XP_003593246.1|  Transcription factor bHLH143                     68.2    5e-09   
gb|EEC75395.1|  hypothetical protein OsI_11883                        57.8    1e-05   Oryza sativa Indica Group [Indian rice]
gb|EEE59187.1|  hypothetical protein OsJ_11123                        55.8    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232047.1|  PREDICTED: uncharacterized protein LOC104582815  51.6    4e-05   
emb|CDP11476.1|  unnamed protein product                              51.2    5e-05   Coffea canephora [robusta coffee]



>ref|XP_010266382.1| PREDICTED: uncharacterized protein LOC104603913 [Nelumbo nucifera]
 ref|XP_010266391.1| PREDICTED: uncharacterized protein LOC104603913 [Nelumbo nucifera]
 ref|XP_010664372.1| PREDICTED: uncharacterized protein LOC100241943 isoform X2 [Vitis 
vinifera]
Length=53

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  53



>gb|KHN26122.1| hypothetical protein glysoja_019446 [Glycine soja]
Length=84

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  737  QVVMVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            +VVMV QAAS+TRFRALKHENG AGS+TIIVRVIACFQPL DCQAEYFRHLLKPVT
Sbjct  29   KVVMVCQAASQTRFRALKHENGYAGSSTIIVRVIACFQPLTDCQAEYFRHLLKPVT  84



>ref|XP_010272947.1| PREDICTED: uncharacterized protein LOC104608609 [Nelumbo nucifera]
Length=53

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AG+ATIIVRVIACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGNATIIVRVIACFQPLQDCQAEYFRHLLKPVT  53



>ref|XP_011077451.1| PREDICTED: uncharacterized protein LOC105161457 [Sesamum indicum]
 ref|XP_011077452.1| PREDICTED: uncharacterized protein LOC105161457 [Sesamum indicum]
Length=53

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AG ATIIVRVIACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGCATIIVRVIACFQPLQDCQAEYFRHLLKPVT  53



>ref|XP_009383576.1| PREDICTED: uncharacterized protein LOC103971311 [Musa acuminata 
subsp. malaccensis]
Length=53

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAA++TRFRALKHENG+AGS TIIVRVIACF+PLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAATRTRFRALKHENGIAGSTTIIVRVIACFRPLQDCQAEYFRHLLKPVT  53



>gb|ERN02911.1| hypothetical protein AMTR_s00135p00067350 [Amborella trichopoda]
Length=53

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALK+ENG+AGSA IIVRVIACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKYENGIAGSAAIIVRVIACFQPLQDCQAEYFRHLLKPVT  53



>ref|XP_006386421.1| hypothetical protein POPTR_0002s10360g [Populus trichocarpa]
 ref|XP_006383513.1| hypothetical protein POPTR_0005s17700g [Populus trichocarpa]
 gb|ERP61310.1| hypothetical protein POPTR_0005s17700g [Populus trichocarpa]
 gb|ERP64218.1| hypothetical protein POPTR_0002s10360g [Populus trichocarpa]
Length=53

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+T FRALKHENG+AG ATIIVRVIACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTNFRALKHENGIAGCATIIVRVIACFQPLQDCQAEYFRHLLKPVT  53



>ref|XP_007141245.1| hypothetical protein PHAVU_008G179600g [Phaseolus vulgaris]
 gb|ESW13239.1| hypothetical protein PHAVU_008G179600g [Phaseolus vulgaris]
Length=53

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AGSATIIVRV+ACFQPL DCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGSATIIVRVMACFQPLIDCQAEYFRHLLKPVT  53



>ref|XP_008782188.1| PREDICTED: uncharacterized protein LOC103701792 [Phoenix dactylifera]
 ref|XP_008782189.1| PREDICTED: uncharacterized protein LOC103701792 [Phoenix dactylifera]
Length=53

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAA+++RFRALKHENG+AGSATIIVR+IACFQPLQDCQA+YFRHLLKPVT
Sbjct  1    MVCQAATQSRFRALKHENGIAGSATIIVRIIACFQPLQDCQAQYFRHLLKPVT  53



>ref|XP_006596366.1| PREDICTED: uncharacterized protein LOC102666651 [Glycine max]
Length=53

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG AGS+TIIVRVIACFQPL DCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGTAGSSTIIVRVIACFQPLTDCQAEYFRHLLKPVT  53



>ref|XP_006578267.1| PREDICTED: uncharacterized protein LOC102668102 [Glycine max]
 ref|XP_007136355.1| hypothetical protein PHAVU_009G038300g [Phaseolus vulgaris]
 gb|ESW08349.1| hypothetical protein PHAVU_009G038300g [Phaseolus vulgaris]
Length=53

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AGS+TIIVRVIACFQPL++CQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGSSTIIVRVIACFQPLRECQAEYFRHLLKPVT  53



>ref|XP_006575346.1| PREDICTED: uncharacterized protein LOC100812109 [Glycine max]
Length=53

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG AGS+TIIVRVIACFQPL DCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGYAGSSTIIVRVIACFQPLTDCQAEYFRHLLKPVT  53



>ref|XP_009380229.1| PREDICTED: uncharacterized protein LOC103968664 [Musa acuminata 
subsp. malaccensis]
Length=53

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAA++TRFRALKHE+G+AGS+TIIVR+IACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAAAQTRFRALKHESGIAGSSTIIVRIIACFQPLQDCQAEYFRHLLKPVT  53



>ref|XP_009393555.1| PREDICTED: uncharacterized protein LOC103979216 [Musa acuminata 
subsp. malaccensis]
Length=53

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAA++TRFRALKHENG+AGS+TIIVRVIACFQPLQ CQAEYFRHLLKPVT
Sbjct  1    MVCQAAAQTRFRALKHENGIAGSSTIIVRVIACFQPLQHCQAEYFRHLLKPVT  53



>ref|XP_009413584.1| PREDICTED: uncharacterized protein LOC103994862 [Musa acuminata 
subsp. malaccensis]
Length=53

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAA++T FRALKHENG+AGS TIIVRV+ACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAATRTTFRALKHENGIAGSTTIIVRVLACFQPLQDCQAEYFRHLLKPVT  53



>ref|XP_006581498.1| PREDICTED: uncharacterized protein LOC100795187 [Glycine max]
Length=53

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AGS+TIIV+VIACFQPL++CQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGSSTIIVKVIACFQPLRECQAEYFRHLLKPVT  53



>gb|KJB27526.1| hypothetical protein B456_005G224400 [Gossypium raimondii]
Length=53

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AG  TI+VRVIACFQP++DCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGKPTIVVRVIACFQPMEDCQAEYFRHLLKPVT  53



>ref|XP_008795183.1| PREDICTED: uncharacterized protein LOC103711002 [Phoenix dactylifera]
Length=53

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAA++TRFRALKHE+G+AGS+TIIVR+IACFQPL+DCQAEYFRHLLKPVT
Sbjct  1    MVCQAATQTRFRALKHESGIAGSSTIIVRIIACFQPLRDCQAEYFRHLLKPVT  53



>gb|KGN43769.1| hypothetical protein Csa_7G066260 [Cucumis sativus]
Length=53

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AG  TIIV+VIACFQPLQ+CQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGKPTIIVKVIACFQPLQNCQAEYFRHLLKPVT  53



>ref|XP_011092444.1| PREDICTED: uncharacterized protein LOC105172623 [Sesamum indicum]
 ref|XP_011092445.1| PREDICTED: uncharacterized protein LOC105172623 [Sesamum indicum]
Length=53

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHE+G+AG  TIIVRVIACFQPLQ+CQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHEHGIAGRTTIIVRVIACFQPLQNCQAEYFRHLLKPVT  53



>ref|XP_007148379.1| hypothetical protein PHAVU_006G203500g [Phaseolus vulgaris]
 gb|ESW20373.1| hypothetical protein PHAVU_006G203500g [Phaseolus vulgaris]
Length=53

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFR LKHENG+ G  TIIVRVIACFQPL DCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRTLKHENGIEGEPTIIVRVIACFQPLHDCQAEYFRHLLKPVT  53



>gb|KJB64180.1| hypothetical protein B456_010G035900, partial [Gossypium raimondii]
Length=382

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALK+ENG+AGSATI+VRVIACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKYENGIAGSATIVVRVIACFQPLQDCQAEYFRHLLKPVT  53



>ref|XP_010094825.1| hypothetical protein L484_011398 [Morus notabilis]
 gb|EXB57311.1| hypothetical protein L484_011398 [Morus notabilis]
Length=423

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AG  TIIVRVIACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGKPTIIVRVIACFQPLQDCQAEYFRHLLKPVT  53



>gb|KJB58933.1| hypothetical protein B456_009G231400, partial [Gossypium raimondii]
Length=403

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAA++TRFRALK+ENG+AGSATI+VRVIACFQPLQDCQAEYFRHLLKPVT
Sbjct  1    MVCQAATQTRFRALKYENGIAGSATIVVRVIACFQPLQDCQAEYFRHLLKPVT  53



>ref|XP_009389558.1| PREDICTED: uncharacterized protein LOC103976096 [Musa acuminata 
subsp. malaccensis]
Length=53

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QA + TRFRALKHENG+AGS T+ VRVIACF+PLQDCQ EYFRHLLKP+T
Sbjct  1    MVCQAVTSTRFRALKHENGIAGSTTVTVRVIACFRPLQDCQVEYFRHLLKPIT  53



>gb|KGN53735.1| hypothetical protein Csa_4G113180 [Cucumis sativus]
Length=53

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAA++TRFRALKHENG+AG  TIIVRVIACFQPLQ+CQA+YFR LLKPVT
Sbjct  1    MVCQAATQTRFRALKHENGIAGKPTIIVRVIACFQPLQNCQAKYFRQLLKPVT  53



>ref|XP_006597359.1| PREDICTED: uncharacterized protein LOC100778385 [Glycine max]
 gb|KHN33551.1| hypothetical protein glysoja_005593 [Glycine soja]
Length=53

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHE+G+ G   IIVRVIACFQPL DCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHESGIKGEPAIIVRVIACFQPLHDCQAEYFRHLLKPVT  53



>ref|XP_008219386.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH145-like 
[Prunus mume]
Length=430

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKP  898
            MV QAAS+TRFRALKHENG+ GSATIIVRVIACFQPLQDCQAEYFRHLLKP
Sbjct  1    MVCQAASQTRFRALKHENGIDGSATIIVRVIACFQPLQDCQAEYFRHLLKP  51



>ref|XP_003529257.1| PREDICTED: uncharacterized protein LOC100790978 isoform X1 [Glycine 
max]
 ref|XP_006583769.1| PREDICTED: uncharacterized protein LOC100790978 isoform X2 [Glycine 
max]
Length=53

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHE G+ G+ATIIVRVIACFQPL  CQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHEYGIDGAATIIVRVIACFQPLHFCQAEYFRHLLKPVT  53



>gb|KHG02368.1| hypothetical protein F383_26115 [Gossypium arboreum]
Length=443

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHENG+AG  TI+VRVIACFQP++DCQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHENGIAGKPTIVVRVIACFQPMEDCQAEYFRHLLKPVT  53



>ref|XP_007159129.1| hypothetical protein PHAVU_002G211300g [Phaseolus vulgaris]
 gb|ESW31123.1| hypothetical protein PHAVU_002G211300g [Phaseolus vulgaris]
Length=53

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHE G+ G ATIIVRVIACFQPL  CQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHEYGINGEATIIVRVIACFQPLHFCQAEYFRHLLKPVT  53



>ref|XP_003531022.1| PREDICTED: uncharacterized protein LOC100817942 isoform X1 [Glycine 
max]
 ref|XP_006584967.1| PREDICTED: uncharacterized protein LOC100817942 isoform X2 [Glycine 
max]
 ref|XP_006584968.1| PREDICTED: uncharacterized protein LOC100817942 isoform X3 [Glycine 
max]
Length=53

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALKHE G+ G ATIIVRVIACFQPL  CQAEYFRHLLKPVT
Sbjct  1    MVCQAASQTRFRALKHEYGIDGKATIIVRVIACFQPLHFCQAEYFRHLLKPVT  53



>ref|XP_007018175.1| Transcription factor, putative isoform 1 [Theobroma cacao]
 gb|EOY15400.1| Transcription factor, putative isoform 1 [Theobroma cacao]
Length=421

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKP  898
            MV QAAS+TRFRALK+ENG+AGSATI+VRVIACFQPLQDCQAEYFRHLLKP
Sbjct  1    MVCQAASQTRFRALKYENGIAGSATIVVRVIACFQPLQDCQAEYFRHLLKP  51



>ref|XP_006420846.1| hypothetical protein CICLE_v10006528mg [Citrus clementina]
 gb|ESR34086.1| hypothetical protein CICLE_v10006528mg [Citrus clementina]
 gb|KDO43408.1| hypothetical protein CISIN_1g037184mg [Citrus sinensis]
Length=53

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+TRFRALK+ENG AG  TIIVRVIACF+P++DCQA+YFR LLKPVT
Sbjct  1    MVCQAASQTRFRALKYENGSAGKPTIIVRVIACFKPMEDCQAQYFRQLLKPVT  53



>ref|XP_007042873.1| Sequence-specific DNA binding transcription factors,transcription 
regulators, putative [Theobroma cacao]
 gb|EOX98704.1| Sequence-specific DNA binding transcription factors,transcription 
regulators, putative [Theobroma cacao]
Length=445

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPV  901
            MV QAAS+TRFRALK+ENG+AG +TI+VRVIACFQP++DCQAEYFRHLLKP+
Sbjct  1    MVCQAASQTRFRALKYENGIAGKSTIVVRVIACFQPMEDCQAEYFRHLLKPI  52



>ref|NP_001119403.1| conserved peptide upstream open reading frame 37 [Arabidopsis 
thaliana]
 gb|AED95884.1| conserved peptide upstream open reading frame 37 [Arabidopsis 
thaliana]
Length=51

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 2/53 (4%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV Q+A +TRFR LKHE+G+ G+  I+VRVIACFQPLQDCQAEYFR LLKPVT
Sbjct  1    MVCQSAGQTRFRTLKHEHGITGN--IVVRVIACFQPLQDCQAEYFRQLLKPVT  51



>ref|XP_003615245.1| Transcription factor bHLH143 [Medicago truncatula]
Length=431

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+T+FRALKHENG AG ATIIVRVIACFQ L++CQAEYFR LLKPVT
Sbjct  1    MVCQAASQTKFRALKHENGTAGCATIIVRVIACFQTLRECQAEYFRQLLKPVT  53



>gb|AES98203.2| transcription factor [Medicago truncatula]
Length=440

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV QAAS+T+FRALKHENG AG ATIIVRVIACFQ L++CQAEYFR LLKPVT
Sbjct  1    MVCQAASQTKFRALKHENGTAGCATIIVRVIACFQTLRECQAEYFRQLLKPVT  53



>gb|EPS71309.1| hypothetical protein M569_03455 [Genlisea aurea]
Length=53

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV Q ASKTRFRALK+E  +A   TI+V+++ACFQP+Q+CQAEYFR LLKPVT
Sbjct  1    MVCQKASKTRFRALKYETVIAERTTIVVKILACFQPMQNCQAEYFRQLLKPVT  53



>ref|XP_006399425.1| hypothetical protein EUTSA_v10015558mg [Eutrema salsugineum]
 gb|ESQ40878.1| hypothetical protein EUTSA_v10015558mg [Eutrema salsugineum]
Length=54

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHEN-GVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MVSQ+A +TRFR LK+EN G + + TI+VRVIACFQP+ +CQAEYFRH+LKPVT
Sbjct  1    MVSQSAGQTRFRTLKYENNGDSNNPTIVVRVIACFQPMDNCQAEYFRHILKPVT  54



>emb|CDY46795.1| BnaC02g43030D [Brassica napus]
 emb|CDY31324.1| BnaA02g34170D [Brassica napus]
Length=53

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV Q+  KTRFRALKHE G A   TI+VRVIACFQP+ +CQAEYFR LLKPVT
Sbjct  1    MVCQSPGKTRFRALKHETGDANRPTIVVRVIACFQPMDNCQAEYFRLLLKPVT  53



>ref|XP_006394164.1| hypothetical protein EUTSA_v10005432mg [Eutrema salsugineum]
 gb|ESQ31450.1| hypothetical protein EUTSA_v10005432mg [Eutrema salsugineum]
Length=53

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV Q+  KTRFRALK+E G A   TI+VRVIACFQP+ +CQAEYFR LLKPVT
Sbjct  1    MVCQSPGKTRFRALKYETGDANRPTIVVRVIACFQPMDNCQAEYFRLLLKPVT  53



>ref|NP_001119196.1| conserved peptide upstream open reading frame 43 [Arabidopsis 
thaliana]
 gb|AED91397.1| conserved peptide upstream open reading frame 43 [Arabidopsis 
thaliana]
Length=54

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHEN-GVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MVSQ+A +TRFR  K+EN G +   TI+VRVIACFQP+ +CQAEYFRH+LKPVT
Sbjct  1    MVSQSAGQTRFRTFKYENNGDSSRPTIVVRVIACFQPMDNCQAEYFRHILKPVT  54



>ref|XP_002873402.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49661.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
Length=54

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHEN-GVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MVSQ+A +TRFR  K+EN G +   TI+VRVIACFQP+ +CQAEYFRH+LKPVT
Sbjct  1    MVSQSAGQTRFRTFKYENNGDSSRQTIVVRVIACFQPMDNCQAEYFRHILKPVT  54



>ref|XP_010098655.1| hypothetical protein L484_026030 [Morus notabilis]
 gb|EXB75558.1| hypothetical protein L484_026030 [Morus notabilis]
Length=82

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLK  895
            MV QAAS+TRFRALKHENG+AGSATIIVRVIACFQPLQDCQ       +K
Sbjct  1    MVCQAASQTRFRALKHENGIAGSATIIVRVIACFQPLQDCQVIVLVEWVK  50



>emb|CDY58273.1| BnaAnng15160D [Brassica napus]
Length=53

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV Q+  KTRFRALK+E G A    I+VRVIACFQP+ +CQAEYFR LLKPVT
Sbjct  1    MVCQSPGKTRFRALKYETGDANRPAIVVRVIACFQPMDNCQAEYFRLLLKPVT  53



>ref|NP_001119490.1| conserved peptide upstream open reading frame 40 [Arabidopsis 
thaliana]
 gb|AED97873.1| conserved peptide upstream open reading frame 40 [Arabidopsis 
thaliana]
Length=53

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MV Q+  KTRFR LK+E G A  +TI+VRVI C+QP+ +CQAEYFR LLKPVT
Sbjct  1    MVCQSPGKTRFRGLKYETGNANESTIVVRVIECYQPMDNCQAEYFRLLLKPVT  53



>emb|CAN73178.1| hypothetical protein VITISV_039910 [Vitis vinifera]
Length=402

 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQ  868
            MV QAAS+TRFRALKHENG+AGSATIIVRVIACFQPLQDCQ
Sbjct  1    MVCQAASQTRFRALKHENGIAGSATIIVRVIACFQPLQDCQ  41



>emb|CDX69901.1| BnaA10g22500D [Brassica napus]
Length=54

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHEN-GVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MVSQ+A +TRFR  K+EN G +    ++VR I CFQP+ +CQAEYFRH+LKPVT
Sbjct  1    MVSQSAGQTRFRTFKYENNGDSNKPAVVVRAIVCFQPMANCQAEYFRHMLKPVT  54



>ref|XP_010230140.1| PREDICTED: uncharacterized protein LOC104582358 [Brachypodium 
distachyon]
Length=181

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 4/58 (7%)
 Frame = +2

Query  731  WEQVVMVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            W     V QAA++TRFR  KHE G+    ++ VRVIACFQPLQ+CQAEYFRHLLKPVT
Sbjct  128  WVLCPWVWQAAAQTRFRVFKHETGI----SVTVRVIACFQPLQNCQAEYFRHLLKPVT  181



>ref|XP_002514013.1| transcription factor, putative [Ricinus communis]
 gb|EEF48596.1| transcription factor, putative [Ricinus communis]
Length=424

 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAE  874
            MV QAAS+T FRALKHENG+AGSATIIVRVIACFQPLQDCQ +
Sbjct  1    MVCQAASQTNFRALKHENGIAGSATIIVRVIACFQPLQDCQKQ  43



>ref|XP_011023035.1| PREDICTED: transcription factor bHLH143-like isoform X2 [Populus 
euphratica]
 ref|XP_011012724.1| PREDICTED: transcription factor bHLH143-like isoform X2 [Populus 
euphratica]
Length=402

 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAE  874
            MV QAAS+TRFRALKHENG AG  TIIVRVIAC+QPLQDCQAE
Sbjct  1    MVCQAASQTRFRALKHENGSAGKLTIIVRVIACYQPLQDCQAE  43



>ref|XP_004490481.1| PREDICTED: uncharacterized protein LOC101514416 [Cicer arietinum]
Length=61

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQ  868
            MV QAAS+TRFRALKHENG +G +TIIVRVIACFQPL++CQ
Sbjct  1    MVCQAASQTRFRALKHENGSSGCSTIIVRVIACFQPLRECQ  41



>ref|XP_011043085.1| PREDICTED: transcription factor bHLH143-like isoform X2 [Populus 
euphratica]
Length=403

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAE  874
            MV QAAS+TRFRALK+ENG+AG  TIIVRVIAC++PLQDCQAE
Sbjct  1    MVCQAASQTRFRALKYENGIAGKPTIIVRVIACYRPLQDCQAE  43



>ref|XP_002522619.1| transcription factor, putative [Ricinus communis]
 gb|EEF39706.1| transcription factor, putative [Ricinus communis]
Length=394

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQA  871
            MV QAAS+TRFRALK+ENG+AG  TIIVRVIAC+QPLQDCQA
Sbjct  1    MVFQAASQTRFRALKYENGIAGKPTIIVRVIACYQPLQDCQA  42



>gb|KHF99744.1| Transcription factor protein [Gossypium arboreum]
Length=397

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQ  868
            MV QAA +TRFRALK+ENG+AGSATI+VRVIACFQPLQDCQ
Sbjct  1    MVCQAAGQTRFRALKYENGIAGSATIVVRVIACFQPLQDCQ  41



>emb|CDX84516.1| BnaC03g49840D [Brassica napus]
Length=369

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKP  898
            MV Q+  KTRFRALK+E G A    I+VRVIACFQP+ +CQAEYFR LLKP
Sbjct  1    MVCQSPGKTRFRALKYETGDANRPAIVVRVIACFQPMDNCQAEYFRLLLKP  51



>emb|CDY21584.1| BnaC09g47080D [Brassica napus]
Length=390

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 4/53 (8%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            MVSQ+A +TRFR  K+EN  A    ++VR I CFQP+ +CQAEYFRH+LKPVT
Sbjct  1    MVSQSAGQTRFRTFKYENNGA----VVVRAIVCFQPMANCQAEYFRHMLKPVT  49



>ref|XP_006433862.1| hypothetical protein CICLE_v10003720mg [Citrus clementina]
 gb|ESR47102.1| hypothetical protein CICLE_v10003720mg [Citrus clementina]
Length=43

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQ  868
            MV QAAS+TRFRALK+E+G+AG A I+VR+IACFQPL+ CQ
Sbjct  1    MVCQAASQTRFRALKYEHGIAGRAAIVVRIIACFQPLKFCQ  41



>ref|XP_003593246.1| Transcription factor bHLH143 [Medicago truncatula]
Length=426

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQ  868
            MV +AAS+  FRALKH NG+ G  TIIVRVIACFQPLQDCQ
Sbjct  1    MVGRAASQKGFRALKHCNGIEGEPTIIVRVIACFQPLQDCQ  41



>gb|EEC75395.1| hypothetical protein OsI_11883 [Oryza sativa Indica Group]
Length=414

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  740  VVMVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYF  880
            V+MV Q  ++TRFR  KHENG+A      VRVIACFQP QDCQ   F
Sbjct  54   VLMVWQPVAQTRFRVFKHENGIA------VRVIACFQPSQDCQKILF  94



>gb|EEE59187.1| hypothetical protein OsJ_11123 [Oryza sativa Japonica Group]
Length=359

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  746  MVSQAASKTRFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYF  880
            MV Q  ++TRFR  KHENG+A      VRVIACFQP QDCQ   F
Sbjct  1    MVWQPVAQTRFRVFKHENGIA------VRVIACFQPSQDCQKILF  39



>ref|XP_010232047.1| PREDICTED: uncharacterized protein LOC104582815 [Brachypodium 
distachyon]
Length=48

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 4/44 (9%)
 Frame = +2

Query  773  RFRALKHENGVAGSATIIVRVIACFQPLQDCQAEYFRHLLKPVT  904
            RFR +K      G+  + VR+ AC+Q +Q CQAEYFR LLKPVT
Sbjct  9    RFRVVKE----VGTIVMSVRIFACYQLMQVCQAEYFRQLLKPVT  48



>emb|CDP11476.1| unnamed protein product [Coffea canephora]
Length=25

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/25 (100%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  212  MRWYSLSIDVFRKVISLNLYCRVIL  286
            MRWYSLSIDVFRKVISLNLYCRVIL
Sbjct  1    MRWYSLSIDVFRKVISLNLYCRVIL  25



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3502287554740