BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2115

Length=712
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011081744.1|  PREDICTED: receptor-like protein kinase 5          193   3e-53   Sesamum indicum [beniseed]
ref|XP_009803852.1|  PREDICTED: receptor-like protein kinase HSL1       158   6e-41   Nicotiana sylvestris
ref|XP_006364730.1|  PREDICTED: probable LRR receptor-like serine...    157   2e-40   
ref|XP_010325071.1|  PREDICTED: LRR receptor-like serine/threonin...    153   5e-39   Solanum lycopersicum
ref|XP_004245385.2|  PREDICTED: LRR receptor-like serine/threonin...    145   2e-36   
ref|XP_006364729.1|  PREDICTED: receptor-like protein kinase 5-like     141   8e-35   Solanum tuberosum [potatoes]
ref|XP_009600837.1|  PREDICTED: DNA-damage-repair/toleration prot...    122   2e-30   Nicotiana tomentosiformis
ref|XP_006475995.1|  PREDICTED: receptor-like protein kinase HSL1...    124   2e-28   Citrus sinensis [apfelsine]
gb|KDO79911.1|  hypothetical protein CISIN_1g001706mg                   124   2e-28   Citrus sinensis [apfelsine]
gb|KDO79910.1|  hypothetical protein CISIN_1g001706mg                   124   2e-28   Citrus sinensis [apfelsine]
ref|XP_006364719.1|  PREDICTED: receptor-like protein kinase HSL1...    122   5e-28   
ref|XP_012076874.1|  PREDICTED: receptor-like protein kinase HSL1       120   3e-27   Jatropha curcas
ref|XP_008220120.1|  PREDICTED: receptor-like protein kinase HSL1       120   5e-27   Prunus mume [ume]
ref|XP_010095355.1|  putative LRR receptor-like serine/threonine-...    117   1e-26   
ref|XP_007137253.1|  hypothetical protein PHAVU_009G112200g             119   1e-26   Phaseolus vulgaris [French bean]
ref|XP_006366693.1|  PREDICTED: receptor-like protein kinase HSL1...    119   1e-26   Solanum tuberosum [potatoes]
ref|XP_010267130.1|  PREDICTED: receptor-like protein kinase HSL1       119   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_004513050.1|  PREDICTED: receptor-like protein kinase HSL1...    117   5e-26   
ref|XP_007013028.1|  Kinase family protein with leucine-rich repe...    117   8e-26   
ref|XP_007013027.1|  Kinase family protein with leucine-rich repe...    117   8e-26   
ref|XP_006596181.1|  PREDICTED: receptor-like protein kinase HSL1...    116   9e-26   Glycine max [soybeans]
ref|XP_006596182.1|  PREDICTED: receptor-like protein kinase HSL1...    116   1e-25   
gb|KDO66581.1|  hypothetical protein CISIN_1g001778mg                   116   1e-25   Citrus sinensis [apfelsine]
ref|XP_006475586.1|  PREDICTED: receptor-like protein kinase 5-like     116   1e-25   Citrus sinensis [apfelsine]
ref|XP_002516533.1|  serine-threonine protein kinase, plant-type,...    115   3e-25   Ricinus communis
ref|XP_009350259.1|  PREDICTED: receptor-like protein kinase HSL1       115   3e-25   Pyrus x bretschneideri [bai li]
ref|XP_010095354.1|  LRR receptor-like serine/threonine-protein k...    114   3e-25   
emb|CDP03253.1|  unnamed protein product                                114   4e-25   Coffea canephora [robusta coffee]
ref|XP_009628517.1|  PREDICTED: LRR receptor-like serine/threonin...    113   7e-25   Nicotiana tomentosiformis
ref|XP_009628516.1|  PREDICTED: receptor-like protein kinase 2 is...    113   8e-25   Nicotiana tomentosiformis
ref|XP_009628514.1|  PREDICTED: receptor-like protein kinase 2 is...    113   9e-25   Nicotiana tomentosiformis
emb|CDM84035.1|  unnamed protein product                                112   1e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_012077398.1|  PREDICTED: receptor-like protein kinase HSL1       113   1e-24   Jatropha curcas
ref|XP_002278306.2|  PREDICTED: receptor-like protein kinase 5 is...    112   2e-24   Vitis vinifera
gb|KDP33797.1|  hypothetical protein JCGZ_07368                         112   2e-24   Jatropha curcas
ref|XP_009779466.1|  PREDICTED: receptor-like protein kinase HSL1       112   2e-24   Nicotiana sylvestris
ref|XP_008444991.1|  PREDICTED: receptor-like protein kinase HSL1       112   3e-24   Cucumis melo [Oriental melon]
ref|XP_004148398.2|  PREDICTED: receptor-like protein kinase HSL1       112   3e-24   Cucumis sativus [cucumbers]
ref|XP_011093340.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    112   3e-24   Sesamum indicum [beniseed]
gb|KGN62796.1|  hypothetical protein Csa_2G373400                       112   4e-24   Cucumis sativus [cucumbers]
ref|XP_010110882.1|  Receptor-like protein kinase HSL1                  112   4e-24   
ref|XP_010106712.1|  Receptor-like protein kinase HSL1                  111   6e-24   
ref|XP_011007101.1|  PREDICTED: receptor-like protein kinase 5          110   2e-23   Populus euphratica
ref|XP_010668734.1|  PREDICTED: receptor-like protein kinase HSL1       110   2e-23   
ref|XP_004245388.2|  PREDICTED: receptor-like protein kinase 2          109   2e-23   Solanum lycopersicum
ref|XP_002324455.2|  hypothetical protein POPTR_0018s09540g             109   2e-23   
ref|XP_010095459.1|  Receptor-like protein kinase HSL1                  109   2e-23   Morus notabilis
ref|XP_003517639.1|  PREDICTED: receptor-like protein kinase HSL1...    109   3e-23   Glycine max [soybeans]
ref|XP_002527459.1|  serine-threonine protein kinase, plant-type,...    109   3e-23   
ref|XP_011048044.1|  PREDICTED: leucine-rich repeat receptor-like...    109   3e-23   Populus euphratica
ref|XP_011078243.1|  PREDICTED: receptor-like protein kinase HSL1       109   3e-23   Sesamum indicum [beniseed]
gb|EYU29298.1|  hypothetical protein MIMGU_mgv1a000685mg                108   4e-23   Erythranthe guttata [common monkey flower]
ref|XP_004301323.1|  PREDICTED: probable LRR receptor-like serine...    108   6e-23   Fragaria vesca subsp. vesca
ref|XP_009587881.1|  PREDICTED: receptor-like protein kinase HSL1       108   6e-23   Nicotiana tomentosiformis
ref|XP_009151498.1|  PREDICTED: leucine-rich repeat receptor-like...    104   7e-23   Brassica rapa
ref|XP_011464596.1|  PREDICTED: probable LRR receptor-like serine...    108   7e-23   Fragaria vesca subsp. vesca
ref|XP_009367420.1|  PREDICTED: receptor-like protein kinase HSL1       108   8e-23   Pyrus x bretschneideri [bai li]
gb|KJB54766.1|  hypothetical protein B456_009G048200                    108   9e-23   Gossypium raimondii
gb|KJB54767.1|  hypothetical protein B456_009G048200                    107   9e-23   Gossypium raimondii
ref|XP_003527853.1|  PREDICTED: receptor-like protein kinase HSL1...    107   1e-22   Glycine max [soybeans]
ref|XP_006367833.1|  PREDICTED: probable leucine-rich repeat rece...    104   1e-22   
ref|XP_003603644.1|  Receptor-like protein kinase                       107   1e-22   Medicago truncatula
ref|XP_003523755.1|  PREDICTED: receptor-like protein kinase HSL1...    107   1e-22   Glycine max [soybeans]
ref|XP_010245908.1|  PREDICTED: receptor-like protein kinase 2          106   1e-22   
ref|XP_007013026.1|  Kinase family protein with leucine-rich repe...    107   1e-22   
ref|XP_002983532.1|  hypothetical protein SELMODRAFT_445533             107   1e-22   
gb|KHG24857.1|  Receptor-like protein kinase HSL1                       107   1e-22   Gossypium arboreum [tree cotton]
ref|XP_007012181.1|  Kinase family protein with leucine-rich repe...    107   2e-22   
ref|XP_010249486.1|  PREDICTED: receptor-like protein kinase HSL1       107   2e-22   Nelumbo nucifera [Indian lotus]
emb|CDX88207.1|  BnaA06g27980D                                          103   3e-22   
ref|XP_004501091.1|  PREDICTED: receptor-like protein kinase HSL1...    106   3e-22   
ref|XP_004501092.1|  PREDICTED: receptor-like protein kinase HSL1...    106   3e-22   
ref|XP_002308032.2|  leucine-rich repeat transmembrane protein ki...    106   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010910570.1|  PREDICTED: probable leucine-rich repeat rece...    103   3e-22   Elaeis guineensis
ref|XP_007152972.1|  hypothetical protein PHAVU_004G175800g             106   3e-22   Phaseolus vulgaris [French bean]
ref|XP_007025533.1|  HAESA-like 1 isoform 2                             106   3e-22   
ref|XP_007025532.1|  HAESA-like 1 isoform 1                             106   3e-22   
ref|XP_002280395.1|  PREDICTED: receptor-like protein kinase 5          106   3e-22   Vitis vinifera
ref|XP_011007100.1|  PREDICTED: receptor-like protein kinase HSL1       105   3e-22   Populus euphratica
ref|XP_004245143.1|  PREDICTED: receptor-like protein kinase HSL1       106   4e-22   Solanum lycopersicum
ref|XP_006382632.1|  hypothetical protein POPTR_0005s03970g             106   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006387571.1|  hypothetical protein POPTR_0830s00200g             105   4e-22   
ref|XP_009793567.1|  PREDICTED: probable LRR receptor-like serine...    106   5e-22   Nicotiana sylvestris
ref|XP_010049140.1|  PREDICTED: receptor-like protein kinase HSL1       105   5e-22   Eucalyptus grandis [rose gum]
ref|XP_011008121.1|  PREDICTED: receptor-like protein kinase 5          105   5e-22   Populus euphratica
ref|XP_011072724.1|  PREDICTED: receptor-like protein kinase isof...    105   5e-22   Sesamum indicum [beniseed]
ref|XP_011072726.1|  PREDICTED: receptor-like protein kinase isof...    105   5e-22   
ref|XP_011014419.1|  PREDICTED: receptor-like protein kinase 5          105   6e-22   Populus euphratica
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...    105   7e-22   Populus euphratica
ref|XP_008242543.1|  PREDICTED: receptor-like protein kinase HSL1       105   7e-22   
ref|XP_010910207.1|  PREDICTED: receptor-like protein kinase HSL1       104   8e-22   
gb|KDP33800.1|  hypothetical protein JCGZ_07371                         105   8e-22   Jatropha curcas
ref|XP_011015844.1|  PREDICTED: leucine-rich repeat receptor-like...    105   8e-22   Populus euphratica
ref|XP_011033329.1|  PREDICTED: leucine-rich repeat receptor-like...    105   8e-22   Populus euphratica
emb|CBI20587.3|  unnamed protein product                                105   8e-22   Vitis vinifera
ref|NP_174166.1|  receptor-like protein kinase HSL1                     105   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009387282.1|  PREDICTED: probable leucine-rich repeat rece...    100   9e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011078428.1|  PREDICTED: probable LRR receptor-like serine...    105   1e-21   
ref|XP_008780256.1|  PREDICTED: receptor-like protein kinase HSL1       100   1e-21   Phoenix dactylifera
gb|KEH27214.1|  leucine-rich receptor-like kinase family protein        104   1e-21   Medicago truncatula
ref|XP_010062723.1|  PREDICTED: leucine-rich repeat receptor-like...    104   1e-21   Eucalyptus grandis [rose gum]
ref|XP_002969057.1|  hypothetical protein SELMODRAFT_90370              104   1e-21   
ref|XP_007152973.1|  hypothetical protein PHAVU_004G175900g             104   2e-21   Phaseolus vulgaris [French bean]
gb|EYU30701.1|  hypothetical protein MIMGU_mgv1a000689mg                104   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_004291157.1|  PREDICTED: receptor-like protein kinase 5          104   2e-21   Fragaria vesca subsp. vesca
ref|XP_002969733.1|  hypothetical protein SELMODRAFT_60277              104   2e-21   
gb|KEH27213.1|  leucine-rich receptor-like kinase family protein        104   2e-21   Medicago truncatula
ref|XP_004955463.1|  PREDICTED: leucine-rich repeat receptor-like...    104   2e-21   Setaria italica
ref|XP_010317427.1|  PREDICTED: probable LRR receptor-like serine...    103   2e-21   
ref|XP_010929233.1|  PREDICTED: receptor-like protein kinase            103   2e-21   Elaeis guineensis
ref|XP_002992868.1|  hypothetical protein SELMODRAFT_136102             103   2e-21   
emb|CDP06118.1|  unnamed protein product                                103   2e-21   Coffea canephora [robusta coffee]
ref|XP_008354538.1|  PREDICTED: receptor-like protein kinase HSL1       103   2e-21   
ref|XP_010460642.1|  PREDICTED: receptor-like protein kinase HSL1       103   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002890776.1|  hypothetical protein ARALYDRAFT_473063             103   2e-21   
ref|XP_002517850.1|  Receptor protein kinase CLAVATA1 precursor, ...    103   3e-21   Ricinus communis
ref|XP_004513049.1|  PREDICTED: receptor-like protein kinase HSL1...    103   3e-21   
gb|AES77382.2|  LRR receptor-like kinase family protein                 103   3e-21   Medicago truncatula
ref|XP_003621164.1|  Receptor kinase                                    103   3e-21   
ref|XP_008778617.1|  PREDICTED: receptor-like protein kinase HSL1     99.8    3e-21   
ref|XP_011078429.1|  PREDICTED: probable LRR receptor-like serine...    103   3e-21   Sesamum indicum [beniseed]
ref|XP_010478219.1|  PREDICTED: receptor-like protein kinase HSL1       103   4e-21   
ref|XP_011007104.1|  PREDICTED: receptor-like protein kinase HSL1       103   4e-21   Populus euphratica
ref|XP_006372068.1|  hypothetical protein POPTR_0018s09520g             103   4e-21   
ref|XP_008337667.1|  PREDICTED: receptor-like protein kinase HSL1       103   4e-21   
ref|XP_002324456.2|  hypothetical protein POPTR_0018s09550g             103   4e-21   
gb|KJB57488.1|  hypothetical protein B456_009G166500                    103   4e-21   Gossypium raimondii
ref|XP_006662949.1|  PREDICTED: somatic embryogenesis receptor ki...  99.0    4e-21   Oryza brachyantha
gb|KEH27211.1|  LRR receptor-like kinase family protein                 102   4e-21   Medicago truncatula
ref|XP_003533283.1|  PREDICTED: receptor-like protein kinase HSL1...    103   4e-21   Glycine max [soybeans]
ref|XP_010110151.1|  putative LRR receptor-like serine/threonine-...    102   5e-21   
ref|XP_006853707.1|  PREDICTED: receptor-like protein kinase HSL1       102   5e-21   Amborella trichopoda
ref|XP_007203859.1|  hypothetical protein PRUPE_ppa022167mg             102   5e-21   
ref|XP_011078427.1|  PREDICTED: LRR receptor-like serine/threonin...    102   5e-21   
ref|XP_010499374.1|  PREDICTED: receptor-like protein kinase HSL1...    102   5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011464597.1|  PREDICTED: probable LRR receptor-like serine...    102   5e-21   Fragaria vesca subsp. vesca
gb|EAY81075.1|  hypothetical protein OsI_36255                        98.6    6e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_002461464.1|  hypothetical protein SORBIDRAFT_02g003080          102   6e-21   
ref|XP_010041484.1|  PREDICTED: probable LRR receptor-like serine...    102   6e-21   
ref|XP_011464598.1|  PREDICTED: probable LRR receptor-like serine...    102   6e-21   Fragaria vesca subsp. vesca
ref|XP_004234101.1|  PREDICTED: receptor-like protein kinase HSL1...    102   6e-21   Solanum lycopersicum
gb|KJB64291.1|  hypothetical protein B456_010G040900                    102   7e-21   Gossypium raimondii
ref|XP_010317434.1|  PREDICTED: receptor-like protein kinase HSL1...    102   7e-21   Solanum lycopersicum
gb|KJB64290.1|  hypothetical protein B456_010G040900                    102   7e-21   Gossypium raimondii
ref|XP_010924441.1|  PREDICTED: receptor-like protein kinase 5          102   7e-21   
gb|ABA93885.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  98.2    7e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002323316.2|  leucine-rich repeat transmembrane protein ki...    102   7e-21   
gb|KHN15495.1|  Receptor-like protein kinase HSL1                       102   7e-21   Glycine soja [wild soybean]
gb|EYU20424.1|  hypothetical protein MIMGU_mgv1a021116mg                101   7e-21   Erythranthe guttata [common monkey flower]
ref|XP_003528467.1|  PREDICTED: receptor-like protein kinase HSL1...    102   8e-21   Glycine max [soybeans]
gb|AGT15910.1|  kinase                                                  102   8e-21   Saccharum hybrid cultivar R570
emb|CDY48481.1|  BnaC05g13410D                                          102   8e-21   Brassica napus [oilseed rape]
gb|EAZ02799.1|  hypothetical protein OsI_24925                          102   8e-21   Oryza sativa Indica Group [Indian rice]
dbj|BAC84715.1|  putative LRR receptor-like kinase                      102   9e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008390812.1|  PREDICTED: receptor-like protein kinase HSL1       102   1e-20   
gb|AGT17281.1|  hypothetical protein SHCRBa_021_E20_F_10                102   1e-20   Saccharum hybrid cultivar R570
ref|XP_006492015.1|  PREDICTED: leucine-rich repeat receptor-like...    102   1e-20   Citrus sinensis [apfelsine]
ref|XP_006659458.1|  PREDICTED: receptor-like protein kinase-like       102   1e-20   Oryza brachyantha
ref|XP_002973857.1|  hypothetical protein SELMODRAFT_414250             102   1e-20   
gb|EAZ43185.1|  hypothetical protein OsJ_27777                          101   1e-20   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD10022.1|  putative receptor protein kinase                       101   1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ07465.1|  hypothetical protein OsI_29720                          101   1e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_010234069.1|  PREDICTED: receptor-like protein kinase HSL1       101   1e-20   
gb|EYU36356.1|  hypothetical protein MIMGU_mgv1a018150mg                101   1e-20   Erythranthe guttata [common monkey flower]
ref|XP_008242547.1|  PREDICTED: LRR receptor-like serine/threonin...    101   1e-20   
ref|NP_001062124.1|  Os08g0493800                                       101   1e-20   
gb|KDO46301.1|  hypothetical protein CISIN_1g001275mg                   101   1e-20   Citrus sinensis [apfelsine]
ref|XP_007204807.1|  hypothetical protein PRUPE_ppa019571mg             101   1e-20   Prunus persica
gb|KCW84032.1|  hypothetical protein EUGRSUZ_B00906                     101   1e-20   Eucalyptus grandis [rose gum]
ref|XP_006470715.1|  PREDICTED: probable LRR receptor-like serine...    101   2e-20   Citrus sinensis [apfelsine]
ref|XP_011033023.1|  PREDICTED: receptor-like protein kinase isof...    101   2e-20   Populus euphratica
emb|CDX94621.1|  BnaC07g10370D                                          101   2e-20   
emb|CDY26259.1|  BnaA06g11580D                                          101   2e-20   Brassica napus [oilseed rape]
ref|XP_011033024.1|  PREDICTED: receptor-like protein kinase isof...    101   2e-20   Populus euphratica
ref|XP_010655181.1|  PREDICTED: putative receptor-like protein ki...    101   2e-20   
gb|KDO36824.1|  hypothetical protein CISIN_1g037538mg                 99.0    2e-20   Citrus sinensis [apfelsine]
ref|XP_010045705.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_004505098.1|  PREDICTED: receptor-like protein kinase HSL1...    100   2e-20   Cicer arietinum [garbanzo]
gb|KDO44090.1|  hypothetical protein CISIN_1g001274mg                   100   2e-20   Citrus sinensis [apfelsine]
ref|XP_006478014.1|  PREDICTED: leucine-rich repeat receptor-like...    100   2e-20   Citrus sinensis [apfelsine]
gb|KDO64793.1|  hypothetical protein CISIN_1g042931mg                 99.0    2e-20   Citrus sinensis [apfelsine]
ref|XP_006343221.1|  PREDICTED: receptor-like protein kinase HSL1...    100   2e-20   Solanum tuberosum [potatoes]
ref|XP_009149170.1|  PREDICTED: leucine-rich repeat receptor-like...    100   2e-20   Brassica rapa
ref|XP_006446083.1|  hypothetical protein CICLE_v10018319mg           99.8    2e-20   
emb|CBN80058.1|  LRR-GTPase of the ROCO family                          100   2e-20   Ectocarpus siliculosus
emb|CDY15668.1|  BnaA07g08390D                                          100   3e-20   Brassica napus [oilseed rape]
ref|XP_010045748.1|  PREDICTED: probable LRR receptor-like serine...    100   3e-20   
gb|ERN15172.1|  hypothetical protein AMTR_s00056p00147890               100   3e-20   Amborella trichopoda
ref|XP_009804334.1|  PREDICTED: leucine-rich repeat receptor-like...    100   3e-20   Nicotiana sylvestris
ref|XP_009102909.1|  PREDICTED: receptor-like protein kinase HSL1       100   3e-20   Brassica rapa
ref|XP_009609979.1|  PREDICTED: probable LRR receptor-like serine...    100   3e-20   Nicotiana tomentosiformis
gb|EMT25886.1|  Receptor-like protein kinase HSL1                     99.8    3e-20   
ref|XP_009149171.1|  PREDICTED: leucine-rich repeat receptor-like...    100   3e-20   Brassica rapa
gb|KDO64794.1|  hypothetical protein CISIN_1g038466mg                 99.4    3e-20   Citrus sinensis [apfelsine]
ref|XP_010508671.1|  PREDICTED: leucine-rich repeat receptor-like...    100   3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_007152512.1|  hypothetical protein PHAVU_004G136500g             100   3e-20   Phaseolus vulgaris [French bean]
ref|XP_003516786.2|  PREDICTED: receptor-like protein kinase 5-like     100   3e-20   Glycine max [soybeans]
ref|XP_006446084.1|  hypothetical protein CICLE_v10017805mg           99.8    3e-20   
gb|EMT31747.1|  LRR receptor-like serine/threonine-protein kinase...    100   3e-20   
emb|CDP19861.1|  unnamed protein product                                100   3e-20   Coffea canephora [robusta coffee]
ref|XP_011081773.1|  PREDICTED: probably inactive leucine-rich re...    100   4e-20   Sesamum indicum [beniseed]
ref|XP_006470750.1|  PREDICTED: probable LRR receptor-like serine...  99.8    4e-20   
ref|XP_010505972.1|  PREDICTED: leucine-rich repeat receptor-like...    100   4e-20   Camelina sativa [gold-of-pleasure]
gb|KHG18466.1|  Receptor-like protein kinase HSL1                       100   4e-20   Gossypium arboreum [tree cotton]
ref|XP_010501502.1|  PREDICTED: leucine-rich repeat receptor-like...    100   4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_011081775.1|  PREDICTED: probably inactive leucine-rich re...    100   4e-20   
ref|XP_006286985.1|  hypothetical protein CARUB_v10000132mg             100   4e-20   Capsella rubella
emb|CAH65841.1|  OSIGBa0137A06.2                                        100   4e-20   Oryza sativa [red rice]
ref|XP_010684496.1|  PREDICTED: receptor-like protein kinase HSL1       100   4e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673884.1|  PREDICTED: receptor-like protein kinase            100   4e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011626753.1|  PREDICTED: receptor-like protein kinase HSL1       100   5e-20   Amborella trichopoda
ref|XP_009352556.1|  PREDICTED: receptor-like protein kinase HSL1       100   5e-20   Pyrus x bretschneideri [bai li]
ref|XP_006415653.1|  hypothetical protein EUTSA_v10006677mg           99.8    5e-20   
ref|XP_006415654.1|  hypothetical protein EUTSA_v10006677mg           99.8    5e-20   Eutrema salsugineum [saltwater cress]
gb|ADE76066.1|  unknown                                               96.3    5e-20   Picea sitchensis
ref|XP_006442130.1|  hypothetical protein CICLE_v10024208mg             100   5e-20   
ref|XP_002278863.1|  PREDICTED: receptor-like protein kinase HSL1     99.8    5e-20   Vitis vinifera
ref|XP_007203222.1|  hypothetical protein PRUPE_ppa000737mg           99.8    5e-20   Prunus persica
sp|P93194.2|RPK1_IPONI  RecName: Full=Receptor-like protein kinas...  99.8    5e-20   Ipomoea nil [qian niu]
gb|EAY81072.1|  hypothetical protein OsI_36252                        95.9    6e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_010923812.1|  PREDICTED: leucine-rich repeat receptor-like...  99.8    6e-20   
ref|XP_010923813.1|  PREDICTED: leucine-rich repeat receptor-like...  99.8    6e-20   Elaeis guineensis
ref|XP_011029916.1|  PREDICTED: probable LRR receptor-like serine...  99.8    6e-20   Populus euphratica
ref|XP_008362962.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  99.8    6e-20   
ref|XP_010923809.1|  PREDICTED: leucine-rich repeat receptor-like...  99.8    6e-20   
pdb|4MN8|B  Chain B, Crystal Structure Of Flg22 In Complex With T...  95.1    6e-20   synthetic construct
ref|XP_006388198.1|  hypothetical protein POPTR_0290s00240g           98.6    6e-20   
ref|XP_010923807.1|  PREDICTED: leucine-rich repeat receptor-like...  99.8    6e-20   
ref|XP_010105912.1|  putative LRR receptor-like serine/threonine-...  99.4    6e-20   
gb|KCW85317.1|  hypothetical protein EUGRSUZ_B02157                   99.4    6e-20   Eucalyptus grandis [rose gum]
ref|XP_006427729.1|  hypothetical protein CICLE_v10024756mg           99.8    6e-20   Citrus clementina [clementine]
ref|XP_002318300.2|  hypothetical protein POPTR_0012s14920g           99.8    6e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011074643.1|  PREDICTED: probable LRR receptor-like serine...  99.8    7e-20   Sesamum indicum [beniseed]
ref|XP_002324453.1|  hypothetical protein POPTR_0018s09510g           99.4    7e-20   
ref|XP_008389971.1|  PREDICTED: probable leucine-rich repeat rece...  99.4    7e-20   
ref|XP_009387280.1|  PREDICTED: probable leucine-rich repeat rece...  99.8    7e-20   
ref|XP_003548595.1|  PREDICTED: receptor-like protein kinase 5-like   99.4    7e-20   Glycine max [soybeans]
ref|XP_009397713.1|  PREDICTED: leucine-rich repeat receptor-like...  99.4    7e-20   
ref|XP_009780758.1|  PREDICTED: LRR receptor-like serine/threonin...  95.5    7e-20   Nicotiana sylvestris
gb|KHN16977.1|  Receptor-like protein kinase HSL1                     99.4    7e-20   Glycine soja [wild soybean]
gb|KFK44719.1|  hypothetical protein AALP_AA1G294100                  99.4    7e-20   Arabis alpina [alpine rockcress]
emb|CDP08192.1|  unnamed protein product                              98.6    8e-20   Coffea canephora [robusta coffee]
gb|EYU34379.1|  hypothetical protein MIMGU_mgv1a020113mg              99.4    8e-20   Erythranthe guttata [common monkey flower]
ref|XP_007152971.1|  hypothetical protein PHAVU_004G175700g           99.4    8e-20   Phaseolus vulgaris [French bean]
ref|XP_002981339.1|  hypothetical protein SELMODRAFT_114392           99.4    8e-20   
ref|XP_010911190.1|  PREDICTED: receptor-like protein kinase HSL1     97.4    8e-20   Elaeis guineensis
ref|XP_010538183.1|  PREDICTED: receptor-like protein kinase HSL1     99.0    9e-20   Tarenaya hassleriana [spider flower]
gb|KCW57971.1|  hypothetical protein EUGRSUZ_H00707                   99.0    9e-20   Eucalyptus grandis [rose gum]
ref|XP_010517672.1|  PREDICTED: leucine-rich repeat receptor-like...  99.0    9e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008377967.1|  PREDICTED: receptor-like protein kinase HSL1     99.0    9e-20   
ref|XP_010069577.1|  PREDICTED: probable LRR receptor-like serine...  99.0    9e-20   Eucalyptus grandis [rose gum]
ref|XP_010096842.1|  LRR receptor-like serine/threonine-protein k...  99.0    1e-19   
ref|XP_002309529.2|  leucine-rich repeat family protein               99.0    1e-19   
gb|KJB69744.1|  hypothetical protein B456_011G040400                  99.0    1e-19   Gossypium raimondii
gb|AFW84179.1|  putative leucine-rich repeat receptor-like protei...  99.0    1e-19   
gb|KCW57968.1|  hypothetical protein EUGRSUZ_H00705                   99.0    1e-19   Eucalyptus grandis [rose gum]
ref|XP_006343427.1|  PREDICTED: probable LRR receptor-like serine...  99.0    1e-19   
ref|XP_012066149.1|  PREDICTED: receptor-like protein kinase          99.0    1e-19   Jatropha curcas
pdb|4M7E|D  Chain D, Structural Insight Into Bl-induced Activatio...  94.0    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007203052.1|  hypothetical protein PRUPE_ppa022950mg           98.2    1e-19   
gb|KCW57972.1|  hypothetical protein EUGRSUZ_H00707                   98.6    1e-19   Eucalyptus grandis [rose gum]
ref|XP_002527461.1|  serine-threonine protein kinase, plant-type,...  99.0    1e-19   Ricinus communis
gb|KCW57970.1|  hypothetical protein EUGRSUZ_H00707                   99.0    1e-19   Eucalyptus grandis [rose gum]
ref|XP_008240894.1|  PREDICTED: leucine-rich repeat receptor-like...  98.6    1e-19   Prunus mume [ume]
ref|XP_004979346.1|  PREDICTED: somatic embryogenesis receptor ki...  94.7    1e-19   Setaria italica
ref|XP_006412360.1|  hypothetical protein EUTSA_v10024694mg           97.8    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_010546603.1|  PREDICTED: leucine-rich repeat receptor-like...  98.6    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_011651869.1|  PREDICTED: probable LRR receptor-like serine...  98.6    1e-19   Cucumis sativus [cucumbers]
ref|XP_010026002.1|  PREDICTED: probable LRR receptor-like serine...  99.0    1e-19   Eucalyptus grandis [rose gum]
emb|CDY06907.1|  BnaA04g24080D                                        95.5    1e-19   
ref|XP_010919440.1|  PREDICTED: putative receptor-like protein ki...  98.6    1e-19   Elaeis guineensis
ref|XP_010036437.1|  PREDICTED: leucine-rich repeat receptor-like...  98.6    1e-19   Eucalyptus grandis [rose gum]
gb|EAZ01474.1|  hypothetical protein OsI_23508                        98.6    1e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_008242546.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  98.6    1e-19   
ref|XP_006306677.1|  hypothetical protein CARUB_v10008195mg           98.6    1e-19   Capsella rubella
ref|XP_006442219.1|  hypothetical protein CICLE_v10018604mg           98.6    1e-19   Citrus clementina [clementine]
ref|XP_006285500.1|  hypothetical protein CARUB_v10006936mg           97.8    1e-19   Capsella rubella
ref|XP_007018575.1|  Serine-threonine protein kinase, plant-type,...  98.6    2e-19   
ref|XP_008463988.1|  PREDICTED: receptor-like protein kinase          98.6    2e-19   Cucumis melo [Oriental melon]
ref|XP_010042217.1|  PREDICTED: probable LRR receptor-like serine...  98.6    2e-19   
dbj|BAJ98312.1|  predicted protein                                    98.2    2e-19   
ref|XP_006306695.1|  hypothetical protein CARUB_v10008216mg           98.2    2e-19   
ref|XP_006293653.1|  hypothetical protein CARUB_v10022610mg           98.2    2e-19   
ref|XP_009405409.1|  PREDICTED: probable LRR receptor-like serine...  98.2    2e-19   
ref|XP_010476937.1|  PREDICTED: leucine-rich repeat receptor-like...  98.2    2e-19   
ref|XP_007204661.1|  hypothetical protein PRUPE_ppa001174mg           98.2    2e-19   
gb|KJB69148.1|  hypothetical protein B456_011G008200                  98.2    2e-19   
emb|CDX79911.1|  BnaA05g02450D                                        95.9    2e-19   
ref|XP_010026004.1|  PREDICTED: probable LRR receptor-like serine...  97.4    2e-19   
gb|KJB84252.1|  hypothetical protein B456_N013500                     98.2    2e-19   
ref|XP_010432564.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  97.4    2e-19   
ref|XP_007133279.1|  hypothetical protein PHAVU_011G166400g           98.2    2e-19   
ref|XP_010437764.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  97.4    2e-19   
ref|XP_006658283.1|  PREDICTED: leucine-rich repeat receptor-like...  98.2    2e-19   
ref|XP_007020601.1|  Receptor like protein 53, putative               97.8    2e-19   
emb|CAE76015.1|  B1292H11.1                                           97.8    2e-19   
ref|XP_010474282.1|  PREDICTED: receptor-like protein 12              97.8    2e-19   
ref|XP_011076203.1|  PREDICTED: leucine-rich repeat receptor prot...  98.2    2e-19   
ref|XP_012090287.1|  PREDICTED: leucine-rich repeat receptor prot...  98.2    2e-19   
ref|XP_011029918.1|  PREDICTED: probable LRR receptor-like serine...  97.8    2e-19   
ref|XP_006476025.1|  PREDICTED: probably inactive leucine-rich re...  97.8    2e-19   
ref|XP_007159371.1|  hypothetical protein PHAVU_002G232600g           97.8    2e-19   
ref|XP_011029919.1|  PREDICTED: probable LRR receptor-like serine...  97.8    2e-19   
ref|XP_006366775.1|  PREDICTED: leucine-rich repeat receptor-like...  97.8    2e-19   
ref|XP_010490063.1|  PREDICTED: receptor-like protein 12              94.7    2e-19   
emb|CDY28619.1|  BnaC09g32560D                                        97.8    2e-19   
emb|CDP11209.1|  unnamed protein product                              97.8    3e-19   
ref|XP_010554836.1|  PREDICTED: leucine-rich repeat receptor-like...  97.4    3e-19   
emb|CAN80774.1|  hypothetical protein VITISV_042330                   97.8    3e-19   
ref|XP_008808346.1|  PREDICTED: receptor-like protein kinase isof...  97.8    3e-19   
ref|XP_009142007.1|  PREDICTED: leucine-rich repeat receptor-like...  97.4    3e-19   
ref|XP_009601880.1|  PREDICTED: receptor-like protein kinase 5        97.8    3e-19   
ref|XP_010910700.1|  PREDICTED: receptor-like protein kinase HSL1...  97.4    3e-19   
gb|KHG09358.1|  Leucine-rich repeat receptor protein kinase EXS       97.1    3e-19   
ref|XP_010910701.1|  PREDICTED: receptor-like protein kinase HSL1...  97.4    3e-19   
ref|XP_010910702.1|  PREDICTED: receptor-like protein kinase HSL1...  97.4    3e-19   
ref|XP_009626861.1|  PREDICTED: leucine-rich repeat receptor-like...  97.4    3e-19   
ref|XP_010549355.1|  PREDICTED: receptor-like protein kinase HSL1     97.4    3e-19   
ref|XP_011075242.1|  PREDICTED: leucine-rich repeat receptor-like...  97.4    3e-19   
ref|XP_007227628.1|  hypothetical protein PRUPE_ppa024924mg           97.4    3e-19   
gb|KGN58774.1|  hypothetical protein Csa_3G731840                     97.4    3e-19   
ref|XP_009109717.1|  PREDICTED: receptor-like protein kinase HSL1...  97.1    3e-19   
ref|NP_001067968.1|  Os11g0514700                                     93.6    3e-19   
gb|EEE60412.1|  hypothetical protein OsJ_13601                        97.4    4e-19   
emb|CDY28301.1|  BnaC03g66580D                                        94.7    4e-19   
ref|XP_009612505.1|  PREDICTED: putative receptor-like protein ki...  94.0    4e-19   
ref|XP_009109716.1|  PREDICTED: receptor-like protein kinase HSL1...  97.4    4e-19   
ref|XP_010648291.1|  PREDICTED: receptor-like protein kinase HSL1     97.4    4e-19   
ref|XP_008808347.1|  PREDICTED: receptor-like protein kinase isof...  97.4    4e-19   
ref|XP_012092411.1|  PREDICTED: receptor-like protein kinase HSL1     97.4    4e-19   
gb|KHG10910.1|  Receptor-like protein kinase HSL1                     97.4    4e-19   
ref|XP_011078903.1|  PREDICTED: leucine-rich repeat receptor-like...  97.1    4e-19   
ref|XP_008390700.1|  PREDICTED: leucine-rich repeat receptor-like...  97.4    4e-19   
gb|KDP21014.1|  hypothetical protein JCGZ_21485                       97.1    4e-19   
ref|XP_002525004.1|  Receptor protein kinase CLAVATA1 precursor, ...  97.4    4e-19   
ref|XP_006657092.1|  PREDICTED: probable LRR receptor-like serine...  97.4    4e-19   
ref|XP_010269438.1|  PREDICTED: probable leucine-rich repeat rece...  97.1    4e-19   
ref|XP_003555482.1|  PREDICTED: receptor-like protein kinase-like     97.1    4e-19   
ref|XP_008390699.1|  PREDICTED: leucine-rich repeat receptor-like...  97.1    4e-19   
ref|XP_006599802.1|  PREDICTED: receptor-like protein kinase HSL1...  96.7    4e-19   
ref|XP_008244025.1|  PREDICTED: receptor-like protein 12              97.1    4e-19   
ref|XP_003535477.1|  PREDICTED: receptor-like protein kinase-like     97.1    4e-19   
gb|EMT08520.1|  Receptor-like protein kinase HSL1                     95.5    4e-19   
gb|KDP33341.1|  hypothetical protein JCGZ_12890                       97.1    4e-19   
ref|XP_004295974.2|  PREDICTED: probable LRR receptor-like serine...  97.1    5e-19   
dbj|BAJ92095.1|  predicted protein                                    96.7    5e-19   
ref|XP_006845564.1|  PREDICTED: receptor-like protein kinase          97.1    5e-19   
ref|XP_008794105.1|  PREDICTED: receptor-like protein kinase 5        97.1    5e-19   
gb|KJB77506.1|  hypothetical protein B456_012G140900                  96.3    5e-19   
ref|XP_002527456.1|  serine-threonine protein kinase, plant-type,...  96.7    5e-19   
ref|XP_002516515.1|  Receptor protein kinase CLAVATA1 precursor, ...  96.7    5e-19   
ref|XP_002310940.2|  leucine-rich repeat transmembrane protein ki...  97.1    5e-19   
ref|XP_004234600.2|  PREDICTED: probable LRR receptor-like serine...  97.1    5e-19   
ref|XP_006411451.1|  hypothetical protein EUTSA_v10016216mg           96.7    5e-19   
ref|XP_006377415.1|  hypothetical protein POPTR_0011s05710g           96.7    5e-19   
ref|XP_008242544.1|  PREDICTED: receptor-like protein kinase HSL1     97.1    5e-19   
gb|AIY22764.1|  somatic embryogenesis receptor-like kinase 4 protein  95.9    5e-19   
gb|KJB52934.1|  hypothetical protein B456_008G284000                  96.3    5e-19   
ref|XP_011001223.1|  PREDICTED: receptor-like protein kinase HSL1     96.7    5e-19   
ref|XP_009604574.1|  PREDICTED: LRR receptor-like serine/threonin...  94.0    5e-19   
tpg|DAA46730.1|  TPA: putative leucine-rich repeat receptor-like ...  96.7    5e-19   
dbj|BAJ87195.1|  predicted protein                                    96.7    5e-19   
ref|XP_010091146.1|  Leucine-rich repeat receptor-like tyrosine-p...  96.7    5e-19   
gb|KJB52935.1|  hypothetical protein B456_008G284000                  95.5    5e-19   
ref|XP_002278590.1|  PREDICTED: probable LRR receptor-like serine...  96.7    6e-19   
ref|XP_008655644.1|  PREDICTED: probable LRR receptor-like serine...  96.7    6e-19   
ref|XP_009405286.1|  PREDICTED: probable LRR receptor-like serine...  96.7    6e-19   
emb|CDY30809.1|  BnaC05g21850D                                        96.7    6e-19   
ref|XP_008805135.1|  PREDICTED: LRR receptor-like serine/threonin...  96.7    6e-19   
ref|XP_008380223.1|  PREDICTED: probable LRR receptor-like serine...  96.7    6e-19   
gb|EDN71345.1|  receptor protein kinase                               97.4    6e-19   
gb|KJB77505.1|  hypothetical protein B456_012G140900                  95.9    6e-19   
ref|XP_006450707.1|  hypothetical protein CICLE_v10007358mg           96.7    6e-19   
ref|XP_009104914.1|  PREDICTED: receptor-like protein 12              96.3    6e-19   
ref|XP_009113661.1|  PREDICTED: receptor-like protein kinase HSL1     96.7    6e-19   
ref|XP_004983379.1|  PREDICTED: probable leucine-rich repeat rece...  96.7    6e-19   
ref|XP_008659490.1|  PREDICTED: leucine-rich repeat receptor-like...  96.7    6e-19   
ref|XP_010915378.1|  PREDICTED: receptor-like protein kinase HSL1     96.7    6e-19   
ref|XP_003549165.1|  PREDICTED: receptor-like protein kinase HSL1...  96.7    6e-19   
ref|XP_010317513.1|  PREDICTED: LRR receptor-like serine/threonin...  93.2    7e-19   
ref|XP_007157942.1|  hypothetical protein PHAVU_002G111100g           96.7    7e-19   
ref|XP_004304387.1|  PREDICTED: leucine-rich repeat receptor-like...  96.3    7e-19   
gb|KHF97470.1|  hypothetical protein F383_36821                       96.3    7e-19   
ref|XP_010498068.1|  PREDICTED: leucine-rich repeat receptor-like...  96.7    7e-19   
gb|KFK24159.1|  hypothetical protein AALP_AAs61366U000100             96.3    7e-19   
ref|XP_012067452.1|  PREDICTED: receptor-like protein kinase          96.3    7e-19   
emb|CAN69176.1|  hypothetical protein VITISV_029773                   96.3    8e-19   
ref|XP_003577544.1|  PREDICTED: somatic embryogenesis receptor ki...  92.0    8e-19   
ref|XP_002526114.1|  receptor-kinase, putative                        96.3    8e-19   
ref|XP_002963822.1|  hypothetical protein SELMODRAFT_30332            96.3    8e-19   
gb|KFK24158.1|  hypothetical protein AALP_AAs61366U000100             96.3    8e-19   
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480        96.3    8e-19   
ref|XP_009804960.1|  PREDICTED: probable LRR receptor-like serine...  96.3    8e-19   
ref|XP_003577543.1|  PREDICTED: somatic embryogenesis receptor ki...  92.4    8e-19   
ref|XP_010064761.1|  PREDICTED: probable LRR receptor-like serine...  95.9    9e-19   
ref|XP_009387801.1|  PREDICTED: probable leucine-rich repeat rece...  94.0    9e-19   
emb|CDY46116.1|  BnaA03g52520D                                        95.1    9e-19   
ref|XP_010915380.1|  PREDICTED: receptor-like protein kinase HSL1     95.9    1e-18   
ref|XP_008451149.1|  PREDICTED: receptor-like protein kinase HSL1     93.2    1e-18   
ref|XP_007021924.1|  Serine-threonine protein kinase                  93.6    1e-18   
emb|CBI18143.3|  unnamed protein product                              95.5    1e-18   
ref|XP_006306625.1|  hypothetical protein CARUB_v10008143mg           95.9    1e-18   
ref|XP_006367834.1|  PREDICTED: probable LRR receptor-like serine...  95.1    1e-18   
ref|XP_010476866.1|  PREDICTED: leucine-rich repeat receptor-like...  95.9    1e-18   
ref|XP_010668729.1|  PREDICTED: receptor-like protein kinase HSL1     95.9    1e-18   
ref|XP_010476867.1|  PREDICTED: leucine-rich repeat receptor-like...  95.9    1e-18   
ref|XP_010063641.1|  PREDICTED: receptor-like protein kinase          95.9    1e-18   
ref|XP_006416726.1|  hypothetical protein EUTSA_v10006611mg           95.9    1e-18   
ref|XP_009138189.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  95.1    1e-18   
ref|XP_009795019.1|  PREDICTED: receptor-like protein kinase HSL1     95.9    1e-18   
ref|XP_009396936.1|  PREDICTED: probable leucine-rich repeat rece...  94.4    1e-18   
emb|CDY45042.1|  BnaA08g11770D                                        95.1    1e-18   
ref|XP_002867182.1|  bri1-associated receptor kinase                  95.1    1e-18   
ref|XP_002274434.2|  PREDICTED: probable LRR receptor-like serine...  95.5    1e-18   
gb|AAK68074.1|AF384970_1  somatic embryogenesis receptor-like kin...  95.1    1e-18   
ref|WP_035088285.1|  hypothetical protein                             96.3    1e-18   
ref|XP_011030777.1|  PREDICTED: leucine-rich repeat receptor-like...  95.9    1e-18   
ref|XP_009108801.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  94.7    1e-18   
ref|XP_002278698.1|  PREDICTED: receptor-like protein kinase HSL1     95.5    1e-18   
ref|NP_567920.1|  Leu-rich receptor Serine/threonine protein kina...  94.7    1e-18   
emb|CDY48766.1|  BnaC04g02190D                                        95.5    1e-18   
ref|XP_002972810.1|  hypothetical protein SELMODRAFT_413431           95.1    1e-18   
ref|XP_009381187.1|  PREDICTED: receptor-like protein kinase HSL1     95.5    1e-18   
ref|XP_006421410.1|  hypothetical protein CICLE_v100042992mg          92.4    1e-18   
gb|ABF73316.1|  clavata-like receptor                                 95.5    1e-18   
gb|KJB79702.1|  hypothetical protein B456_013G062900                  91.7    2e-18   
ref|XP_010026000.1|  PREDICTED: probable leucine-rich repeat rece...  94.7    2e-18   
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g           95.5    2e-18   
gb|KJB64285.1|  hypothetical protein B456_010G040400                  94.0    2e-18   
ref|XP_010246887.1|  PREDICTED: receptor-like protein kinase          95.5    2e-18   
ref|XP_009772313.1|  PREDICTED: probable LRR receptor-like serine...  95.5    2e-18   
ref|XP_007028772.1|  Leucine-rich repeat protein kinase family pr...  95.1    2e-18   
ref|XP_010459295.1|  PREDICTED: leucine-rich repeat receptor-like...  95.1    2e-18   
gb|KGN66179.1|  hypothetical protein Csa_1G574950                     92.4    2e-18   
ref|XP_010674253.1|  PREDICTED: leucine-rich repeat receptor-like...  94.0    2e-18   
ref|XP_010265745.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-18   
gb|KCW68823.1|  hypothetical protein EUGRSUZ_F02424                   92.0    2e-18   
ref|XP_009608276.1|  PREDICTED: probably inactive leucine-rich re...  95.1    2e-18   
ref|XP_004485839.1|  PREDICTED: receptor-like protein kinase HSL1...  95.1    2e-18   
ref|XP_007158089.1|  hypothetical protein PHAVU_002G123200g           95.1    2e-18   
gb|KJB19275.1|  hypothetical protein B456_003G092400                  94.7    2e-18   
gb|KJB14600.1|  hypothetical protein B456_002G133000                  95.1    2e-18   
gb|KJB59075.1|  hypothetical protein B456_009G2377002                 92.4    2e-18   
ref|WP_027271448.1|  hypothetical protein                             91.7    2e-18   
gb|KJB77508.1|  hypothetical protein B456_012G141000                  93.2    2e-18   
gb|KDO39241.1|  hypothetical protein CISIN_1g046683mg                 91.7    2e-18   
ref|XP_004485840.1|  PREDICTED: receptor-like protein kinase HSL1...  94.7    2e-18   
gb|KCW58244.1|  hypothetical protein EUGRSUZ_H00949                   94.7    2e-18   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...  94.7    2e-18   
ref|WP_010653235.1|  RHS repeat-associated core domain-containing...  91.7    2e-18   
emb|CDP08193.1|  unnamed protein product                              94.7    2e-18   
ref|XP_003617047.1|  Receptor-like protein kinase                     94.7    2e-18   
emb|CDX88206.1|  BnaA06g27970D                                        94.7    2e-18   
ref|XP_008377334.1|  PREDICTED: leucine-rich repeat receptor prot...  95.1    3e-18   
ref|XP_009620321.1|  PREDICTED: probable LRR receptor-like serine...  94.7    3e-18   
ref|XP_009387191.1|  PREDICTED: probable LRR receptor-like serine...  94.7    3e-18   
emb|CDP11288.1|  unnamed protein product                              94.7    3e-18   
ref|XP_011019562.1|  PREDICTED: receptor-like protein kinase HSL1     94.7    3e-18   
gb|ABR18304.1|  unknown                                               94.7    3e-18   
ref|XP_006441216.1|  hypothetical protein CICLE_v10018613mg           94.7    3e-18   
ref|XP_007144218.1|  hypothetical protein PHAVU_007G137800g           94.7    3e-18   
ref|XP_006443728.1|  hypothetical protein CICLE_v10023610mg           94.7    3e-18   
emb|CDX80548.1|  BnaC07g28960D                                        94.4    3e-18   
ref|XP_002975437.1|  hypothetical protein SELMODRAFT_30410            94.7    3e-18   
ref|XP_009611661.1|  PREDICTED: probable LRR receptor-like serine...  94.7    3e-18   
ref|XP_009142780.1|  PREDICTED: leucine-rich repeat receptor-like...  94.4    3e-18   
gb|KHG25031.1|  Receptor-like protein kinase HSL1                     94.7    3e-18   
ref|XP_006429335.1|  hypothetical protein CICLE_v10010968mg           94.7    3e-18   
ref|XP_007155271.1|  hypothetical protein PHAVU_003G187200g           94.7    3e-18   
ref|XP_006489937.1|  PREDICTED: leucine-rich repeat receptor-like...  94.4    3e-18   
ref|XP_004295705.1|  PREDICTED: leucine-rich repeat receptor-like...  94.7    3e-18   
ref|XP_010905353.1|  PREDICTED: probable LRR receptor-like serine...  94.7    3e-18   
emb|CBN79919.1|  Hypothetical leucine rich repeat protein             90.5    3e-18   
gb|KDO52815.1|  hypothetical protein CISIN_1g001226mg                 94.7    3e-18   
gb|KJB31630.1|  hypothetical protein B456_005G199100                  94.4    3e-18   
ref|XP_009611662.1|  PREDICTED: LRR receptor-like serine/threonin...  94.4    3e-18   
ref|XP_002311912.2|  leucine-rich repeat transmembrane protein ki...  94.4    3e-18   
ref|XP_002273607.2|  PREDICTED: receptor-like protein kinase          94.4    3e-18   
ref|XP_010933195.1|  PREDICTED: probable LRR receptor-like serine...  94.4    3e-18   
ref|XP_003619087.1|  Receptor-like protein kinase                     94.4    3e-18   
ref|XP_002982402.1|  hypothetical protein SELMODRAFT_116152           94.4    3e-18   
gb|KFK37022.1|  hypothetical protein AALP_AA4G202100                  94.4    3e-18   
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...  94.4    4e-18   
gb|EEC68243.1|  hypothetical protein OsI_36258                        90.1    4e-18   
ref|XP_009415190.1|  PREDICTED: receptor-like protein kinase HSL1     94.4    4e-18   
ref|XP_008455491.1|  PREDICTED: receptor-like protein kinase HSL1     94.4    4e-18   
ref|XP_008229456.1|  PREDICTED: probable LRR receptor-like serine...  92.4    4e-18   
ref|XP_002883811.1|  hypothetical protein ARALYDRAFT_319434           93.6    4e-18   
gb|KDO48084.1|  hypothetical protein CISIN_1g0097712mg                92.0    4e-18   
ref|XP_009400938.1|  PREDICTED: probable LRR receptor-like serine...  94.4    4e-18   
ref|WP_045478962.1|  hypothetical protein                             90.5    4e-18   
ref|XP_009409608.1|  PREDICTED: receptor-like protein kinase HSL1     94.4    4e-18   
gb|KJB69554.1|  hypothetical protein B456_011G030400                  94.0    4e-18   
gb|AES75305.2|  LRR receptor-like kinase                              94.0    4e-18   
gb|KJB64299.1|  hypothetical protein B456_010G041800                  94.0    4e-18   
ref|XP_006662947.1|  PREDICTED: somatic embryogenesis receptor ki...  90.5    4e-18   
emb|CDX72403.1|  BnaC07g44250D                                        93.2    4e-18   
ref|XP_006602905.1|  PREDICTED: probable leucine-rich repeat rece...  94.0    4e-18   
ref|XP_010907375.1|  PREDICTED: probable LRR receptor-like serine...  94.4    4e-18   
emb|CDY35751.1|  BnaC03g58720D                                        94.0    4e-18   



>ref|XP_011081744.1| PREDICTED: receptor-like protein kinase 5 [Sesamum indicum]
Length=730

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 130/184 (71%), Gaps = 5/184 (3%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSE  340
            +SQ L+ +   E+ ILL  KQHWG P SL + WNSTSSPCDWP I C S G+VT + LS 
Sbjct  18   HSQDLSGFSS-EQTILLSFKQHWGSPPSL-DSWNSTSSPCDWPEIECIS-GTVTALHLSG  74

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
              + G+ P++  ICQL NLVSIN   N++ G +PA L +CS LE L LS+N L+G I GE
Sbjct  75   KDLSGTIPST--ICQLKNLVSINLFDNNISGDVPAALYNCSSLERLRLSVNGLSGTIPGE  132

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
             F MK LR L+L GN L+G+IPTP+ A SLESLD+S N LNGSIPDDIGN  NL +LDLS
Sbjct  133  LFLMKKLRELHLDGNRLYGKIPTPIRASSLESLDLSDNQLNGSIPDDIGNLDNLMHLDLS  192

Query  701  MNSL  712
             NS 
Sbjct  193  NNSF  196


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 0/106 (0%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L S++ S N L G+IP ++ +   L  LDLS N  +G I    F M  L S+ L  N L 
Sbjct  162  LESLDLSDNQLNGSIPDDIGNLDNLMHLDLSNNSFSGTIPMRVFHMHQLYSMLLGYNNLS  221

Query  575  GEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            GE+PT +  +SL+ L+++ N L+G+IP  +G    LS LDLS N L
Sbjct  222  GELPTQLDFFSLQELNITHNQLHGTIPRSLGQLPQLSVLDLSDNHL  267



>ref|XP_009803852.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=709

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISC-NSNGSVTRISLSEMIMGGSFPAS  370
            E+++LL LKQHW  P  +F+ W+   SPC W G+SC N  G VT++ L    + G+ P++
Sbjct  25   EKSVLLSLKQHWSNP-EIFQSWDLKYSPCSWSGVSCMNGFGRVTQLVLGGNNITGTIPST  83

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
              ICQL NL  I+ S+N+++GTIP +L  CSKL+ LDLS N L G+I GE F M  L +L
Sbjct  84   --ICQLKNLTLIDLSNNNIFGTIPVSLMDCSKLQHLDLSNNYLRGQIPGELFRMDRLANL  141

Query  551  NLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+GNM  GE+P  + A  LE+LD+S N LNGSIP++ G+   L  LDLS NSL
Sbjct  142  YLKGNMFSGEMPKEISASQLENLDLSRNYLNGSIPEEFGSLKKLVKLDLSHNSL  195



>ref|XP_006364730.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Solanum tuberosum]
Length=709

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSE  340
            + Q    +   E++ILL LK+HW       + W+  SS C W G+ C  +  VT+++L E
Sbjct  52   FFQETLQFSVREQSILLSLKRHW-RDSEFLQSWDLNSSACTWSGVLCIDDRVVTQLNLGE  110

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
              + G  P S IICQL NL  I+ S+N++ GTIP  L  CS L+ LDLS N L  +I GE
Sbjct  111  KNITGKIP-STIICQLKNLNFIDLSNNNISGTIPVGLKDCSMLQHLDLSNNSLIDRIPGE  169

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
             F MK L SL L GNML GE+P   ++  LE+LD+S N LNGSIP+DIGNF NL  LDLS
Sbjct  170  LFGMKQLLSLYLNGNMLSGEMP-KQISSQLENLDLSENHLNGSIPEDIGNFKNLLKLDLS  228

Query  701  MNSL  712
             NSL
Sbjct  229  HNSL  232


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 64/123 (52%), Gaps = 4/123 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G  P   I  QL NL   + S N L G+IP ++ +   L  LDLS N L+G I  + 
Sbjct  185  MLSGEMPKQ-ISSQLENL---DLSENHLNGSIPEDIGNFKNLLKLDLSHNSLSGSITSKL  240

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            F +  LR L+L  N L G IP  M  +SL  +D+S N L GSIP        L  LDLS 
Sbjct  241  FQLHDLRHLSLSSNYLSGVIPDEMDLFSLYDMDLSHNQLTGSIPKGFQYLPGLHALDLSY  300

Query  704  NSL  712
            N L
Sbjct  301  NQL  303



>ref|XP_010325071.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Solanum lycopersicum]
Length=697

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = +2

Query  167  QSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMI  346
            Q    +   ER+ILL +KQHW      F+ WNS SS C WPG+ C  +  VT + L    
Sbjct  24   QETLQFSGTERSILLNMKQHWS-DSEFFQSWNSNSSECTWPGVWCIDDRVVTELHLGGKN  82

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+   S+I+C+L NL  I+ S+N++ G IP +L  CS L+ LDLS N L+ +I GE F
Sbjct  83   ITGTI--SSILCELKNLTFIDLSNNNISGIIPLSLKDCSMLQHLDLSNNSLSDRIPGELF  140

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             MK L +L L GNML GE+P  + +  L++L++S N LNGSIP+DIGN  N+  LD+S N
Sbjct  141  EMKQLLNLYLNGNMLSGEMPKEIASSQLKNLNLSENYLNGSIPEDIGNLKNIVKLDMSHN  200

Query  707  SL  712
            SL
Sbjct  201  SL  202


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G  P      QL NL   N S N L G+IP ++ +   +  LD+S N L+G I  + 
Sbjct  154  MLSGEMPKEIASSQLKNL---NLSENYLNGSIPEDIGNLKNIVKLDMSHNSLSGSITNKL  210

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            F +  LR L+L  N L   IP  M  +SL  +D+S N L GSIP        L  LDLS 
Sbjct  211  FQLHHLRHLSLSFNYLSSVIPDEMNLFSLYDMDLSHNQLTGSIPRGFQYLPGLHALDLSY  270

Query  704  NSL  712
            N L
Sbjct  271  NQL  273



>ref|XP_004245385.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Solanum lycopersicum]
Length=683

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 110/173 (64%), Gaps = 3/173 (2%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            E+ +LL LKQHW       + WNS SS C W G+ C  +  VT + L    + G+   S+
Sbjct  19   EQTVLLKLKQHWS-DSEFLQSWNSNSSECTWSGVWCIDDRVVTELHLGGKNITGTI--SS  75

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            I+C+L NL  I+ S+N++ G IP +L  CS L+ LDLS N L+ +I GE F MK L +L 
Sbjct  76   ILCELKNLTFIDLSNNNISGIIPLSLKDCSMLQHLDLSNNSLSDRIPGELFEMKQLLNLY  135

Query  554  LRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L GNML GE+P  + +  L++L++S N LNGSIP+DIGN  N+  LD+S NSL
Sbjct  136  LNGNMLSGEMPKEIASSQLKNLNLSENYLNGSIPEDIGNLKNIVKLDMSHNSL  188


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G  P      QL NL   N S N L G+IP ++ +   +  LD+S N L+G I  + 
Sbjct  140  MLSGEMPKEIASSQLKNL---NLSENYLNGSIPEDIGNLKNIVKLDMSHNSLSGSITNKL  196

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            F +  LR L+L  N L   IP  M  +SL  +D+S N L GSIP        L  LDLS 
Sbjct  197  FQLHHLRHLSLSFNYLSSVIPDEMTLFSLYDMDLSHNQLTGSIPRGFQYLPGLHALDLSY  256

Query  704  NSL  712
            N L
Sbjct  257  NQL  259



>ref|XP_006364729.1| PREDICTED: receptor-like protein kinase 5-like [Solanum tuberosum]
Length=698

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 109/173 (63%), Gaps = 3/173 (2%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            E+++LL LKQHW       + W+  SS C W G+SC     VT + L    + G+   S+
Sbjct  34   EQSVLLKLKQHWS-DSEFLQSWDLNSSECTWSGVSCIDGRVVTELHLGGKDITGTI--SS  90

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             IC+L NL  I+ S+N++ G IP +L+ CS L+ LDLS N L  +I GE F MK + +L 
Sbjct  91   TICELKNLTFIDLSNNNISGIIPVSLNDCSMLQHLDLSNNSLNDRIPGELFGMKQILNLY  150

Query  554  LRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L GNML GE+P  + +  L++L++S N LNGSIP+DIGN  N+  LD+S NSL
Sbjct  151  LNGNMLSGEMPKEISSSQLKNLNLSENYLNGSIPEDIGNLKNIVKLDMSHNSL  203


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G  P      QL NL   N S N L G+IP ++ +   +  LD+S N L+G I  + 
Sbjct  155  MLSGEMPKEISSSQLKNL---NLSENYLNGSIPEDIGNLKNIVKLDMSHNSLSGSITNQL  211

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            F +  LR L+L  N L   IP  M  +SL ++D+S N L GSIP        L  LDLS 
Sbjct  212  FQLHHLRHLSLSSNYLSSVIPDEMDLFSLYAMDLSHNQLTGSIPKGFRYLPGLHALDLSY  271

Query  704  NSL  712
            N L
Sbjct  272  NQL  274



>ref|XP_009600837.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nicotiana 
tomentosiformis]
Length=177

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = +2

Query  302  NSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            N  G VT++ L E  + G+ P +  ICQLNNL  I+ S N++ GTIPA+L  CSKL+ LD
Sbjct  2    NGFGRVTQLILGEKNITGTIPTA--ICQLNNLTLIDLSDNNISGTIPASLKDCSKLQHLD  59

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPD  658
            LS N L G+I GE F MK L +L L GNM  GE+P  + + S LE+LD+S N LNGSIP+
Sbjct  60   LSNNYLRGQIPGELFGMKKLVTLYLNGNMFSGEMPKEISSASQLENLDLSGNYLNGSIPE  119

Query  659  DIGNFYNLSYLDLSMNSL  712
            + G+   L  LDLS NSL
Sbjct  120  EFGSLKKLVKLDLSHNSL  137



>ref|XP_006475995.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis]
Length=1024

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 103/174 (59%), Gaps = 5/174 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            +ER ILL LKQ  G P SL + W STSSPCDWP I+C  N SVT ISL    +    P  
Sbjct  35   EERTILLNLKQQLGNPPSL-QSWTSTSSPCDWPEITCTFN-SVTGISLRHKDITQKIPP-  91

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
             IIC L NL +I+ SSNS+ G  P  L +C+KL+ LDLS N   G I  +   +  L+ +
Sbjct  92   -IICDLKNLTTIDLSSNSIPGEFPEFLYNCTKLQNLDLSQNYFVGPIPSDIDRISGLQCI  150

Query  551  NLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            +L GN   G+IP  +   S L++L +  N+ NG+ P +IG+  NL  L L+ NS
Sbjct  151  DLGGNNFSGDIPRSIGRLSELQTLYLYMNEFNGTFPKEIGDLSNLEVLGLAYNS  204


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L  L ++  +  +L G IP  +S+ S LE L L+ N L G I    F +  L  L L  N
Sbjct  218  LKKLKTLWMTEANLIGEIPEAMSNLSSLEILALNGNHLEGAIPSGLFLLNNLTQLFLYDN  277

Query  566  MLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L GEIP+ + A  L  +D+S N+L GSIP++ G   NL  L L  N L
Sbjct  278  ILSGEIPSSVEALKLTDIDLSMNNLTGSIPEEFGKLKNLQLLGLFSNHL  326


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 5/121 (4%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            +  G  P    +  L++L ++    N L G +P+ + S + L  L+L+ N+L+G+I    
Sbjct  491  LFSGEIPVE--LTSLSHLNTLLLDGNKLSGKLPSQIVSWTSLNNLNLARNELSGEIPKAI  548

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             S+  + SL+L GN   GEIP  +    L + ++SSN L G+IPD+   F NL+Y D  +
Sbjct  549  GSLLVMVSLDLSGNQFSGEIPPEIGQLKLNTFNLSSNKLYGNIPDE---FNNLAYDDSFL  605

Query  704  N  706
            N
Sbjct  606  N  606


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +TR+ +S     G       +    NL+    S+N   G IP  L+S S L TL L  N 
Sbjct  458  LTRLEISNNRFSGQIQRG--VGSWKNLIVFKASNNLFSGEIPVELTSLSHLNTLLLDGNK  515

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNF  673
            L+GK+  +  S  +L +LNL  N L GEIP  + +   + SLD+S N  +G IP +IG  
Sbjct  516  LSGKLPSQIVSWTSLNNLNLARNELSGEIPKAIGSLLVMVSLDLSGNQFSGEIPPEIGQL  575

Query  674  YNLSYLDLSMNSL  712
              L+  +LS N L
Sbjct  576  -KLNTFNLSSNKL  587


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 4/123 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P+   +  LNNL  +    N L G IP+++ +  KL  +DLS+N+LTG I  EF 
Sbjct  255  LEGAIPSGLFL--LNNLTQLFLYDNILSGEIPSSVEAL-KLTDIDLSMNNLTGSIPEEFG  311

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +K L+ L L  N L GE+P  +    +L+   V +N L+G +P +IG    L   ++S 
Sbjct  312  KLKNLQLLGLFSNHLSGEVPASIGKIPALKKFKVFNNSLSGVLPPEIGLHSALEGFEVST  371

Query  704  NSL  712
            N  
Sbjct  372  NQF  374



>gb|KDO79911.1| hypothetical protein CISIN_1g001706mg [Citrus sinensis]
Length=969

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 103/174 (59%), Gaps = 5/174 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            +ER ILL LKQ  G P SL + W STSSPCDWP I+C  N SVT ISL    +    P  
Sbjct  35   EERTILLNLKQQLGNPPSL-QSWTSTSSPCDWPEITCTFN-SVTGISLRHKDITQKIPP-  91

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
             IIC L NL +I+ SSNS+ G  P  L +C+KL+ LDLS N   G I  +   +  L+ +
Sbjct  92   -IICDLKNLTTIDLSSNSIPGEFPEFLYNCTKLQNLDLSQNYFVGPIPSDIDRISGLQCI  150

Query  551  NLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            +L GN   G+IP  +   S L++L +  N+ NG+ P +IG+  NL  L L+ NS
Sbjct  151  DLGGNNFSGDIPRSIGRLSELQTLYLYMNEFNGTFPKEIGDLSNLEVLGLAYNS  204


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L  L ++  +  +L G IP  +S+ S LE L L+ N L G I    F +  L  L L  N
Sbjct  218  LKKLKTLWMTEANLIGEIPEAMSNLSSLEILALNGNHLEGAIPSGLFLLNNLTQLFLYDN  277

Query  566  MLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L GEIP+ + A  L  +D+S N+L GSIP++ G   NL  L L  N L
Sbjct  278  ILSGEIPSSVEALKLTDIDLSMNNLTGSIPEEFGKLKNLQLLGLFSNHL  326


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 5/121 (4%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            +  G  P    +  L++L ++    N L G +P+ + S + L  L+L+ N+L+G+I    
Sbjct  436  LFSGEIPVE--LTSLSHLNTLLLDGNKLSGKLPSQIVSWTSLNNLNLARNELSGEIPKAI  493

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             S+  + SL+L GN   GEIP  +    L + ++SSN L G+IPD+   F NL+Y D  +
Sbjct  494  GSLLVMVSLDLSGNQFSGEIPPEIGQLKLNTFNLSSNKLYGNIPDE---FNNLAYDDSFL  550

Query  704  N  706
            N
Sbjct  551  N  551


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +TR+ +S     G       +    NL+    S+N   G IP  L+S S L TL L  N 
Sbjct  403  LTRLEISNNRFSGQIQRG--VGSWKNLIVFKASNNLFSGEIPVELTSLSHLNTLLLDGNK  460

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNF  673
            L+GK+  +  S  +L +LNL  N L GEIP  + +   + SLD+S N  +G IP +IG  
Sbjct  461  LSGKLPSQIVSWTSLNNLNLARNELSGEIPKAIGSLLVMVSLDLSGNQFSGEIPPEIGQL  520

Query  674  YNLSYLDLSMNSL  712
              L+  +LS N L
Sbjct  521  -KLNTFNLSSNKL  532


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P+   +  LNNL  +    N L G IP+++ +  KL  +DLS+N+LTG I  EF 
Sbjct  255  LEGAIPSGLFL--LNNLTQLFLYDNILSGEIPSSVEAL-KLTDIDLSMNNLTGSIPEEFG  311

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             +K L+ L L  N L GE+P  +   + E      N+L+G++P  +GN   L  + L  N
Sbjct  312  KLKNLQLLGLFSNHLSGEVPASIGVVAFE------NNLSGAVPKSLGNCRTLRTVQLYSN  365


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 72/148 (49%), Gaps = 23/148 (16%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T++ L + I+ G  P+S    +L +   I+ S N+L G+IP        L+ L L  N 
Sbjct  269  LTQLFLYDNILSGEIPSSVEALKLTD---IDLSMNNLTGSIPEEFGKLKNLQLLGLFSNH  325

Query  497  LTGKIAGEFFSM-----------------KTLRSLNLRGNMLFGEIPTPM-VAYSLESLD  622
            L+G++      +                 +TLR++ L  N   GE+PT +   ++L SL 
Sbjct  326  LSGEVPASIGVVAFENNLSGAVPKSLGNCRTLRTVQLYSNRFSGELPTGLWTTFNLSSLM  385

Query  623  VSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +S N ++G +P      +NL+ L++S N
Sbjct  386  LSDNTISGELPSKTA--WNLTRLEISNN  411



>gb|KDO79910.1| hypothetical protein CISIN_1g001706mg [Citrus sinensis]
Length=1024

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 103/174 (59%), Gaps = 5/174 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            +ER ILL LKQ  G P SL + W STSSPCDWP I+C  N SVT ISL    +    P  
Sbjct  35   EERTILLNLKQQLGNPPSL-QSWTSTSSPCDWPEITCTFN-SVTGISLRHKDITQKIPP-  91

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
             IIC L NL +I+ SSNS+ G  P  L +C+KL+ LDLS N   G I  +   +  L+ +
Sbjct  92   -IICDLKNLTTIDLSSNSIPGEFPEFLYNCTKLQNLDLSQNYFVGPIPSDIDRISGLQCI  150

Query  551  NLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            +L GN   G+IP  +   S L++L +  N+ NG+ P +IG+  NL  L L+ NS
Sbjct  151  DLGGNNFSGDIPRSIGRLSELQTLYLYMNEFNGTFPKEIGDLSNLEVLGLAYNS  204


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L  L ++  +  +L G IP  +S+ S LE L L+ N L G I    F +  L  L L  N
Sbjct  218  LKKLKTLWMTEANLIGEIPEAMSNLSSLEILALNGNHLEGAIPSGLFLLNNLTQLFLYDN  277

Query  566  MLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L GEIP+ + A  L  +D+S N+L GSIP++ G   NL  L L  N L
Sbjct  278  ILSGEIPSSVEALKLTDIDLSMNNLTGSIPEEFGKLKNLQLLGLFSNHL  326


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +TR+ +S     G       +    NL+    S+N   G IP  L+S S L TL L  N 
Sbjct  458  LTRLEISNNRFSGQIQRG--VGSWKNLIVFKASNNLFSGEIPVELTSLSHLNTLLLDGNK  515

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNF  673
            L+GK+  +  S  +L +LNL  N L GEIP  + +   + SLD+S N  +G IP +IG  
Sbjct  516  LSGKLPSQIVSWTSLNNLNLARNELSGEIPKAIGSLLVMVSLDLSGNQFSGEIPPEIGQL  575

Query  674  YNLSYLDLSMNSL  712
              L+  +LS N L
Sbjct  576  -KLNTFNLSSNKL  587


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 5/121 (4%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            +  G  P    +  L++L ++    N L G +P+ + S + L  L+L+ N+L+G+I    
Sbjct  491  LFSGEIPVE--LTSLSHLNTLLLDGNKLSGKLPSQIVSWTSLNNLNLARNELSGEIPKAI  548

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             S+  + SL+L GN   GEIP  +    L + ++SSN L G+IPD+   F NL+Y D  +
Sbjct  549  GSLLVMVSLDLSGNQFSGEIPPEIGQLKLNTFNLSSNKLYGNIPDE---FNNLAYDDSFL  605

Query  704  N  706
            N
Sbjct  606  N  606


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 4/123 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P+   +  LNNL  +    N L G IP+++ +  KL  +DLS+N+LTG I  EF 
Sbjct  255  LEGAIPSGLFL--LNNLTQLFLYDNILSGEIPSSVEAL-KLTDIDLSMNNLTGSIPEEFG  311

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +K L+ L L  N L GE+P  +    +L+   V +N L+G +P +IG    L   ++S 
Sbjct  312  KLKNLQLLGLFSNHLSGEVPASIGKIPALKKFKVFNNSLSGVLPPEIGLHSALEGFEVST  371

Query  704  NSL  712
            N  
Sbjct  372  NQF  374



>ref|XP_006364719.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=637

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 107/206 (52%), Gaps = 26/206 (13%)
 Frame = +2

Query  167  QSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMI  346
            Q    +   ER+ LL LKQHW      F+ WN  SS C+W G+SC ++   T+++L E  
Sbjct  12   QETLQFSGTERSTLLSLKQHW-RDSEFFQSWNLNSSECNWLGVSCINDMVETQLNLGEKN  70

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLE------------------  472
            + G+ P S IICQLNNL  I+ S+N++ GTIP +L  CS L+                  
Sbjct  71   ITGTIP-STIICQLNNLTFIDLSNNNISGTIPLSLKDCSMLQHLDLFNNSLSGRIPEAIG  129

Query  473  ------TLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSN  634
                   LDLS N L+G I  + F +  L  L+L  N L G +P  M  +SL  +D+S N
Sbjct  130  NLKNLVKLDLSHNSLSGSITSKLFQLNQLSHLSLSYNYLSGVLPNAMNLFSLYDMDLSHN  189

Query  635  DLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GSIP  + +   L  LDLS N L
Sbjct  190  QLTGSIPKGLASSTGLDALDLSYNQL  215



>ref|XP_012076874.1| PREDICTED: receptor-like protein kinase HSL1 [Jatropha curcas]
 gb|KDP33799.1| hypothetical protein JCGZ_07370 [Jatropha curcas]
Length=968

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 101/179 (56%), Gaps = 7/179 (4%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQW--NSTSSPCDWPGISCNSN-GSVTRISLSEMIMGGS  358
            + E+ ILL LKQHW     + +QW  +++SS C WPG++CNSN  S+  + L+ M + G+
Sbjct  30   DQEQEILLRLKQHWRNQ-PVLDQWTPSTSSSYCTWPGVNCNSNNSSIVGLGLANMSISGT  88

Query  359  FPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKT  538
             P    IC L NL  +NF +NS  GT P +L +CSKLE LDL+ N   GK+  +   +  
Sbjct  89   IPP--FICDLKNLTVVNFYNNSFTGTFPVSLFNCSKLEYLDLAQNYFVGKLPDDIDRLSR  146

Query  539  LRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L  LNL  N   G +P  +     L +L +  N  NG+ P +IG  +NL  L ++ NS 
Sbjct  147  LSYLNLYANNFTGNVPVAIGRLQELRNLQLQQNQFNGTFPSEIGELFNLEVLYMAYNSF  205


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  + FS+++L G IP  +     LE LDLS N+L+GKI      +K L  L L  
Sbjct  216  QLKKLKELWFSNSNLIGEIPDMIGEMVALERLDLSGNELSGKIPSSLLMLKNLSVLYLYK  275

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L+GEIP  + A +L  +D+S N+L G+IPDD G    LS L L  N L
Sbjct  276  NQLYGEIPHVVEALNLTVIDLSDNNLIGTIPDDFGKLTKLSDLRLFFNQL  325


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++ R+ LS   + G  P+S ++  L NL  +    N L+G IP  + + + L  +DLS N
Sbjct  243  ALERLDLSGNELSGKIPSSLLM--LKNLSVLYLYKNQLYGEIPHVVEALN-LTVIDLSDN  299

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +L G I  +F  +  L  L L  N L GEIP  +    +++ + + SN+L+G IP + G 
Sbjct  300  NLIGTIPDDFGKLTKLSDLRLFFNQLSGEIPEGIARLPAIKDILLFSNNLSGLIPQEFGR  359

Query  671  FYNLSYLDLSMNSL  712
               L   +++ N  
Sbjct  360  HSMLETFEVASNRF  373


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 46/90 (51%), Gaps = 3/90 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ +S     G  P         NLV  N S+N L GTIP  L++   L TL L  N 
Sbjct  457  LRRLEISNNRFSGKIPTGD---SWRNLVVFNASNNQLSGTIPQELTALPFLTTLLLDRNQ  513

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIP  586
            L+G I  +  S K+L +LNL  N L GEIP
Sbjct  514  LSGAIPSDIISWKSLNTLNLSRNQLSGEIP  543



>ref|XP_008220120.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=1022

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 103/172 (60%), Gaps = 5/172 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            E++ILL LK  WG P S+   WNS+S PCDWP ++C +NG+VT I LS+  +    P + 
Sbjct  34   EQSILLKLKDQWGNPPSI-HSWNSSSLPCDWPEVNC-TNGAVTGIFLSQKNITEKIPET-  90

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             +C L++L  ++ + N + G  P +L +CSKL+ LDLS N   G+I  +   M +LR L+
Sbjct  91   -VCYLSSLAELDLAWNFIPGEFPDSLYNCSKLQVLDLSQNYFVGRIPNDIDRMSSLRYLD  149

Query  554  LRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L GN   G+IP  +     L++L +  N  NGS+P +IGN  NL   D+  N
Sbjct  150  LGGNNFSGDIPAEIGRLPELQTLRLYQNFFNGSVPSEIGNLSNLEIFDMPFN  201


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 76/137 (55%), Gaps = 3/137 (2%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSF-PAS--AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G+++ + + +M   G+  PA   A   +L  L  +     +L G IP + S    LETLD
Sbjct  188  GNLSNLEIFDMPFNGNLVPAQIPADFGKLKKLKRLWMKQTNLIGQIPESFSGLLSLETLD  247

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDD  661
            L+ N+L GKI G  F +K L  L L  N L GEIP+ + A +L  +D+S N+L+G IP D
Sbjct  248  LARNNLEGKIPGGLFLLKNLSELFLFHNKLSGEIPSTVEALNLVQIDLSMNNLSGLIPQD  307

Query  662  IGNFYNLSYLDLSMNSL  712
             G   NL+ L+L  N L
Sbjct  308  FGKLKNLTILNLFSNQL  324


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 79/144 (55%), Gaps = 10/144 (7%)
 Frame = +2

Query  284  WPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCS  463
            W G++ +S      + LS  +  G  P+S +     NL  +  S+N   G IP  +SS  
Sbjct  429  WTGLNLSS------LMLSNNLFSGQLPSSNLAL---NLSRLEISNNRFSGEIPFQVSSWE  479

Query  464  KLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDL  640
             L     S N  +GKI  E  S+  L +L L GN L GE+P+ ++++ SL++L++S N+L
Sbjct  480  SLVVFKASGNLFSGKIPIELTSLSQLNTLLLDGNRLSGELPSRIISWGSLDTLNLSRNEL  539

Query  641  NGSIPDDIGNFYNLSYLDLSMNSL  712
            +G IP  IG+  +L YLDLS N  
Sbjct  540  SGHIPAAIGSLPDLLYLDLSGNQF  563


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            + QLN L+      N L G +P+ + S   L+TL+LS N+L+G I     S+  L  L+L
Sbjct  502  LSQLNTLL---LDGNRLSGELPSRIISWGSLDTLNLSRNELSGHIPAAIGSLPDLLYLDL  558

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             GN   GEIP       L SL++SSN L+G IPD    F N +Y D  +N
Sbjct  559  SGNQFSGEIPAEFGHLRLNSLNLSSNKLSGKIPDV---FANRAYEDSFLN  605


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NLV I+ S N+L G IP +      L  L+L  N LTG I      +  L++  +  N L
Sbjct  289  NLVQIDLSMNNLSGLIPQDFGKLKNLTILNLFSNQLTGGIPESLGLIPELKNFRVFMNQL  348

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
             G +P  +  +S LE+ +VS N L+GS+P+ +
Sbjct  349  NGTLPPELGLHSELEAFEVSENQLSGSLPEHL  380



>ref|XP_010095355.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB59774.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=526

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 104/181 (57%), Gaps = 8/181 (4%)
 Frame = +2

Query  179  TYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T  E ER++LL LKQHWG   S  ++W  S++S C WPGI+C SN SVT +SL  + + G
Sbjct  30   TLQEQERSVLLKLKQHWGN-ISFMDEWTPSSNSHCSWPGITCTSN-SVTGLSLRNVNITG  87

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
              P  + IC L N+ +IN   N + G  P  + +CSKLE LDLS N   G +  +   + 
Sbjct  88   --PVPSFICDLKNVTTINLGDNYIPGEFPRAVFNCSKLEALDLSENYFVGTLPDDIDKLA  145

Query  536  TLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
             L+ L L GN   G+IP P++     L+ L + SN  NGS+  +IG+  NL  L L+ N 
Sbjct  146  KLQRLVLGGNNFTGDIP-PVIGKLQELKVLALGSNLFNGSLAPEIGDLSNLEDLRLANNG  204

Query  710  L  712
            L
Sbjct  205  L  205


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 75/142 (53%), Gaps = 2/142 (1%)
 Frame = +2

Query  287  PGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSK  466
            P I   SN    R++ + +++    P++    QL  L  +   +++L G IP ++     
Sbjct  187  PEIGDLSNLEDLRLANNGLLVRSELPSNY--TQLRKLKILWVFNSNLIGEIPQSIGDMEA  244

Query  467  LETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNG  646
            LE +DLS NDL GKI    F +K L  + L  N L G++P  + A +L  +D+S N+L G
Sbjct  245  LEWVDLSRNDLHGKIPDGLFMLKNLSVVFLFMNKLSGDVPQVVEALNLGMIDLSENNLTG  304

Query  647  SIPDDIGNFYNLSYLDLSMNSL  712
             IP+D G    L+ LDLS N  
Sbjct  305  KIPEDFGKLTKLTSLDLSENKF  326


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 6/121 (5%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + G  P    +  L NL  +    N L G +P  + + + L  +DLS N+LTG
Sbjct  248  VDLSRNDLHGKIPDGLFM--LKNLSVVFLFMNKLSGDVPQVVEALN-LGMIDLSENNLTG  304

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
            KI  +F  +  L SL+L  N   G+IPT +   +L  L++SSN+  G+IP +   F N+ 
Sbjct  305  KIPEDFGKLTKLTSLDLSENKFSGQIPTQLGLLALRFLELSSNNFTGTIPRE---FENVR  361

Query  686  Y  688
            Y
Sbjct  362  Y  362



>ref|XP_007137253.1| hypothetical protein PHAVU_009G112200g [Phaseolus vulgaris]
 gb|ESW09247.1| hypothetical protein PHAVU_009G112200g [Phaseolus vulgaris]
Length=1018

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 100/174 (57%), Gaps = 1/174 (1%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            E E+ ILL LK+  G P SL     S S+PCDW  I C S+G+VT++ LS   +  S   
Sbjct  27   ETEQTILLTLKRQLGDPPSLRSWKPSPSAPCDWTEIGCGSDGAVTKLLLSSKGITTSKSL  86

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
             + IC L NL+ ++ S+NS+ G  P  L  CS L+ LDLS N L G +  +   +KTL  
Sbjct  87   PSTICNLKNLLMLDLSNNSIAGEFPTTLYECSNLQYLDLSQNYLAGAVPADVDRLKTLTY  146

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L  N   GEIP  +     L++LD+ +N+  G++P +IGN  NL  L L+ N
Sbjct  147  LSLGANSFSGEIPAAIGNLPELQTLDLFTNNFEGTVPKEIGNLSNLEGLGLAYN  200


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 75/133 (56%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LS   + GS P +  +  L  L  +   SN L G IP+    C +L  +DL+ N+
Sbjct  243  LVRLDLSMNKLSGSIPRT--LFSLRKLRFLYLFSNRLSGVIPSATMQCLELIDVDLAKNN  300

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
            LTG I  EF  +K L +L+L  N LFGEIP  +    +L+   V SN+L+G++P ++G  
Sbjct  301  LTGSIPREFGELKNLSTLHLYENHLFGEIPVSLSQIPTLKYFRVFSNNLSGTLPPELGLH  360

Query  674  YNLSYLDLSMNSL  712
              L+ +++S N L
Sbjct  361  SKLAAIEVSDNQL  373


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSC-SKLETLDLSINDLTGKIAGEFFSMKTLRSLNLR  559
            +L NL  +  +  +L G IP       + L  LDLS+N L+G I    FS++ LR L L 
Sbjct  214  KLRNLRRLWMTRCNLIGEIPEYFGDIFTNLVRLDLSMNKLSGSIPRTLFSLRKLRFLYLF  273

Query  560  GNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             N L G IP+  M    L  +D++ N+L GSIP + G   NLS L L  N L
Sbjct  274  SNRLSGVIPSATMQCLELIDVDLAKNNLTGSIPREFGELKNLSTLHLYENHL  325


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 66/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + RI ++     G    S  I    NL  ++  +N L G IP  L+  SKL  L L  N 
Sbjct  457  IARIEIANNNFSGGI--SVGITSAKNLGFLDARNNMLSGEIPRELTQLSKLTALMLDGNQ  514

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
            L+G +  E  S ++L +L L  N L G+IPT + A   L  LD+S ND++G IP      
Sbjct  515  LSGALPSEIISWQSLNTLTLSRNKLSGQIPTAITALPRLAYLDLSQNDISGEIPPQFDRL  574

Query  674  YNLSYLDLSMNSL  712
                +L+LS N L
Sbjct  575  -RFVFLNLSSNQL  586


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 56/110 (51%), Gaps = 2/110 (2%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G  P    + QL+ L ++    N L G +P+ + S   L TL LS N L+G+I    
Sbjct  490  MLSGEIPRE--LTQLSKLTALMLDGNQLSGALPSEIISWQSLNTLTLSRNKLSGQIPTAI  547

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
             ++  L  L+L  N + GEIP          L++SSN L+G IPD+  N 
Sbjct  548  TALPRLAYLDLSQNDISGEIPPQFDRLRFVFLNLSSNQLSGKIPDEFNNL  597



>ref|XP_006366693.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=1032

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 97/175 (55%), Gaps = 7/175 (4%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            ER  LL +K+ WG P +L + WNSTSSPC WP I C+ +G VT I + E  +    P+S 
Sbjct  39   ERDTLLKIKRQWGNPLAL-DSWNSTSSPCSWPEIECD-DGKVTGIIIQEKDITVEIPSS-  95

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             IC+L NL  +N   N L G  P  L  CS L+ LDLS N   G I  + + +  L+ LN
Sbjct  96   -ICELKNLTFLNLRLNYLPGKFPTFLYKCSNLQHLDLSQNYFVGSIPEDIYRLGKLKYLN  154

Query  554  LRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L GN   G+IP P V     LE+L ++ N  +GS P +IGN  NL  L L  N  
Sbjct  155  LGGNNFTGDIP-PSVGNLTELETLCMNLNLFDGSFPAEIGNLANLESLGLEFNEF  208


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  +  I      L G IP +      LE +D + N+L GKI    F +K L  + L G
Sbjct  219  KLKKIKYIWMRDTKLIGEIPESFGDFENLELIDFAYNNLEGKIPSGLFLLKNLTMMYLYG  278

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G IP    +  L  LDVS+N L G+IP+  G F +L  ++L  N L
Sbjct  279  NRLSGRIPETFDSSKLMELDVSNNYLTGTIPESFGGFKHLEIMNLFGNQL  328


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 62/123 (50%), Gaps = 4/123 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+   +  L NL  +    N L G IP    S SKL  LD+S N LTG I   F 
Sbjct  257  LEGKIPSGLFL--LKNLTMMYLYGNRLSGRIPETFDS-SKLMELDVSNNYLTGTIPESFG  313

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
              K L  +NL GN L+G IP  +    SL+   V  N LNGS+P ++G    L   ++S+
Sbjct  314  GFKHLEIMNLFGNQLYGAIPESIAKIPSLKVFKVFRNKLNGSLPSEMGLHSKLESFEVSL  373

Query  704  NSL  712
            NS 
Sbjct  374  NSF  376


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 66/133 (50%), Gaps = 5/133 (4%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T + LS+    G  P+        N   +  S+N   G IP  +SS   L  L  S N 
Sbjct  438  MTSLLLSDNSFSGELPSKIAF----NFTRLEISNNRFSGEIPVGISSWRSLVVLLASNNS  493

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
             +G+I  E  S+  +  L L GN L GE+P  ++++ SL  LD++ N L+G IP  IG  
Sbjct  494  FSGRIPVELTSLSQITQLELDGNSLSGELPADIISWKSLTILDLARNKLSGKIPAVIGLI  553

Query  674  YNLSYLDLSMNSL  712
             +L  LDLS N  
Sbjct  554  PDLVALDLSQNQF  566


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 54/107 (50%), Gaps = 2/107 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P    +  L+ +  +    NSL G +PA++ S   L  LDL+ N L+GKI      +
Sbjct  496  GRIPVE--LTSLSQITQLELDGNSLSGELPADIISWKSLTILDLARNKLSGKIPAVIGLI  553

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
              L +L+L  N   G IP  +    + SL+VSSN L G+IPD   N 
Sbjct  554  PDLVALDLSQNQFSGPIPPQLGVKRITSLNVSSNQLTGNIPDAFANL  600


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P S  I ++ +L       N L G++P+ +   SKLE+ ++S+N  TG +     + 
Sbjct  330  GAIPES--IAKIPSLKVFKVFRNKLNGSLPSEMGLHSKLESFEVSLNSFTGNLPEHLCAG  387

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
             TL       N L GEIP  +    SL S+ +  N L+G IP  +    +++ L LS NS
Sbjct  388  GTLFGAVAYANNLSGEIPKSLGTCSSLRSIQLYKNQLSGEIPSGVWTLVDMTSLLLSDNS  447

Query  710  L  712
             
Sbjct  448  F  448



>ref|XP_010267130.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=1045

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 101/177 (57%), Gaps = 5/177 (3%)
 Frame = +2

Query  185  GEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFP  364
            G DE +ILL LKQHWG    +   WNS+ SPC+W GISC  +GSVT+IS     + G  P
Sbjct  50   GIDELSILLKLKQHWGDQPPM-NSWNSSLSPCNWTGISC-VHGSVTKISFYNQNITGKIP  107

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
             +  IC LNNL  ++ S N + G  P  L +CSKL+ LDLS N   G +  +   + +L 
Sbjct  108  PA--ICGLNNLTYLDLSYNYIPGEFPTLLYNCSKLQYLDLSQNYFVGTLPDDIHRLSSLS  165

Query  545  SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             LNL  N   G+IP+ +   S L+ L +  N  NG+ P DIGN  NL  L+++ N  
Sbjct  166  FLNLGANNFSGDIPSTIGRLSALKRLYLYQNLFNGTFPPDIGNLSNLEALEMAYNKF  222


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 79/131 (60%), Gaps = 2/131 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLN-NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            ++L  +++ G+F +  +  +L  NL  +  S+N   G IP+++ + S L     S N  +
Sbjct  450  LNLWSLMISGNFFSGKLPGKLAWNLTRLEISNNRFSGEIPSDIRNASNLVVFKASNNLFS  509

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYN  679
            GKI  E  ++  L  L+L GN L+GE+P+ ++++ +L SL++S N L+G IP  IG   +
Sbjct  510  GKIPVELTALPHLTVLSLDGNRLYGELPSEIISWKALNSLNLSRNQLSGQIPRTIGLLPD  569

Query  680  LSYLDLSMNSL  712
            LSYLDLS N L
Sbjct  570  LSYLDLSDNQL  580


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 62/122 (51%), Gaps = 3/122 (2%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
             F  S I  Q   L  + +   +  +L G IP ++   + +  LDLS+N L G I    F
Sbjct  221  KFVPSRIPVQFTRLKKLTYLWMARTNLIGEIPVSIGDMAAIRWLDLSMNHLNGTIPTSLF  280

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             +K L +L L  N L GEIP  + A  L  +D+S N+L G IP D G   +L++L L  N
Sbjct  281  LLKQLTNLYLYANRLSGEIPARVEALGLTDIDLSINNLTGPIPGDFGKLVSLTHLVLYYN  340

Query  707  SL  712
             L
Sbjct  341  RL  342


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             + RI +++  + G  P +  +C    L  +   SNSL G +PA+L +CS L T+ L  N
Sbjct  379  KLERIEVAKNRLSGKLPEN--LCAGGMLRGVVVFSNSLSGEVPASLGNCSSLTTVQLYNN  436

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
              +G+I    +S   L SL + GN   G++P  + A++L  L++S+N  +G IP DI N 
Sbjct  437  GFSGEIPDSLWSSLNLWSLMISGNFFSGKLPGKL-AWNLTRLEISNNRFSGEIPSDIRNA  495

Query  674  YNLSYLDLSMN  706
             NL     S N
Sbjct  496  SNLVVFKASNN  506


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = +2

Query  293  ISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLE  472
            +S     ++  + LS   + G+ P S  +  L  L ++   +N L G IPA + +   L 
Sbjct  253  VSIGDMAAIRWLDLSMNHLNGTIPTSLFL--LKQLTNLYLYANRLSGEIPARVEALG-LT  309

Query  473  TLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGS  649
             +DLSIN+LTG I G+F  + +L  L L  N L GEIP+ +    +L  + + +N L+G 
Sbjct  310  DIDLSINNLTGPIPGDFGKLVSLTHLVLYYNRLSGEIPSSIARLPALNDIRLYNNSLSGV  369

Query  650  IPDDIGNFYNLSYLDLSMNSL  712
            +P ++G +  L  ++++ N L
Sbjct  370  LPPELGLYSKLERIEVAKNRL  390


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 68/151 (45%), Gaps = 27/151 (18%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +TR+ +S     G  P+   I   +NLV    S+N   G IP  L++   L  L L  N 
Sbjct  474  LTRLEISNNRFSGEIPSD--IRNASNLVVFKASNNLFSGKIPVELTALPHLTVLSLDGNR  531

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT-----PMVAY-------------------  604
            L G++  E  S K L SLNL  N L G+IP      P ++Y                   
Sbjct  532  LYGELPSEIISWKALNSLNLSRNQLSGQIPRTIGLLPDLSYLDLSDNQLSGNIPSEFGLL  591

Query  605  SLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
             L SL++SSN L G IP +  N  Y  S+L+
Sbjct  592  KLVSLNLSSNQLIGEIPTEFDNMAYENSFLN  622


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 69/132 (52%), Gaps = 3/132 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T + L    + G  P+S  I +L  L  I   +NSL G +P  L   SKLE ++++ N
Sbjct  331  SLTHLVLYYNRLSGEIPSS--IARLPALNDIRLYNNSLSGVLPPELGLYSKLERIEVAKN  388

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
             L+GK+     +   LR + +  N L GE+P  +    SL ++ + +N  +G IPD + +
Sbjct  389  RLSGKLPENLCAGGMLRGVVVFSNSLSGEVPASLGNCSSLTTVQLYNNGFSGEIPDSLWS  448

Query  671  FYNLSYLDLSMN  706
              NL  L +S N
Sbjct  449  SLNLWSLMISGN  460



>ref|XP_004513050.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1014

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 105/184 (57%), Gaps = 4/184 (2%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEM  343
            SQS     ++E   L+ LKQH+  P  L    +S +S C W  I C +NGS+T+++L + 
Sbjct  25   SQSHYNLHDEEHETLMKLKQHFENPSKLTHWISSNTSHCSWQEIIC-TNGSITQLNLFDT  83

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             +  + P    IC L NL  ++F++N + G  P  L++CSKLE LDLS+N+  GKI  E 
Sbjct  84   NINQTIPP--FICDLKNLTHVDFNNNFIPGMFPTYLNNCSKLEYLDLSMNNFIGKIPDEI  141

Query  524  FSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            F+   L+ LNL  N L  +IP  +     L  L + +   NG+ PD+IGN  NL  LDLS
Sbjct  142  FTFSNLKYLNLSYNNLTDDIPKSIGRMKELRFLALQACLFNGTYPDEIGNLLNLETLDLS  201

Query  701  MNSL  712
             NS+
Sbjct  202  SNSM  205


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = +2

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L+G +P  +   + LE LD+S N LTGKI    F +K L  L L  N L GEIP+ + A 
Sbjct  231  LFGEMPEPMGKMASLEKLDVSQNGLTGKIPSGLFMLKNLSILFLSRNNLSGEIPSLVEAL  290

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L  +D++ N L G IPDD G    L+ L LSMN+L
Sbjct  291  NLTIIDLTRNRLTGKIPDDFGKLQKLTGLALSMNNL  326


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            N+V    S N L G+IP  L++  KLE L L  N L G +  +  S K+L  LNL  N L
Sbjct  480  NVVEFIASKNFLNGSIPQELTNLFKLEKLLLDQNQLKGSLPFDVTSWKSLVFLNLSQNQL  539

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GEIP  +    SL  LDVS N  +G IP  +     ++ L+LS N L
Sbjct  540  NGEIPVSIGHLPSLGVLDVSENQFSGQIPSVLP---RITVLNLSSNHL  584


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 69/135 (51%), Gaps = 4/135 (3%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
             S+ ++ +S+  + G  P+   +  L NL  +  S N+L G IP+ L     L  +DL+ 
Sbjct  243  ASLEKLDVSQNGLTGKIPSGLFM--LKNLSILFLSRNNLSGEIPS-LVEALNLTIIDLTR  299

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG  667
            N LTGKI  +F  ++ L  L L  N L G+IP  +    SL    V  N+L+G++P + G
Sbjct  300  NRLTGKIPDDFGKLQKLTGLALSMNNLSGKIPQSIGNLPSLIDFKVFMNNLSGTLPSNFG  359

Query  668  NFYNLSYLDLSMNSL  712
             +  L    +S NS 
Sbjct  360  LYSKLGTFLISSNSF  374


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 3/108 (3%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NLV    S N   G +P NLSS   L   D+S N   G+I     S   +       N L
Sbjct  434  NLVDFMVSHNKFTGELPQNLSSSITL--FDISYNQFYGEIPNGVSSWTNVVEFIASKNFL  491

Query  572  FGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP  +   + LE L +  N L GS+P D+ ++ +L +L+LS N L
Sbjct  492  NGSIPQELTNLFKLEKLLLDQNQLKGSLPFDVTSWKSLVFLNLSQNQL  539



>ref|XP_007013028.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
 gb|EOY30647.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
Length=1019

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 103/180 (57%), Gaps = 8/180 (4%)
 Frame = +2

Query  182  YGEDERAILLILKQHWGYPFSLFEQW---NSTSSPCDWPGISCNSNGSVTRISLSEMIMG  352
            +   E+AIL+ LK+HW  P S+   W   +++S  C WP I+C  N SV  + L+   +G
Sbjct  40   HDAQEQAILIELKRHWQNPSSI-NHWIPSSNSSYHCSWPEITC-INNSVAELHLANKTIG  97

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
             + P+S  IC L  L SI+ + N+L G  P  L +CSKLE LDLS N   G I  +  S+
Sbjct  98   VTIPSS--ICDLKKLTSIDLNYNNLVGKFPKTLYNCSKLEYLDLSQNYFVGTIPDDIDSL  155

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L++LNL GN   G+IP  +     L SL +SSN  NGS P +IGN   L +L L+ ++
Sbjct  156  GQLQNLNLMGNNFSGQIPVAIGRLQDLRSLQLSSNQFNGSFPPEIGNLSKLEFLGLAYHT  215


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L ++     +L G IP  + + + LE LDLS N+LTGKI    FS+K L+ + L  
Sbjct  228  QLKKLKTLWMRKANLIGDIPDMIGAMTALEVLDLSENELTGKIPNALFSLKNLKGMYLFR  287

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  + A +L  +D+S N L G IPDDIG   NL  L L  N L
Sbjct  288  NNLSGEIPQVIRASNLSVIDLSGNKLTGRIPDDIGKLENLLGLVLFFNQL  337


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = +2

Query  320  TRISLSEMIMGGSFPASAIICQL-NNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            T ++LS++ +  +F    +  ++ ++LV +  S+N  +G IP  ++  S L     S N 
Sbjct  443  TSLNLSQLRISDNFFTDELPRKVAHSLVRLEISNNRFFGKIPVEVNLWSDLSVFIASNNF  502

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
              G I  E  ++ +L  L L  N L G +P+ ++++ SL++L++S N L+G IP+ IG  
Sbjct  503  FNGAIPRELTALPSLTMLLLDQNQLHGFLPSDIISWKSLQTLNLSRNKLSGQIPETIGFL  562

Query  674  YNLSYLDLSMNSL  712
             NL  LDLS N  
Sbjct  563  PNLKGLDLSENQF  575


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 4/130 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LSE  + G  P +  +  L NL  +    N+L G IP  + + S L  +DLS N LTG
Sbjct  259  LDLSENELTGKIPNA--LFSLKNLKGMYLFRNNLSGEIPQVIRA-SNLSVIDLSGNKLTG  315

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            +I  +   ++ L  L L  N L GEIP  +   S L  + + SN+L+G++P D G +  L
Sbjct  316  RIPDDIGKLENLLGLVLFFNQLSGEIPESIGRISTLTDVRLFSNNLSGTLPPDFGRYSML  375

Query  683  SYLDLSMNSL  712
             Y +++ N L
Sbjct  376  EYFEVASNRL  385


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 58/116 (50%), Gaps = 3/116 (3%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSIN---FSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            LS  I   +F   AI  +L  L S+       N L G +P+++ S   L+TL+LS N L+
Sbjct  493  LSVFIASNNFFNGAIPRELTALPSLTMLLLDQNQLHGFLPSDIISWKSLQTLNLSRNKLS  552

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
            G+I      +  L+ L+L  N   G+IP  +        ++SSN L GSIP +  N
Sbjct  553  GQIPETIGFLPNLKGLDLSENQFSGQIPPQLGRLRFTPFNLSSNHLIGSIPREFEN  608


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 1/110 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            +C    L  +    N+L G +P +L +C+ L   D+  N LTG I G  ++   L  L +
Sbjct  393  LCYGGKLKGVVAFDNNLTGELPKSLGNCNSLIMFDIRNNSLTGNIPGGLWTSLNLSQLRI  452

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              N    E+P   VA+SL  L++S+N   G IP ++  + +LS    S N
Sbjct  453  SDNFFTDELPRK-VAHSLVRLEISNNRFFGKIPVEVNLWSDLSVFIASNN  501



>ref|XP_007013027.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 1 [Theobroma cacao]
 gb|EOY30646.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 1 [Theobroma cacao]
Length=1097

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 103/180 (57%), Gaps = 8/180 (4%)
 Frame = +2

Query  182  YGEDERAILLILKQHWGYPFSLFEQW---NSTSSPCDWPGISCNSNGSVTRISLSEMIMG  352
            +   E+AIL+ LK+HW  P S+   W   +++S  C WP I+C  N SV  + L+   +G
Sbjct  40   HDAQEQAILIELKRHWQNPSSI-NHWIPSSNSSYHCSWPEITC-INNSVAELHLANKTIG  97

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
             + P+S  IC L  L SI+ + N+L G  P  L +CSKLE LDLS N   G I  +  S+
Sbjct  98   VTIPSS--ICDLKKLTSIDLNYNNLVGKFPKTLYNCSKLEYLDLSQNYFVGTIPDDIDSL  155

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L++LNL GN   G+IP  +     L SL +SSN  NGS P +IGN   L +L L+ ++
Sbjct  156  GQLQNLNLMGNNFSGQIPVAIGRLQDLRSLQLSSNQFNGSFPPEIGNLSKLEFLGLAYHT  215


 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L ++     +L G IP  + + + LE LDLS N+LTGKI    FS+K L+ + L  
Sbjct  228  QLKKLKTLWMRKANLIGDIPDMIGAMTALEVLDLSENELTGKIPNALFSLKNLKGMYLFR  287

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  + A +L  +D+S N L G IPDDIG   NL  L L  N L
Sbjct  288  NNLSGEIPQVIRASNLSVIDLSGNKLTGRIPDDIGKLENLLGLVLFFNQL  337


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = +2

Query  320  TRISLSEMIMGGSFPASAIICQL-NNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            T ++LS++ +  +F    +  ++ ++LV +  S+N  +G IP  ++  S L     S N 
Sbjct  443  TSLNLSQLRISDNFFTDELPRKVAHSLVRLEISNNRFFGKIPVEVNLWSDLSVFIASNNF  502

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
              G I  E  ++ +L  L L  N L G +P+ ++++ SL++L++S N L+G IP+ IG  
Sbjct  503  FNGAIPRELTALPSLTMLLLDQNQLHGFLPSDIISWKSLQTLNLSRNKLSGQIPETIGFL  562

Query  674  YNLSYLDLSMNSL  712
             NL  LDLS N  
Sbjct  563  PNLKGLDLSENQF  575


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 4/130 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LSE  + G  P +  +  L NL  +    N+L G IP  + + S L  +DLS N LTG
Sbjct  259  LDLSENELTGKIPNA--LFSLKNLKGMYLFRNNLSGEIPQVIRA-SNLSVIDLSGNKLTG  315

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            +I  +   ++ L  L L  N L GEIP  +   S L  + + SN+L+G++P D G +  L
Sbjct  316  RIPDDIGKLENLLGLVLFFNQLSGEIPESIGRISTLTDVRLFSNNLSGTLPPDFGRYSML  375

Query  683  SYLDLSMNSL  712
             Y +++ N L
Sbjct  376  EYFEVASNRL  385


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 58/116 (50%), Gaps = 3/116 (3%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSIN---FSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            LS  I   +F   AI  +L  L S+       N L G +P+++ S   L+TL+LS N L+
Sbjct  493  LSVFIASNNFFNGAIPRELTALPSLTMLLLDQNQLHGFLPSDIISWKSLQTLNLSRNKLS  552

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
            G+I      +  L+ L+L  N   G+IP  +        ++SSN L GSIP +  N
Sbjct  553  GQIPETIGFLPNLKGLDLSENQFSGQIPPQLGRLRFTPFNLSSNHLIGSIPREFEN  608


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 1/110 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            +C    L  +    N+L G +P +L +C+ L   D+  N LTG I G  ++   L  L +
Sbjct  393  LCYGGKLKGVVAFDNNLTGELPKSLGNCNSLIMFDIRNNSLTGNIPGGLWTSLNLSQLRI  452

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              N    E+P   VA+SL  L++S+N   G IP ++  + +LS    S N
Sbjct  453  SDNFFTDELPRK-VAHSLVRLEISNNRFFGKIPVEVNLWSDLSVFIASNN  501



>ref|XP_006596181.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Glycine max]
Length=1032

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 102/177 (58%), Gaps = 6/177 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLS-EMIMGGSFP  364
            +D++  LL +K+ +G P +L   W S+S PC WP I C S G VT + L+ + I     P
Sbjct  30   QDQQTTLLGIKRQFGDPPAL-RSWKSSSPPCAWPEIRC-SGGFVTELHLAGKNISAVQLP  87

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
            A+  IC L +L  +N S N++ G  PA LS+CS L+ LDLS N L G I  +    KTL 
Sbjct  88   AA--ICDLAHLAHLNLSDNNIAGQFPAFLSNCSNLKLLDLSQNYLAGPIPNDIAKFKTLN  145

Query  545  SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+L GN   G+IP  + A S L +L +  N+ NG+ P +IGN  NL  L L+ NS 
Sbjct  146  YLDLGGNSFSGDIPAAIGAVSELRTLLLYRNEFNGTFPSEIGNLTNLEVLGLAYNSF  202


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 7/133 (5%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ +   +  G   +SA+     NLV  +  +N L G IP  L+  S+L TL L  N 
Sbjct  456  LSRLEIRNNLFSGKIFSSAV-----NLVVFDARNNMLSGEIPRALTGLSRLNTLMLDENQ  510

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            L GK+  E  S  +L +L+L  N LFG IP  +     L  LD++ N+++G IP  +G  
Sbjct  511  LYGKLPSEIISWGSLNTLSLSRNKLFGNIPETLCDLRDLVYLDLAENNISGEIPPKLGTL  570

Query  674  YNLSYLDLSMNSL  712
              L +L+LS N L
Sbjct  571  -RLVFLNLSSNKL  582


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G  P +  +  L+ L ++    N L+G +P+ + S   L TL LS N L G I    
Sbjct  486  MLSGEIPRA--LTGLSRLNTLMLDENQLYGKLPSEIISWGSLNTLSLSRNKLFGNIPETL  543

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
              ++ L  L+L  N + GEIP  +    L  L++SSN L+GS+PD+  N  Y  S+L+
Sbjct  544  CDLRDLVYLDLAENNISGEIPPKLGTLRLVFLNLSSNKLSGSVPDEFNNLAYESSFLN  601


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 63/112 (56%), Gaps = 3/112 (3%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L NL ++     +L G IP + ++ S LE LDLS N LTG I    F+++ L+ L L  N
Sbjct  213  LKNLKTLWMPMCNLIGAIPESFANLSSLELLDLSFNFLTGNIPNGLFALRNLQFLYLYHN  272

Query  566  MLFGEIPT---PMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GEIP     +  +SL  +D++ N+L GSIP+  G   NL+ L L  N L
Sbjct  273  GLSGEIPVLPRSVRGFSLNEIDLAMNNLTGSIPEFFGMLENLTILHLFSNQL  324



>ref|XP_006596182.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Glycine max]
Length=883

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 102/177 (58%), Gaps = 6/177 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLS-EMIMGGSFP  364
            +D++  LL +K+ +G P +L   W S+S PC WP I C S G VT + L+ + I     P
Sbjct  30   QDQQTTLLGIKRQFGDPPAL-RSWKSSSPPCAWPEIRC-SGGFVTELHLAGKNISAVQLP  87

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
            A+  IC L +L  +N S N++ G  PA LS+CS L+ LDLS N L G I  +    KTL 
Sbjct  88   AA--ICDLAHLAHLNLSDNNIAGQFPAFLSNCSNLKLLDLSQNYLAGPIPNDIAKFKTLN  145

Query  545  SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+L GN   G+IP  + A S L +L +  N+ NG+ P +IGN  NL  L L+ NS 
Sbjct  146  YLDLGGNSFSGDIPAAIGAVSELRTLLLYRNEFNGTFPSEIGNLTNLEVLGLAYNSF  202


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 7/133 (5%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ +   +  G   +SA+     NLV  +  +N L G IP  L+  S+L TL L  N 
Sbjct  456  LSRLEIRNNLFSGKIFSSAV-----NLVVFDARNNMLSGEIPRALTGLSRLNTLMLDENQ  510

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            L GK+  E  S  +L +L+L  N LFG IP  +     L  LD++ N+++G IP  +G  
Sbjct  511  LYGKLPSEIISWGSLNTLSLSRNKLFGNIPETLCDLRDLVYLDLAENNISGEIPPKLGTL  570

Query  674  YNLSYLDLSMNSL  712
              L +L+LS N L
Sbjct  571  -RLVFLNLSSNKL  582


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G  P +  +  L+ L ++    N L+G +P+ + S   L TL LS N L G I    
Sbjct  486  MLSGEIPRA--LTGLSRLNTLMLDENQLYGKLPSEIISWGSLNTLSLSRNKLFGNIPETL  543

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
              ++ L  L+L  N + GEIP  +    L  L++SSN L+GS+PD+  N  Y  S+L+
Sbjct  544  CDLRDLVYLDLAENNISGEIPPKLGTLRLVFLNLSSNKLSGSVPDEFNNLAYESSFLN  601


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 63/112 (56%), Gaps = 3/112 (3%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L NL ++     +L G IP + ++ S LE LDLS N LTG I    F+++ L+ L L  N
Sbjct  213  LKNLKTLWMPMCNLIGAIPESFANLSSLELLDLSFNFLTGNIPNGLFALRNLQFLYLYHN  272

Query  566  MLFGEIPT---PMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GEIP     +  +SL  +D++ N+L GSIP+  G   NL+ L L  N L
Sbjct  273  GLSGEIPVLPRSVRGFSLNEIDLAMNNLTGSIPEFFGMLENLTILHLFSNQL  324



>gb|KDO66581.1| hypothetical protein CISIN_1g001778mg [Citrus sinensis]
Length=1014

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            + E A+LL LKQHW  P  +     + SS C WP I+C ++GSVT + L+ M M G+FP 
Sbjct  31   DREHAVLLKLKQHWQNPPPISHWATTNSSHCTWPEIAC-TDGSVTELHLTNMNMNGTFPP  89

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
               IC L NL  ++   N +    P  L +CSKLE LDLS N   G I  +   +  L+ 
Sbjct  90   --FICDLRNLTILDLQFNYIISQFPRVLYNCSKLEYLDLSQNYFIGPIPEDIDRLSRLKF  147

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            L L  N + G+IP  +   + L  L++  N  NGSIP +IGN  NL  L+L+ N+
Sbjct  148  LYLTANNMSGKIPASIGRLTELRQLNLVVNQFNGSIPAEIGNLQNLEALELAYNT  202


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 72/137 (53%), Gaps = 3/137 (2%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAI---ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G++  +   E+     F  S++     QL  L  +  +S +L G IP  +     LE LD
Sbjct  188  GNLQNLEALELAYNTEFSPSSLPSNFTQLKKLKKLWMASTNLIGEIPETIGDMLALEFLD  247

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDD  661
            LSIN+ TG I    F +K L  + L  N L GEIP  + + +L+ +D+S+N+L G+IP+D
Sbjct  248  LSINNFTGSIPSSVFKLKNLSKVYLYSNSLSGEIPQAVESLNLKVIDLSANNLTGAIPND  307

Query  662  IGNFYNLSYLDLSMNSL  712
             G   NL  L L  N L
Sbjct  308  FGKLENLLNLSLMFNQL  324


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P+S  + +L NL  +   SNSL G IP  + S + L+ +DLS N+LTG I  +F  +
Sbjct  255  GSIPSS--VFKLKNLSKVYLYSNSLSGEIPQAVESLN-LKVIDLSANNLTGAIPNDFGKL  311

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            + L +L+L  N L GEIP  + +  SL+ + + +N L+G++P D G +  L Y ++S+N+
Sbjct  312  ENLLNLSLMFNQLSGEIPEGIGLLPSLKDVRLFNNMLSGALPPDFGRYSPLEYFEVSVNN  371

Query  710  L  712
            L
Sbjct  372  L  372


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 63/144 (44%), Gaps = 26/144 (18%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
            G+++R+ +S     G  P    +    NLV    S+N   GTIP  L++   L TL L  
Sbjct  454  GNLSRLEISNNRFSGKIPTG--VSSSKNLVVFQASNNLFNGTIPGELTALPSLTTLLLDQ  511

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT-----------------------PMVA  601
            N L+G +  +  S K+L +LNL  N L GEIP                        P + 
Sbjct  512  NQLSGSLPLDIISWKSLTALNLSRNQLSGEIPEKIGFLPVLQDLDLSENQFSGKIPPQIG  571

Query  602  Y-SLESLDVSSNDLNGSIPDDIGN  670
               L SL++SSN L G IP    N
Sbjct  572  RLMLTSLNLSSNRLTGEIPSQFEN  595



>ref|XP_006475586.1| PREDICTED: receptor-like protein kinase 5-like [Citrus sinensis]
Length=1014

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            + E A+LL LKQHW  P  +     + SS C WP I+C ++GSVT + L+ M M G+FP 
Sbjct  31   DREHAVLLKLKQHWQNPPPISHWATTNSSHCTWPEIAC-TDGSVTELHLTNMNMNGTFPP  89

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
               IC L NL  ++   N +    P  L +CSKLE LDLS N   G I  +   +  L+ 
Sbjct  90   --FICDLRNLTILDLQFNYIISQFPRVLYNCSKLEYLDLSQNYFIGPIPEDIDRLSRLKF  147

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            L L  N + G+IP  +   + L  L++  N  NGSIP +IGN  NL  L+L+ N+
Sbjct  148  LYLTANNMSGKIPASIGRLTELRQLNLVVNQFNGSIPAEIGNLQNLEALELAYNT  202


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 72/137 (53%), Gaps = 3/137 (2%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAI---ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G++  +   E+     F  S++     QL  L  +  +S +L G IP  +     LE LD
Sbjct  188  GNLQNLEALELAYNTEFSPSSLPSNFTQLKKLKKLWMASTNLIGEIPETIGDMLALEFLD  247

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDD  661
            LSIN+ TG I    F +K L  + L  N L GEIP  + + +L+ +D+S+N+L G+IP+D
Sbjct  248  LSINNFTGSIPSSVFKLKNLSKVYLYSNSLSGEIPQAVESLNLKVIDLSANNLTGAIPND  307

Query  662  IGNFYNLSYLDLSMNSL  712
             G   NL  L L  N L
Sbjct  308  FGKLENLLNLSLMFNQL  324


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P+S  + +L NL  +   SNSL G IP  + S + L+ +DLS N+LTG I  +F  +
Sbjct  255  GSIPSS--VFKLKNLSKVYLYSNSLSGEIPQAVESLN-LKVIDLSANNLTGAIPNDFGKL  311

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            + L +L+L  N L GEIP  + +  SL+ + + +N L+G++P D G +  L Y ++S+N+
Sbjct  312  ENLLNLSLMFNQLSGEIPEGIGLLPSLKDVRLFNNMLSGALPPDFGRYSPLEYFEVSVNN  371

Query  710  L  712
            L
Sbjct  372  L  372


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 63/144 (44%), Gaps = 26/144 (18%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
            G+++R+ +S     G  P    +    NLV    S+N   GTIP  L++   L TL L  
Sbjct  454  GNLSRLEISNNRFSGKIPTG--VSSSKNLVVFQASNNLFNGTIPGELTALPSLTTLLLDQ  511

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT-----------------------PMVA  601
            N L+G +  +  S K+L +LNL  N L GEIP                        P + 
Sbjct  512  NQLSGSLPLDIISWKSLTALNLSRNQLSGEIPEKIGFLPVLQDLDLSENQFSGKIPPQIG  571

Query  602  Y-SLESLDVSSNDLNGSIPDDIGN  670
               L SL++SSN L G IP    N
Sbjct  572  RLMLTSLNLSSNRLTGEIPSQFEN  595



>ref|XP_002516533.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45874.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=1026

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 100/174 (57%), Gaps = 6/174 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
             E++ILL +KQ  G P SL + W +++SPC WP ISC+ +GSVT + L +  +  + PA 
Sbjct  35   QEQSILLNIKQQLGNPPSL-QSWTTSTSPCTWPEISCSDDGSVTALGLRDKNITVAIPAR  93

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
              IC L NL  ++ + N + G  P  L +CS LE LDLS N   G +  +   +  L+S+
Sbjct  94   --ICDLKNLTVLDLAYNYIPGGFPTFLYNCSSLERLDLSQNYFVGTVPDDIDRLSNLKSI  151

Query  551  NLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L  N   G+IP P +     L++L +  N+ NG+ P +IGN  NL  L L+ N
Sbjct  152  DLSANNFSGDIP-PAIGNLRELQTLFLHQNEFNGTFPKEIGNLANLEQLRLAFN  204


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 65/121 (54%), Gaps = 3/121 (2%)
 Frame = +2

Query  359  FPASAIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
            F  S I  +  NL  + F      +L G+IP +L++ S LETLDLSIN L G I    F 
Sbjct  206  FVPSRIPVEFGNLTKLTFLWIRDANLIGSIPESLANLSSLETLDLSINKLEGSIPDGLFL  265

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            +K L  L L  N L G++P  + A +L  +D+  N+L GSI +D G   NL  L L  N 
Sbjct  266  LKNLTYLYLFHNQLSGDMPKKVEALNLVEVDLGINNLIGSISEDFGKLKNLERLHLYSNQ  325

Query  710  L  712
            L
Sbjct  326  L  326


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 69/133 (52%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ LS     G  P    I    NLV    S+N L G IP  ++S S L TL L  N 
Sbjct  458  LSRLELSNNKFSGPIPTG--ISSWVNLVVFEASNNLLSGEIPVEVTSLSHLNTLLLDGNQ  515

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
            L G++  +  S KTL +LNL  N L G+IP  + +   L  LD+S N L+G IP + G  
Sbjct  516  LLGQLPSKIISWKTLNTLNLSRNALSGQIPAAIGSLPDLLYLDLSQNHLSGQIPSEFGQL  575

Query  674  YNLSYLDLSMNSL  712
             NL  L+LS N  
Sbjct  576  -NLISLNLSSNQF  587


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 5/115 (4%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G  P    +  L++L ++    N L G +P+ + S   L TL+LS N L+G+I    
Sbjct  491  LLSGEIPVE--VTSLSHLNTLLLDGNQLLGQLPSKIISWKTLNTLNLSRNALSGQIPAAI  548

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
             S+  L  L+L  N L G+IP+     +L SL++SSN  +G IPD    F NL+Y
Sbjct  549  GSLPDLLYLDLSQNHLSGQIPSEFGQLNLISLNLSSNQFSGQIPD---KFDNLAY  600


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ L    + G  P +  I  L  L S    +N+L G +P  +   SKL+  ++S N 
Sbjct  316  LERLHLYSNQLSGELPQT--IGLLPALKSFRVFTNNLSGVLPTEIGLHSKLQYFEVSTNH  373

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
             +GK+     +   L  +    N L GE+P  +    SL+++ + +N  +G IP  I   
Sbjct  374  FSGKLPENLCAGGVLEGVVAFSNNLTGEVPQSLGKCNSLKTVQLYNNRFSGEIPSGIWTV  433

Query  674  YNLSYLDLSMNSL  712
             N++YL LS NS 
Sbjct  434  INMTYLMLSNNSF  446



>ref|XP_009350259.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1017

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 101/173 (58%), Gaps = 6/173 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            E++ILL +K  WG P    + WNS+SSPCDWPGI+C +NG VT +SL ++ +    P + 
Sbjct  29   EQSILLRIKAQWGNP-PFIQSWNSSSSPCDWPGINC-TNGMVTGLSLPDVNITERIPEA-  85

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK-TLRSL  550
             IC+L  L  ++ + N + G  P  L +CS LE LDLS N   G I  + + M  +L+ L
Sbjct  86   -ICELPRLAELHLAWNYIPGEFPKFLYNCSNLEVLDLSQNYFVGPIPPDIYRMSPSLKYL  144

Query  551  NLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L GN   G IP  +   + L +L + SN  NGS+P +IGN  NL   ++  N
Sbjct  145  DLGGNNFSGNIPAAIGRLTELRTLKLYSNLFNGSVPWEIGNLSNLEIFEMPYN  197


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 79/137 (58%), Gaps = 3/137 (2%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSIN---FSSNSLWGTIPANLSSCSKLETLD  481
            G+++ + + EM   G+  A++I  +  NL  +     +  +L G IP + S  S LE L+
Sbjct  184  GNLSNLEIFEMPYNGNLAAASIPTEFGNLKKLKSLWMTDTNLIGEIPESFSGLSSLENLN  243

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDD  661
            L+ N+L GKI G  F +K LR L L  N   GEIP  + A +L  +D+S+N+L+GSIP D
Sbjct  244  LARNNLEGKIPGGLFLLKNLRDLFLFNNKFSGEIPLAVEALNLSQIDLSTNNLSGSIPQD  303

Query  662  IGNFYNLSYLDLSMNSL  712
             G   NL+ L+L  N L
Sbjct  304  FGKIKNLTVLNLFSNQL  320


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 77/144 (53%), Gaps = 10/144 (7%)
 Frame = +2

Query  284  WPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCS  463
            W G++ +S      + LS+ +  G  PAS +     NL  +  S+N   G IP  +SS  
Sbjct  425  WTGLTLSS------LMLSDNLFSGQLPASKLAW---NLSRLEISNNRFSGEIPVQVSSWE  475

Query  464  KLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDL  640
            +L     S N  +GKI  E  S+  L +L L GN   GE+P+ ++++ SL +L++S N  
Sbjct  476  RLVVFKASGNLFSGKIPVELTSLSQLNTLLLDGNQFSGELPSQIISWESLNTLNLSRNAF  535

Query  641  NGSIPDDIGNFYNLSYLDLSMNSL  712
            +G IP  IG+  NL YLDLS N  
Sbjct  536  SGHIPAAIGSLPNLLYLDLSGNQF  559


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  I+ S+N+L G+IP +      L  L+L  N LTG I      +  +R   +  NML
Sbjct  285  NLSQIDLSTNNLSGSIPQDFGKIKNLTVLNLFSNQLTGGIPESLGLIPAMRVFQVFQNML  344

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
             G +P  +  +S LE+ DVS N L+GS+P+ +
Sbjct  345  NGTLPPELGLHSKLEAFDVSGNQLSGSLPEQL  376



>ref|XP_010095354.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Morus 
notabilis]
 gb|EXB59773.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Morus 
notabilis]
Length=694

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 102/178 (57%), Gaps = 8/178 (4%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFP  364
            E ER++LL LKQHWG   S  ++W  S +S C WPGI+C SN SVT +SL+ + + G  P
Sbjct  16   EKERSVLLKLKQHWGN-ISFMDEWTPSNNSHCSWPGITCTSN-SVTGLSLNNVNITG--P  71

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
              + IC L NL +I+   N + G  P  + +CSKLE LDLS N   G +  +   +  L+
Sbjct  72   VPSFICDLKNLTTIDLGDNYIPGEFPRAVFNCSKLEALDLSENYFVGTLPDDIDKLAKLQ  131

Query  545  SLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            SL L GN   G+IP P +     L+ L +  N  NGS+  +IG+  NL  L L+ N L
Sbjct  132  SLVLGGNNFTGDIP-PAIGKLQELKVLALGGNLFNGSLAPEIGDLSNLEDLRLANNGL  188


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 76/142 (54%), Gaps = 2/142 (1%)
 Frame = +2

Query  287  PGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSK  466
            P I   SN    R++ + +++    P+S    QL  L ++  SS++L G IP ++     
Sbjct  170  PEIGDLSNLEDLRLANNGLLVRSELPSS--YTQLRKLKNLWVSSSNLIGEIPQSIGDLEA  227

Query  467  LETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNG  646
            LE LDLS +DL GKI      +K L  + L  N L G++P  + A +LE +D+S N+L G
Sbjct  228  LEWLDLSRSDLHGKIPDGLLMLKNLSIVYLFKNKLSGDVPQVVEALNLEIIDLSENNLTG  287

Query  647  SIPDDIGNFYNLSYLDLSMNSL  712
             IP+D G    L+ L L  N L
Sbjct  288  KIPEDFGKLTKLTGLALFSNQL  309


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 4/130 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + G  P   ++  L NL  +    N L G +P  + + + LE +DLS N+LTG
Sbjct  231  LDLSRSDLHGKIPDGLLM--LKNLSIVYLFKNKLSGDVPQVVEALN-LEIIDLSENNLTG  287

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            KI  +F  +  L  L L  N L G +P  +     L    +  N+L G +P D+G + NL
Sbjct  288  KIPEDFGKLTKLTGLALFSNQLSGSVPEGIGRLPVLVDFKLWDNNLTGVLPPDLGKYSNL  347

Query  683  SYLDLSMNSL  712
                +S N L
Sbjct  348  REFQVSSNRL  357


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 5/117 (4%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G+ P    +    +L  +    N L G +P++  S   L TL+LS N L+G+I  + 
Sbjct  474  LLTGTIPQE--LTTFRHLTILLLDQNQLTGHLPSDKESWESLNTLNLSRNQLSGQIPEKL  531

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
              + TL  L+L  N   G+IP+ +    L  L++SSN+L+G IP +   F + +Y D
Sbjct  532  GLLPTLTELDLSENTFSGQIPSQLGLLRLIFLNLSSNNLSGRIPSE---FEDAAYAD  585



>emb|CDP03253.1| unnamed protein product [Coffea canephora]
Length=934

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/219 (36%), Positives = 107/219 (49%), Gaps = 44/219 (20%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T    +E+ ILL LKQ W  P SL   W S+S  C WP I+C + GSVT +++S + +  
Sbjct  32   TKTNPEEQTILLKLKQQWLNPPSL-SHWTSSSDHCTWPEINC-TGGSVTELNVSNLAITE  89

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN--------------  493
            + P+   IC L NL  ++  +N + G+ P  L +CSKLE LDLS N              
Sbjct  90   TIPS--FICDLKNLTVLDLKNNFIPGSFPTVLYNCSKLEYLDLSQNFFTRLKKLRFLWMF  147

Query  494  --------------------------DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM  595
                                      DL+G I G  F +K L  L+L  N L G IP+ +
Sbjct  148  QTNLIGEIPQDIGNMTALESLNLADNDLSGNIPGGLFQLKNLSILSLYKNRLVGSIPSSI  207

Query  596  VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             A +LE +D+S+N L G IPD+ G   NL+ L L  N L
Sbjct  208  EALNLEQIDLSNNSLTGKIPDEFGKLTNLTRLALFFNEL  246


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 75/134 (56%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++  ++L++  + G+ P    + QL NL  ++   N L G+IP+++ + + LE +DLS N
Sbjct  164  ALESLNLADNDLSGNIPGG--LFQLKNLSILSLYKNRLVGSIPSSIEALN-LEQIDLSNN  220

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             LTGKI  EF  +  L  L L  N L GE+PT + +  SL  + +  N+L+G +P D G 
Sbjct  221  SLTGKIPDEFGKLTNLTRLALFFNELSGEVPTSLGMLPSLVDIKLFYNNLSGQLPPDFGR  280

Query  671  FYNLSYLDLSMNSL  712
               LS   +S N+ 
Sbjct  281  HSKLSSFQVSANNF  294


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 1/102 (1%)
 Frame = +2

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S+N   G IPA +SS + L     S N  +GKI  E  S+  L +L L GN L G +
Sbjct  380  LDISNNQFSGEIPAGVSSWNNLREFKASNNLFSGKIPQELTSLPELGTLLLDGNRLSGSL  439

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            P+ ++++  L  L  S+N+L+G IP  IG    L+ LDLS N
Sbjct  440  PSSIISWKGLNVLSFSNNELSGQIPAAIGLLPVLNALDLSEN  481



>ref|XP_009628517.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 isoform X3 [Nicotiana tomentosiformis]
Length=710

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 91/170 (54%), Gaps = 5/170 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
             R ILL LK + G    + ++WN +SSPC WP ISC S G +  I+L    +    P   
Sbjct  2    RRPILLKLKSYLGNTSDIQQRWNLSSSPCTWPEISC-SRGFIIGINLEYQYLAAIPP---  57

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            IIC+L NL  +  +S  L G  P  + +CSKL+ LD+S N   G +  +   M  L  LN
Sbjct  58   IICKLKNLTHLILASTFLSGAFPTVVYNCSKLKVLDISFNKFQGPLPTDIHRMSRLTGLN  117

Query  554  LRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            LR N   G IP  +   S L+ L ++ ND  GSIP +IGN  NL  LD S
Sbjct  118  LRSNFFNGAIPGAVGLLSELKHLHLTGNDFEGSIPREIGNLSNLEILDAS  167


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 3/101 (3%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDL--TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
            N+  G+IP  + + S LETLD+S  +      I  E   +K LR++ +  + L G IP  
Sbjct  183  NNFEGSIPREIGNLSNLETLDISFMEKFELATIPDELGELKNLRNIRIVNSNLIGNIPEA  242

Query  593  MVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              ++ SL  +D+S N LNGSIPD +  F NLS L+L  N L
Sbjct  243  FSSFFSLVYMDLSRNYLNGSIPDWLFRFENLSDLNLERNQL  283


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 55/117 (47%), Gaps = 2/117 (2%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            SN     IS  E     + P    + +L NL +I   +++L G IP   SS   L  +DL
Sbjct  197  SNLETLDISFMEKFELATIPDE--LGELKNLRNIRIVNSNLIGNIPEAFSSFFSLVYMDL  254

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
            S N L G I    F  + L  LNL  N L G +P P+      +L +S N L+G IP
Sbjct  255  SRNYLNGSIPDWLFRFENLSDLNLERNQLHGTLPIPIGEAKFSALKLSWNQLSGKIP  311



>ref|XP_009628516.1| PREDICTED: receptor-like protein kinase 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=765

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 91/170 (54%), Gaps = 5/170 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
             R ILL LK + G    + ++WN +SSPC WP ISC S G +  I+L    +    P   
Sbjct  2    RRPILLKLKSYLGNTSDIQQRWNLSSSPCTWPEISC-SRGFIIGINLEYQYLAAIPP---  57

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            IIC+L NL  +  +S  L G  P  + +CSKL+ LD+S N   G +  +   M  L  LN
Sbjct  58   IICKLKNLTHLILASTFLSGAFPTVVYNCSKLKVLDISFNKFQGPLPTDIHRMSRLTGLN  117

Query  554  LRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            LR N   G IP  +   S L+ L ++ ND  GSIP +IGN  NL  LD S
Sbjct  118  LRSNFFNGAIPGAVGLLSELKHLHLTGNDFEGSIPREIGNLSNLEILDAS  167


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 5/136 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  + +SE  + GS P   ++ QL+ L  +  + N+  G+IP  + + S LETLD+S  
Sbjct  210  SLEYMDMSENYLNGSIPG--VVGQLSKLRRLFLTGNNFEGSIPREIGNLSNLETLDISFM  267

Query  494  DL--TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDI  664
            +      I  E   +K LR++ +  + L G IP    ++ SL  +D+S N LNGSIPD +
Sbjct  268  EKFELATIPDELGELKNLRNIRIVNSNLIGNIPEAFSSFFSLVYMDLSRNYLNGSIPDWL  327

Query  665  GNFYNLSYLDLSMNSL  712
              F NLS L+L  N L
Sbjct  328  FRFENLSDLNLERNQL  343


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 55/117 (47%), Gaps = 2/117 (2%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            SN     IS  E     + P    + +L NL +I   +++L G IP   SS   L  +DL
Sbjct  257  SNLETLDISFMEKFELATIPDE--LGELKNLRNIRIVNSNLIGNIPEAFSSFFSLVYMDL  314

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
            S N L G I    F  + L  LNL  N L G +P P+      +L +S N L+G IP
Sbjct  315  SRNYLNGSIPDWLFRFENLSDLNLERNQLHGTLPIPIGEAKFSALKLSWNQLSGKIP  371



>ref|XP_009628514.1| PREDICTED: receptor-like protein kinase 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628515.1| PREDICTED: receptor-like protein kinase 2 isoform X1 [Nicotiana 
tomentosiformis]
Length=770

 Score =   113 bits (283),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 91/170 (54%), Gaps = 5/170 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
             R ILL LK + G    + ++WN +SSPC WP ISC S G +  I+L    +    P   
Sbjct  2    RRPILLKLKSYLGNTSDIQQRWNLSSSPCTWPEISC-SRGFIIGINLEYQYLAAIPP---  57

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            IIC+L NL  +  +S  L G  P  + +CSKL+ LD+S N   G +  +   M  L  LN
Sbjct  58   IICKLKNLTHLILASTFLSGAFPTVVYNCSKLKVLDISFNKFQGPLPTDIHRMSRLTGLN  117

Query  554  LRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            LR N   G IP  +   S L+ L ++ ND  GSIP +IGN  NL  LD S
Sbjct  118  LRSNFFNGAIPGAVGLLSELKHLHLTGNDFEGSIPREIGNLSNLEILDAS  167


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 5/136 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  + +SE  + GS P   ++ QL+ L  +  + N+  G+IP  + + S LETLD+S  
Sbjct  210  SLEYMDMSENYLNGSIPG--VVGQLSKLRRLFLTGNNFEGSIPREIGNLSNLETLDISFM  267

Query  494  DL--TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDI  664
            +      I  E   +K LR++ +  + L G IP    ++ SL  +D+S N LNGSIPD +
Sbjct  268  EKFELATIPDELGELKNLRNIRIVNSNLIGNIPEAFSSFFSLVYMDLSRNYLNGSIPDWL  327

Query  665  GNFYNLSYLDLSMNSL  712
              F NLS L+L  N L
Sbjct  328  FRFENLSDLNLERNQL  343


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 55/117 (47%), Gaps = 2/117 (2%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            SN     IS  E     + P    + +L NL +I   +++L G IP   SS   L  +DL
Sbjct  257  SNLETLDISFMEKFELATIPDE--LGELKNLRNIRIVNSNLIGNIPEAFSSFFSLVYMDL  314

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
            S N L G I    F  + L  LNL  N L G +P P+      +L +S N L+G IP
Sbjct  315  SRNYLNGSIPDWLFRFENLSDLNLERNQLHGTLPIPIGEAKFSALKLSWNQLSGKIP  371



>emb|CDM84035.1| unnamed protein product [Triticum aestivum]
Length=665

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 100/177 (56%), Gaps = 6/177 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCN-SNGSVTRISLSEMIMGGSFPA  367
            DER  L+ +K+ WG P  +   WN +S  C WP ++C+ S+G VT +SL+   + G FP 
Sbjct  30   DERHSLMQIKRAWGDP-PVLAAWNGSSDHCTWPYVTCDASSGRVTSLSLANTGVAGPFPD  88

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF-SMKTLR  544
            +  I  L+ L S+N S+N +    P +L  C+ L  LDLS+  L G++  +    M  L+
Sbjct  89   A--IGGLSRLTSLNISNNDITSAFPTSLYRCASLRHLDLSLAYLHGELPADIGNGMPLLQ  146

Query  545  SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            ++NL GN L GEIP  +   S L  LD+S N L G IP ++G    L  LDLS N L
Sbjct  147  AMNLSGNQLSGEIPRSVAKLSYLTQLDLSRNQLAGEIPAELGAMRVLDALDLSSNKL  203



>ref|XP_012077398.1| PREDICTED: receptor-like protein kinase HSL1 [Jatropha curcas]
 gb|KDP34178.1| hypothetical protein JCGZ_07749 [Jatropha curcas]
Length=1026

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 103/172 (60%), Gaps = 5/172 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            E+ ILL L++  G P  L E WNS+S PC+W G+ C  N +VT + LS++ +  + PA+ 
Sbjct  35   EQTILLKLRRELGNP-PLLESWNSSSPPCNWKGVQCIGN-TVTGLVLSDVNITVTIPAT-  91

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             IC L NL+S++ S N + GT P  L +CSKL+ LDLS N   G I  +   + TL+ ++
Sbjct  92   -ICDLKNLISLDLSLNYIPGTFPTVLYNCSKLQHLDLSQNYFVGPIPDDIDRLSTLQYID  150

Query  554  LRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L  N   G+IPT +   + L++L +  N  NG IP +IG+  NL  L L+ N
Sbjct  151  LGANNFSGDIPTTIGNLTELQTLFLYQNGFNGIIPKEIGSLANLVKLGLAFN  202


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 64/121 (53%), Gaps = 3/121 (2%)
 Frame = +2

Query  359  FPASAIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
            F  S I  +  NL  + F      +L G IP + S+ S LE LDL++N L   +    F 
Sbjct  204  FMPSRIPVEFGNLKKLTFMWIRFANLIGPIPESFSNLSSLEHLDLAMNKLEANMPNGLFL  263

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            +K L +L L  N L GEIP  + A++L  +D+S N L GSIPDD G    L  L L +N 
Sbjct  264  LKNLTNLYLFHNKLSGEIPQVVEAFNLVEIDISLNSLTGSIPDDFGKLQRLEVLLLYINQ  323

Query  710  L  712
            L
Sbjct  324  L  324


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 68/151 (45%), Gaps = 27/151 (18%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ +S   + G  P    I    N+V    S+N   G IP  L+S S+L TL L  N 
Sbjct  456  LSRLEISNNKLSGPIPTG--ISSWRNVVVFKASNNLFSGEIPEELTSLSRLSTLFLDGNQ  513

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY------------------------  604
             +G++  +  S K+L  LNL  N L GEIP  M +                         
Sbjct  514  FSGQLPSQMISWKSLTDLNLSRNALSGEIPAAMGSLPDLLYLDLSQNHLSGNIPSGFGQL  573

Query  605  SLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
             L  L++SSN L+G IPD   N  Y  S+L+
Sbjct  574  KLIYLNLSSNQLSGQIPDQFDNLAYEYSFLN  604


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 59/117 (50%), Gaps = 4/117 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T + L    + G  P    + +  NLV I+ S NSL G+IP +     +LE L L IN 
Sbjct  267  LTNLYLFHNKLSGEIPQ---VVEAFNLVEIDISLNSLTGSIPDDFGKLQRLEVLLLYINQ  323

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
            L+G++      +  L    +  N L G +P     +S LE  +VSSN  +G +P+++
Sbjct  324  LSGELPSSIALLPKLSIFRVFTNKLSGVLPPEFGLHSKLEVFEVSSNHFSGRLPENL  380



>ref|XP_002278306.2| PREDICTED: receptor-like protein kinase 5 isoform X1 [Vitis vinifera]
Length=1021

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 103/181 (57%), Gaps = 6/181 (3%)
 Frame = +2

Query  167  QSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMI  346
            Q ++   +DER+ILL +KQ  G P SL + WNS+S PCDWP I+C  N +VT ISL    
Sbjct  26   QVISQNLDDERSILLDVKQQLGNPPSL-QSWNSSSLPCDWPEITCTDN-TVTAISLHNKT  83

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            +    PA+  IC L NL+ ++ S+N + G  P ++ +CSKLE L L  N   G I  +  
Sbjct  84   IREKIPAT--ICDLKNLIVLDLSNNYIVGEFP-DILNCSKLEYLLLLQNSFVGPIPADID  140

Query  527  SMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +  LR L+L  N   G+IP  +     L  L +  N+ NG+ P +IGN  NL +L ++ 
Sbjct  141  RLSHLRYLDLTANNFSGDIPAAIGRLRELFYLFLVQNEFNGTWPTEIGNLANLEHLAMAY  200

Query  704  N  706
            N
Sbjct  201  N  201


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 72/125 (58%), Gaps = 1/125 (1%)
 Frame = +2

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
            M+ G SF  +       NL  +  S+N   G IPA +SS   +  L+ S N L+GKI  E
Sbjct  438  MLAGNSFSGTLPSKLARNLSRVEISNNKFSGPIPAEISSWMNIAVLNASNNMLSGKIPME  497

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
              S++ +  L L GN   GE+P+ ++++ SL +L++S N L+G IP  +G+  NL+YLDL
Sbjct  498  LTSLRNISVLLLDGNQFSGELPSEIISWKSLNNLNLSRNKLSGPIPKALGSLPNLNYLDL  557

Query  698  SMNSL  712
            S N  
Sbjct  558  SENQF  562


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 79/163 (48%), Gaps = 12/163 (7%)
 Frame = +2

Query  233  YPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINF  412
            Y F +  ++N T     WP       G++  +    M     F  SA+  +   L  + +
Sbjct  171  YLFLVQNEFNGT-----WP----TEIGNLANLEHLAMAYNDKFRPSALPKEFGALKKLKY  221

Query  413  ---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
               +  +L G IP + +  S LE LDLS+N L G I G    +K L +L L  N L G I
Sbjct  222  LWMTQANLIGEIPKSFNHLSSLEHLDLSLNKLEGTIPGVMLMLKNLTNLYLFNNRLSGRI  281

Query  584  PTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P+ + A +L+ +D+S N L G IP+  G   NL+ L+L  N L
Sbjct  282  PSSIEALNLKEIDLSKNHLTGPIPEGFGKLQNLTGLNLFWNQL  324


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 63/133 (47%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  I LS+  + G  P      +L NL  +N   N L G IP N+S    LET  +  N 
Sbjct  290  LKEIDLSKNHLTGPIPEG--FGKLQNLTGLNLFWNQLSGEIPVNISLIPTLETFKVFSNQ  347

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
            L+G +   F     L+   +  N L GE+P  + A   L  +  S+N+L+G +P  +GN 
Sbjct  348  LSGVLPPAFGLHSELKRFEVSENKLSGELPQHLCARGVLLGVVASNNNLSGEVPKSLGNC  407

Query  674  YNLSYLDLSMNSL  712
             +L  + LS N  
Sbjct  408  RSLLTIQLSNNRF  420



>gb|KDP33797.1| hypothetical protein JCGZ_07368 [Jatropha curcas]
Length=835

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 93/166 (56%), Gaps = 7/166 (4%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQW--NSTSSPCDWPGISCNSN-GSVTRISLSEMIMGGS  358
            + E+ ILL LKQHW     + +QW  +++SS C WPG++CNSN  S+  + L+ M + G+
Sbjct  30   DQEQEILLRLKQHWRNQ-PVLDQWTPSTSSSYCTWPGVNCNSNNSSIVGLGLANMSISGT  88

Query  359  FPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKT  538
             P    IC L NL  +NF +NS  GT P +L +CSKLE LDL+ N   GK+  +   +  
Sbjct  89   IPP--FICDLKNLTVVNFYNNSFTGTFPVSLFNCSKLEYLDLAQNYFVGKLPDDIDRLSR  146

Query  539  LRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
            L  LNL  N   G +P  +     L +L +  N  NG+ P +IG  
Sbjct  147  LSYLNLYANNFTGNVPVAIGRLQELRNLQLQQNQFNGTFPSEIGKL  192


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 67/151 (44%), Gaps = 28/151 (19%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ +S     G  P         NLV  N S+N L GTIP  L++   L TL L  N 
Sbjct  272  LQRLEISNNRFSGKIPTGD---SWRNLVVFNASNNQLSGTIPQELTALPFLTTLLLDRNQ  328

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGE------------------------IPTPMVAY  604
            L+G +  +  S K+L +LNL  N L GE                        IPT   + 
Sbjct  329  LSGALPSDIVSWKSLNTLNLSRNQLSGEIPGELALLPTLLDLDLSDNQFSGHIPTQFSSP  388

Query  605  SLESLDVSSNDLNGSIPDDIG-NFYNLSYLD  694
                L++SSN L+G IP  +  + YN S+L+
Sbjct  389  KFNLLNLSSNHLSGEIPSQLEISAYNNSFLN  419



>ref|XP_009779466.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=1019

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 99/174 (57%), Gaps = 6/174 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            +ER ILL +K+ WG P SL    NSTSSPCDWP I C+ +G VT I L E  +    P+S
Sbjct  27   NERDILLKIKRQWGNPLSLSSW-NSTSSPCDWPEIECSDDGEVTGIILQEKDITVEIPSS  85

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
              IC L NL  +N + N L G  P  L +CS LE LDLS N   G I  +   ++ L+ L
Sbjct  86   --ICDLKNLTFLNLALNYLPGKFPTFLYNCSSLEHLDLSQNYFVGPIPADIHRLQKLKYL  143

Query  551  NLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L GN   G+IP P +     LESL +  N  +G+ P +IGN  NL  L L+ N
Sbjct  144  DLGGNNFTGDIP-PAIGNLTELESLFLHMNLFDGTFPAEIGNLANLENLGLAFN  196


 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 67/134 (50%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  I L+   + G  P+   +  L NL      SN L   IP    S + +E LD+S N
Sbjct  236  SLEHIDLAYNNLEGEIPSGLFL--LKNLTYAYLYSNQLSDLIPETNKSSNLIE-LDVSSN  292

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +LTGKI      +K L  LNL  N L+GEIP  +    +L+   V  N LNGS+P +IG 
Sbjct  293  NLTGKIPESIGELKQLEILNLFSNQLYGEIPQSIAKIPTLKEFKVFRNKLNGSLPSEIGL  352

Query  671  FYNLSYLDLSMNSL  712
               L   ++S NS 
Sbjct  353  HSKLEVFEVSQNSF  366


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 54/107 (50%), Gaps = 2/107 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P    +  L+ L  +    NS  G IPAN++S   L  LDL+ N L+GKI      +
Sbjct  486  GQIPVE--LTSLSRLTRLELDGNSFSGEIPANITSWKSLTNLDLAKNKLSGKIPAALGLI  543

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
              L +L+L  N L G IP  +    + SL++SSN L G IPD   N 
Sbjct  544  PDLVALDLSQNQLSGPIPPQLGVKRITSLNLSSNQLIGKIPDSFANL  590


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 50/96 (52%), Gaps = 0/96 (0%)
 Frame = +2

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G IP +  +   LE +DL+ N+L G+I    F +K L    L  N L   IP    + 
Sbjct  223  LIGEIPESFGNFQSLEHIDLAYNNLEGEIPSGLFLLKNLTYAYLYSNQLSDLIPETNKSS  282

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L  LDVSSN+L G IP+ IG    L  L+L  N L
Sbjct  283  NLIELDVSSNNLTGKIPESIGELKQLEILNLFSNQL  318


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL+ ++ SSN+L G IP ++    +LE L+L  N L G+I      + TL+   +  N L
Sbjct  283  NLIELDVSSNNLTGKIPESIGELKQLEILNLFSNQLYGEIPQSIAKIPTLKEFKVFRNKL  342

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
             G +P+ +  +S LE  +VS N   G++P  +
Sbjct  343  NGSLPSEIGLHSKLEVFEVSQNSFTGNMPQHL  374


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 51/107 (48%), Gaps = 3/107 (3%)
 Frame = +2

Query  293  ISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLE  472
            +   S   +TR+ L      G  PA+  I    +L +++ + N L G IPA L     L 
Sbjct  490  VELTSLSRLTRLELDGNSFSGEIPAN--ITSWKSLTNLDLAKNKLSGKIPAALGLIPDLV  547

Query  473  TLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLE  613
             LDLS N L+G I  +   +K + SLNL  N L G+IP      + E
Sbjct  548  ALDLSQNQLSGPIPPQL-GVKRITSLNLSSNQLIGKIPDSFANLAFE  593



>ref|XP_008444991.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
 ref|XP_008444992.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=1003

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 99/174 (57%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            ++AILL LK+ WG P SL+  WN++S PCDWP I C  +G+V  ISL    + G  P   
Sbjct  34   DQAILLDLKEQWGNPSSLW-LWNASSLPCDWPEIICR-DGTVIGISLRNKNITGKVPT--  89

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            +IC L NL  ++ S N + G  P  L +CSKL+ LDLS N   G I  +   ++TL+ ++
Sbjct  90   VICNLQNLTVLDLSWNYIPGEFPEVLYNCSKLKYLDLSGNYFVGSIPQDVDRLQTLQYMD  149

Query  554  LRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L  N   G+ P  +   S L +L +     NG++P +I N  NL  L ++ N+L
Sbjct  150  LSANNFSGDFPAALGKLSDLRTLKIYRTQCNGTLPAEIANLSNLEVLSMAYNTL  203


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 3/118 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G FP    +  L +L ++  S N L G +P  + S   L TL+LS N ++G I   F
Sbjct  489  LLSGKFPDG--LASLPHLTTLVLSGNQLSGQLPTTIGSWESLNTLNLSRNKISGHIPAAF  546

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
             S+  L  L+L GN   GEIP  +    L SL++SSN L+G IPD+  N  Y  S+L+
Sbjct  547  GSLPNLLYLDLSGNNFTGEIPPEIGHLRLASLNLSSNQLSGKIPDEYENIAYGRSFLN  604


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  + N  WG IP N+S+   L   + S N L+GK      S+  L +L L GN L
Sbjct  455  NLSRLAINDNKFWGQIPQNVSAWRNLIVFEASNNLLSGKFPDGLASLPHLTTLVLSGNQL  514

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G++PT + ++ SL +L++S N ++G IP   G+  NL YLDLS N+ 
Sbjct  515  SGQLPTTIGSWESLNTLNLSRNKISGHIPAAFGSLPNLLYLDLSGNNF  562


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 69/121 (57%), Gaps = 4/121 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS PA   +  L NL ++    N L G IP ++ + S L  +DLS N+L+G I  +F  +
Sbjct  255  GSIPAG--LFSLQNLNNLFLYQNRLSGEIPKSIRA-SNLLNVDLSANNLSGTIPEDFGKL  311

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            K L+ LNL  N L GEIP  + +   L+   V +N L G++P ++G   NL  L++SMN 
Sbjct  312  KKLQVLNLFANHLSGEIPGSLGLIPELKGFRVFNNSLTGALPQELGLHSNLEALEVSMNK  371

Query  710  L  712
            L
Sbjct  372  L  372


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  L  +  + ++L G IP +LS    LE LDLS N+L G I    FS++ L +L L  
Sbjct  215  KLKKLKYMWMTKSNLIGEIPESLSELLSLEHLDLSSNNLIGSIPAGLFSLQNLNNLFLYQ  274

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  + A +L ++D+S+N+L+G+IP+D G    L  L+L  N L
Sbjct  275  NRLSGEIPKSIRASNLLNVDLSANNLSGTIPEDFGKLKKLQVLNLFANHL  324



>ref|XP_004148398.2| PREDICTED: receptor-like protein kinase HSL1 [Cucumis sativus]
Length=1004

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 99/174 (57%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            ++AILL LK+ WG P SL+  WN++S PCDWP I C  + +V  ISL    + G  P   
Sbjct  35   DQAILLDLKEQWGNPPSLW-LWNASSLPCDWPEIICR-DSTVIGISLRNKTITGKVPT--  90

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            +IC L NL  ++ S N + G  P  L +CSKL+ LDLS N   G I  +   ++TL+ ++
Sbjct  91   VICNLQNLTVLDLSWNYIPGEFPEVLYNCSKLKYLDLSGNYFVGPIPQDVDRLQTLQYMD  150

Query  554  LRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L  N   G+ P  +   S L +L +     NG++P +IGN  NL  L ++ N+L
Sbjct  151  LSANNFSGDFPAALGQLSDLRTLKIYRTQCNGTLPAEIGNLSNLETLSMAYNTL  204


 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = +2

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
            S+ ++ G FP    +  L +L ++  S N L G +P  + S   L TL+LS N+++G I 
Sbjct  487  SDNLLSGKFPDG--LTSLPHLTTLVLSGNQLSGQLPTTIGSWESLNTLNLSRNEISGHIP  544

Query  515  GEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYL  691
              F S+  L  L+L GN   GEIP  +    L SL++SSN L+G IPD+  N  Y  S+L
Sbjct  545  AAFGSLPNLLYLDLSGNNFTGEIPPEIGHLRLASLNLSSNQLSGKIPDEYENIAYGRSFL  604

Query  692  D  694
            +
Sbjct  605  N  605


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 4/121 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P    +  L NL ++    N L G IP ++ + S L  +DLS N+L+G I  +F  +
Sbjct  256  GSIPVG--LFSLQNLTNLFLYQNRLSGEIPKSIRA-SNLLNVDLSTNNLSGTIPEDFGKL  312

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            K L+ LNL  N L GEIP  + +   L+   V +N L G +P ++G   NL  L++SMN 
Sbjct  313  KKLQVLNLFANQLSGEIPGSLGLLPELKGFRVFNNSLTGGLPQELGLHSNLEALEVSMNK  372

Query  710  L  712
            L
Sbjct  373  L  373


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  ++N   G IP N+S+   L   + S N L+GK      S+  L +L L GN L
Sbjct  456  NLSRLAINNNKFSGQIPQNVSAWRNLIVFEASDNLLSGKFPDGLTSLPHLTTLVLSGNQL  515

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G++PT + ++ SL +L++S N+++G IP   G+  NL YLDLS N+ 
Sbjct  516  SGQLPTTIGSWESLNTLNLSRNEISGHIPAAFGSLPNLLYLDLSGNNF  563


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  L  +  + ++L G IP +L     LE LDLS N+L G I    FS++ L +L L  
Sbjct  216  KLKKLKYMWMTKSNLIGQIPESLLELLSLEHLDLSSNNLIGSIPVGLFSLQNLTNLFLYQ  275

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  + A +L ++D+S+N+L+G+IP+D G    L  L+L  N L
Sbjct  276  NRLSGEIPKSIRASNLLNVDLSTNNLSGTIPEDFGKLKKLQVLNLFANQL  325



>ref|XP_011093340.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Sesamum indicum]
Length=1025

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 97/179 (54%), Gaps = 6/179 (3%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            + +   ERA LL LKQ WG P  + + WN+TSSPC WP I C+++G VT I L    + G
Sbjct  29   SQFSPAERATLLSLKQEWGNP-PVLDSWNATSSPCHWPEIQCSADGFVTGILLKNYNLNG  87

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P S  I  L NL  ++ + N   G  P  + +CSKL+ LDLS N   G I      +K
Sbjct  88   SIPDS--ISTLENLTVLDLAFNLFAGNFPIAVLNCSKLQYLDLSQNLFVGNIPAGIDRLK  145

Query  536  TLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L+ L+L  N   G++P P +     L +L +  N  NGS P +I N  NL  L L+ N
Sbjct  146  SLQYLDLGANNFTGDVP-PAIGNLTQLRTLYLYMNLFNGSYPMEISNLVNLEILGLAYN  203


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 3/98 (3%)
 Frame = +2

Query  383  QLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            +   L SI F   +  +L G IP NL++   LE LDLS ND+ G+I G  F +K L  + 
Sbjct  213  EFGKLRSIKFIWMTEANLVGEIPQNLTNLLSLEHLDLSSNDMEGEIPGGLFLLKNLSRVY  272

Query  554  LRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIG  667
            L  N   G IP  + + ++  +D++ N L G IP+DIG
Sbjct  273  LYKNRFSGSIPQVIESLNMVEIDLAMNSLTGRIPEDIG  310


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 66/132 (50%), Gaps = 3/132 (2%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
             S+     S  I  G  P    +  L+ L+++    NSL G +P+ + S   L TL+L+ 
Sbjct  479  ASLVVFEASNNIFSGPIPQR--LTGLHQLITLILDGNSLSGELPSEIISWKSLTTLNLAR  536

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
            N L+G I     S+  L  L+L  N L GEIP  +    L SL++SSN L G IP +  N
Sbjct  537  NKLSGPIPPALGSLPDLLDLDLSQNQLSGEIPPQLGKLKLTSLNLSSNQLTGRIPAEFDN  596

Query  671  F-YNLSYLDLSM  703
              Y  S+L  S+
Sbjct  597  MAYGSSFLHNSL  608



>gb|KGN62796.1| hypothetical protein Csa_2G373400 [Cucumis sativus]
Length=1090

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 99/174 (57%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            ++AILL LK+ WG P SL+  WN++S PCDWP I C  + +V  ISL    + G  P   
Sbjct  121  DQAILLDLKEQWGNPPSLW-LWNASSLPCDWPEIICR-DSTVIGISLRNKTITGKVPT--  176

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            +IC L NL  ++ S N + G  P  L +CSKL+ LDLS N   G I  +   ++TL+ ++
Sbjct  177  VICNLQNLTVLDLSWNYIPGEFPEVLYNCSKLKYLDLSGNYFVGPIPQDVDRLQTLQYMD  236

Query  554  LRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L  N   G+ P  +   S L +L +     NG++P +IGN  NL  L ++ N+L
Sbjct  237  LSANNFSGDFPAALGQLSDLRTLKIYRTQCNGTLPAEIGNLSNLETLSMAYNTL  290


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = +2

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
            S+ ++ G FP    +  L +L ++  S N L G +P  + S   L TL+LS N+++G I 
Sbjct  573  SDNLLSGKFPDG--LTSLPHLTTLVLSGNQLSGQLPTTIGSWESLNTLNLSRNEISGHIP  630

Query  515  GEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYL  691
              F S+  L  L+L GN   GEIP  +    L SL++SSN L+G IPD+  N  Y  S+L
Sbjct  631  AAFGSLPNLLYLDLSGNNFTGEIPPEIGHLRLASLNLSSNQLSGKIPDEYENIAYGRSFL  690

Query  692  D  694
            +
Sbjct  691  N  691


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 4/121 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P    +  L NL ++    N L G IP ++ + S L  +DLS N+L+G I  +F  +
Sbjct  342  GSIPVG--LFSLQNLTNLFLYQNRLSGEIPKSIRA-SNLLNVDLSTNNLSGTIPEDFGKL  398

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            K L+ LNL  N L GEIP  + +   L+   V +N L G +P ++G   NL  L++SMN 
Sbjct  399  KKLQVLNLFANQLSGEIPGSLGLLPELKGFRVFNNSLTGGLPQELGLHSNLEALEVSMNK  458

Query  710  L  712
            L
Sbjct  459  L  459


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  ++N   G IP N+S+   L   + S N L+GK      S+  L +L L GN L
Sbjct  542  NLSRLAINNNKFSGQIPQNVSAWRNLIVFEASDNLLSGKFPDGLTSLPHLTTLVLSGNQL  601

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G++PT + ++ SL +L++S N+++G IP   G+  NL YLDLS N+ 
Sbjct  602  SGQLPTTIGSWESLNTLNLSRNEISGHIPAAFGSLPNLLYLDLSGNNF  649


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  L  +  + ++L G IP +L     LE LDLS N+L G I    FS++ L +L L  
Sbjct  302  KLKKLKYMWMTKSNLIGQIPESLLELLSLEHLDLSSNNLIGSIPVGLFSLQNLTNLFLYQ  361

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  + A +L ++D+S+N+L+G+IP+D G    L  L+L  N L
Sbjct  362  NRLSGEIPKSIRASNLLNVDLSTNNLSGTIPEDFGKLKKLQVLNLFANQL  411



>ref|XP_010110882.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC28701.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1055

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 102/179 (57%), Gaps = 8/179 (4%)
 Frame = +2

Query  179  TYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T  E E+++LL LKQHWG   S  ++W  S +S C WPGI+C SN SV  +SL+ + + G
Sbjct  30   TLQEQEQSVLLKLKQHWGN-ISFMDEWTPSDNSHCSWPGITCTSN-SVKGLSLNNVNITG  87

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
              P  + IC L NL +I+   N + G  P  + +CSKLE LDLS N   G +  +   + 
Sbjct  88   --PVPSFICDLKNLATIDLGDNYIPGEFPRAVFNCSKLEALDLSENYFVGTLPDDIDKLA  145

Query  536  TLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             L+SL L GN   G+IP P +     L+ L +  N  NGS+P +IG+  NL  L L+ N
Sbjct  146  KLQSLVLGGNNFTGDIP-PAIGKLQELKVLALGGNLFNGSLPPEIGDLSNLEDLWLANN  203


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L ++  SS++L G IP ++     LE LDLS +DL GKI    F +K L  + L  
Sbjct  217  QLRKLTNLEVSSSNLIGEIPESIGDMEALEWLDLSRSDLHGKIPDGLFMLKNLSIVFLFK  276

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G++P  + A +L+ +D+S N+L G IP+D G    L+ L L  N L
Sbjct  277  NKLSGDVPQVVEALNLKIIDLSENNLAGKIPEDFGKLTKLTGLALFSNQL  326


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 70/133 (53%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +TR+ +S     G+ P    +  L NLV    S+N L G IP  L++   L  L L  N 
Sbjct  458  LTRLEISNNNFSGNIPIG--LASLRNLVVFKASNNLLTGAIPQELTTFHHLTNLFLDQNQ  515

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG +  +  S  +L +LNL GN L G+IP  +    +L  LD+S N+ +G IP  +G  
Sbjct  516  LTGDLPSDIESWDSLNTLNLSGNQLSGQIPEKLGFLPTLTDLDLSENEFSGQIPPQLG-L  574

Query  674  YNLSYLDLSMNSL  712
              L +L+LS N L
Sbjct  575  LRLIFLNLSSNDL  587


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G+ P    +   ++L ++    N L G +P+++ S   L TL+LS N L+G+I  + 
Sbjct  491  LLTGAIPQE--LTTFHHLTNLFLDQNQLTGDLPSDIESWDSLNTLNLSGNQLSGQIPEKL  548

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
              + TL  L+L  N   G+IP  +    L  L++SSNDL+G+IP
Sbjct  549  GFLPTLTDLDLSENEFSGQIPPQLGLLRLIFLNLSSNDLSGTIP  592


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 61/130 (47%), Gaps = 4/130 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + G  P    +  L NL  +    N L G +P  + + + L+ +DLS N+L G
Sbjct  248  LDLSRSDLHGKIPDGLFM--LKNLSIVFLFKNKLSGDVPQVVEALN-LKIIDLSENNLAG  304

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            KI  +F  +  L  L L  N L G IP  +     L    +  N+L G +P D+G + NL
Sbjct  305  KIPEDFGKLTKLTGLALFSNQLSGSIPEGIGRLPVLVDFKLWDNNLTGVLPPDLGKYSNL  364

Query  683  SYLDLSMNSL  712
                +S N L
Sbjct  365  REFQVSSNRL  374



>ref|XP_010106712.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC11523.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1194

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 99/174 (57%), Gaps = 8/174 (5%)
 Frame = +2

Query  179  TYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T  E E+++LL LKQHWG   S  ++W  S +S C WPGI+C SN SV  +SL  + + G
Sbjct  30   TLQEQEQSVLLKLKQHWGN-ISFMDEWTPSDNSHCSWPGITCTSN-SVKGLSLYNVNITG  87

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
              P  + IC L N+ +IN   N + G  P  + +CSKLE LDLS N   G +  +   + 
Sbjct  88   --PVPSFICDLKNVTTINLGDNYIPGEFPRAVFNCSKLEALDLSENYFVGTLPDDIDKLA  145

Query  536  TLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
             L+SL L GN   G+IP P++     L+ L +  N  NGS+P +IG+  NL  L
Sbjct  146  KLQSLVLGGNNFTGDIP-PVIGKLQELKVLGLGGNLFNGSLPPEIGDLSNLEDL  198


 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 101/179 (56%), Gaps = 8/179 (4%)
 Frame = +2

Query  179  TYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T  E E+++LL LKQHWG   S  ++W  S +S C WPGI+C SN SV  +SL  + + G
Sbjct  206  TLQEQEQSVLLKLKQHWGN-ISFMDEWTPSDNSHCSWPGITCTSN-SVKGLSLYNVNITG  263

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
              P  + IC L NL +I+   N + G  P  + +CSKLE LDLS N   G +  +   + 
Sbjct  264  --PVPSFICDLKNLTTIDLGDNYIPGEFPRAVFNCSKLEALDLSENYFVGTLPDDIDKLA  321

Query  536  TLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             L+SL L GN   G+IP P +     L+ L +  N  NGS+P +IG+  NL  L L+ N
Sbjct  322  KLQSLVLGGNNFTGDIP-PAIGKLQELKVLALGGNLFNGSLPPEIGDLSNLEDLWLANN  379


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L ++  SS++L G IP ++     LE LDLS +DL GKI    F +K L  + L  
Sbjct  393  QLRKLKNLWVSSSNLIGEIPESIGDMEALEWLDLSRSDLHGKIPDGLFMLKNLSIVFLFK  452

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G++P  + A +L+ +D+S N+L G IP+D G    L+ L L  N L
Sbjct  453  NKLSGDVPQVVEALNLKIIDLSENNLAGKIPEDFGKLTKLTGLALFSNQL  502


 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 70/133 (53%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +TR+ +S     G+ P    +  L NLV    S+N L G IP  L++   L  L L  N 
Sbjct  634  LTRLEISNNRFSGNIPIG--LASLRNLVVFKASNNLLTGAIPQELTTFHHLTNLFLDQNQ  691

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG +  +  S  +L +LNL GN L G+IP  +    +L  LD+S N+ +G IP  +G  
Sbjct  692  LTGDLPSDIESWDSLNTLNLSGNQLSGQIPEKLGFLPTLTDLDLSENEFSGQIPPQLG-L  750

Query  674  YNLSYLDLSMNSL  712
              L +L+LS N L
Sbjct  751  LRLIFLNLSSNDL  763


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G+ P    +   ++L ++    N L G +P+++ S   L TL+LS N L+G+I  + 
Sbjct  667  LLTGAIPQE--LTTFHHLTNLFLDQNQLTGDLPSDIESWDSLNTLNLSGNQLSGQIPEKL  724

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
              + TL  L+L  N   G+IP  +    L  L++SSNDL+G+IP
Sbjct  725  GFLPTLTDLDLSENEFSGQIPPQLGLLRLIFLNLSSNDLSGTIP  768


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 61/130 (47%), Gaps = 4/130 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + G  P    +  L NL  +    N L G +P  + + + L+ +DLS N+L G
Sbjct  424  LDLSRSDLHGKIPDGLFM--LKNLSIVFLFKNKLSGDVPQVVEALN-LKIIDLSENNLAG  480

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            KI  +F  +  L  L L  N L G IP  +     L    +  N+L G +P D+G + NL
Sbjct  481  KIPEDFGKLTKLTGLALFSNQLSGSIPEGIGRLPVLVDFKLWDNNLTGVLPPDLGKYSNL  540

Query  683  SYLDLSMNSL  712
                +S N L
Sbjct  541  REFQVSSNRL  550



>ref|XP_011007101.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=982

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 96/173 (55%), Gaps = 6/173 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            ++A+LL LK HW  P SL EQW  S SS C+WPG+ CN N  VT++ L    + G+ P  
Sbjct  28   DQAVLLRLKHHWQNPLSL-EQWTPSNSSHCNWPGVVCNDN-YVTQLILDNKNISGTIPP-  84

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
             ++  L NL  +NFS+N++ G  P  + + SKLE LDLS N + G I  +  S+  L  L
Sbjct  85   -LLSDLKNLTFLNFSNNNIIGKFPVAVHNLSKLEILDLSQNYIVGTIPDDIDSLARLSYL  143

Query  551  NLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            NL  N   G IP  +     L +L +  N  NG+ P +IGN   L  L ++ N
Sbjct  144  NLYANNFSGNIPAAIGRLPELRTLRLYDNQFNGTFPPEIGNLSKLEELSMAHN  196


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 62/110 (56%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L ++  S  +L G IP  +   + LE LDLS N LTG I G  F +  LR L L  
Sbjct  209  QLKKLKTLWISGANLIGEIPQMIGGMASLEHLDLSSNKLTGNIPGSLFMLMNLRVLWLYE  268

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  + A +L S+D+S N+L G+IP D G    LS L+L  N L
Sbjct  269  NKLSGEIPRVVEALNLTSVDLSYNNLTGTIPVDFGKLDKLSGLNLFYNQL  318


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 72/135 (53%), Gaps = 4/135 (3%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
             S+  + LS   + G+ P S  +  L NL  +    N L G IP  + + + L ++DLS 
Sbjct  235  ASLEHLDLSSNKLTGNIPGSLFM--LMNLRVLWLYENKLSGEIPRVVEALN-LTSVDLSY  291

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG  667
            N+LTG I  +F  +  L  LNL  N L GEIP  +    +L+ L + +N+L+GSIP D+G
Sbjct  292  NNLTGTIPVDFGKLDKLSGLNLFYNQLSGEIPDGIGRLPALKDLKLFTNNLSGSIPPDLG  351

Query  668  NFYNLSYLDLSMNSL  712
             +  L   ++  N L
Sbjct  352  RYSALERFEVCSNRL  366


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +    N L G +P+++ S   L TL+LS N L+G++  +F  +
Sbjct  486  GTIPLE--LTALPNLTVLLLDKNQLTGALPSDIISWKSLTTLNLSQNQLSGQVPDKFGIL  543

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
            + L  L+L  N   G+IP  + +  L  L++SSN+L G IP +  N  Y  S+L+
Sbjct  544  RDLVKLDLSDNQFSGDIPPQLGSLRLVFLNLSSNNLMGQIPTEYENAAYATSFLN  598


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 55/107 (51%), Gaps = 1/107 (1%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  +  S+N   G+I    +S   L   + S N  TG I  E  ++  L  L L  N L 
Sbjct  450  LSRLEISNNKFSGSISIEGNSWRNLVVFNASNNQFTGTIPLELTALPNLTVLLLDKNQLT  509

Query  575  GEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            G +P+ ++++ SL +L++S N L+G +PD  G   +L  LDLS N  
Sbjct  510  GALPSDIISWKSLTTLNLSQNQLSGQVPDKFGILRDLVKLDLSDNQF  556



>ref|XP_010668734.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=1023

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 100/173 (58%), Gaps = 5/173 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            ++ ILL + Q WG P  + + WNST   C WPGI+C    SVT ISL+   + G+ PAS 
Sbjct  35   DQDILLNIAQQWGNPLPM-QSWNSTIPVCVWPGINCTDGESVTGISLNSQNIDGAIPAS-  92

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK-TLRSL  550
             IC L NL  ++  +NS+ G  P  L +C+KL+TL LS N   G++  +   +  +L++L
Sbjct  93   -ICDLKNLTLLDLGNNSITGNFPTFLYNCTKLQTLVLSSNYFVGELPNDINKLSPSLQNL  151

Query  551  NLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L  N   G+IPT +     L +L + SN  NG+ P ++GN  NL  L L+ N
Sbjct  152  DLSANNFTGDIPTSLAQIKGLITLHLESNLFNGTFPSELGNLENLEELWLAFN  204


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  S+N   G IP ++S+   L+  + S N +TG +  E  S+  L +L L GN L
Sbjct  457  NLSRVVISNNKFSGKIPPSISTWRILQVFEASNNMITGTVPLELTSLSNLNTLMLDGNQL  516

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GE+P+ ++++  L  LD+S N L+GSIP  +G+   L+YLDLS N  
Sbjct  517  TGELPSEIISWQNLNRLDLSHNALSGSIPSVLGSLPVLNYLDLSDNQF  564


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L NL  +  +  +L G IP + ++ + LE LDL  N L G I  + F +K L  + L  N
Sbjct  218  LKNLKFLWMTQCNLIGEIPDDYANLTSLEHLDLVENGLVGGIPSKLFLLKNLTYVYLYKN  277

Query  566  MLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L G IP+ + A +L  +D+S N+L G IPD  G    L  L L  N L
Sbjct  278  RLSGGIPSLIEALNLVEVDLSMNNLTGIIPDAFGKLQKLEILQLLENQL  326


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G+ P    +  L+NL ++    N L G +P+ + S   L  LDLS N L+G I    
Sbjct  491  MITGTVPLE--LTSLSNLNTLMLDGNQLTGELPSEIISWQNLNRLDLSHNALSGSIPSVL  548

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLDLS  700
             S+  L  L+L  N   G+IP       + SL++SSN LNG IP  I N  Y  S+LD  
Sbjct  549  GSLPVLNYLDLSDNQFSGKIPPEFDQLKVPSLNLSSNQLNGKIPYGIDNSAYKTSFLDTH  608

Query  701  MNS  709
            + S
Sbjct  609  LCS  611


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 65/125 (52%), Gaps = 3/125 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            +S+    G  P +  +C   NL  +   +N L GTIP +LS C+ L  + L+ N L+G +
Sbjct  369  VSDNAFTGQLPEN--LCAGGNLNGVVAFNNYLNGTIPRSLSQCNSLIVVLLNNNSLSGDV  426

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              + +S++ + ++ L  N   G++P  + A +L  + +S+N  +G IP  I  +  L   
Sbjct  427  PEQLWSLQQMTTILLNNNQFTGQLPEKL-ASNLSRVVISNNKFSGKIPPSISTWRILQVF  485

Query  692  DLSMN  706
            + S N
Sbjct  486  EASNN  490



>ref|XP_004245388.2| PREDICTED: receptor-like protein kinase 2 [Solanum lycopersicum]
Length=807

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 100/173 (58%), Gaps = 10/173 (6%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEM-IMGGSFP  364
            E+E+ ILL LKQ WG+     + W+S SS CDW GI C  NGSVT IS+ ++ +  G+ P
Sbjct  85   ENEKNILLELKQVWGFE----KLWDSNSSHCDWYGIDCR-NGSVTSISIQDVNLHTGTIP  139

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
               I+C+L +L  I+  +N + G  P +L +CS LE LD+S N   G +  +   +  L 
Sbjct  140  P--ILCELKSLYLIDLKTNYIRGEFPTSLYNCSNLEYLDISWNQFHGPLPSDLHRLSRLY  197

Query  545  SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            +LN+ GN  F  IP  +   S L+ L +  N+ N SIP +IGN   L  LD+S
Sbjct  198  NLNIAGNS-FSNIPGAIGQLSELQYLSLEFNNFNTSIPREIGNLSKLETLDIS  249



>ref|XP_002324455.2| hypothetical protein POPTR_0018s09540g [Populus trichocarpa]
 gb|EEF03020.2| hypothetical protein POPTR_0018s09540g [Populus trichocarpa]
Length=984

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 97/179 (54%), Gaps = 6/179 (3%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMG  352
            + + + E+A+LL LKQHW  P SL EQW  S SS C WPG+ C  N  +T++ L    + 
Sbjct  24   SQFHDQEQAVLLRLKQHWQNPLSL-EQWTPSNSSHCTWPGVVCTDN-YITQLILDNKNIS  81

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +NFS+N++ G  P  + + SKLE LDLS N + G I  +   +
Sbjct  82   GTIPP--FLSDLKNLTFLNFSNNNIIGKFPVAVPNLSKLEILDLSQNYIVGTIPDDIDCL  139

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              L  LNL  N   G IP  + +   L +L +  N  NG+ P +IGN   L  L ++ N
Sbjct  140  ARLSYLNLYANNFSGNIPAAIGLLPELRTLRLYDNQFNGTFPPEIGNLSKLEELSMAHN  198


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 69/136 (51%), Gaps = 2/136 (1%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPAS--AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            G+++++    M   G  P+   +   QL  L  +  S  +L G IP  +     LE LDL
Sbjct  185  GNLSKLEELSMAHNGFSPSRLHSSFTQLKKLKMLWISGANLIGEIPQMIGEMVALEHLDL  244

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDI  664
            S N LTG I G  F +  LR L L  N L  EIP  + A +L S+D+S N+L G+IP D 
Sbjct  245  SSNKLTGNIPGSLFMLLNLRVLYLHKNKLSEEIPRVVEALNLTSVDLSVNNLTGTIPFDF  304

Query  665  GNFYNLSYLDLSMNSL  712
            G    LS L L  N L
Sbjct  305  GKLDKLSGLSLFSNQL  320


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 57/108 (53%), Gaps = 2/108 (2%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NLV  N S+N   GTIP  L++   L  L L  N LTG +     S K+L  LNL  N L
Sbjct  475  NLVVFNASNNQFTGTIPLELTALPNLTVLLLDKNQLTGALPPNIISWKSLNILNLSQNHL  534

Query  572  FGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G+IP        L  LD+S N  +G IP  +G+   L +L+LS N+L
Sbjct  535  SGQIPEKFGFLTDLVKLDLSDNQFSGKIPPQLGSL-RLVFLNLSSNNL  581


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 71/134 (53%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++  + LS   + G+ P S  +  L NL  +    N L   IP  + + + L ++DLS+N
Sbjct  238  ALEHLDLSSNKLTGNIPGSLFM--LLNLRVLYLHKNKLSEEIPRVVEALN-LTSVDLSVN  294

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  +F  +  L  L+L  N L GEIP  +    +L+   + SN+L+GSIP D+G 
Sbjct  295  NLTGTIPFDFGKLDKLSGLSLFSNQLSGEIPEGIGRLPALKDFKLFSNNLSGSIPPDLGR  354

Query  671  FYNLSYLDLSMNSL  712
            +  L   ++  N L
Sbjct  355  YSALERFEVCSNRL  368


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +    N L G +P N+ S   L  L+LS N L+G+I  +F  +
Sbjct  488  GTIPLE--LTALPNLTVLLLDKNQLTGALPPNIISWKSLNILNLSQNHLSGQIPEKFGFL  545

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
              L  L+L  N   G+IP  + +  L  L++SSN+L G IP +  +  Y  S+L+
Sbjct  546  TDLVKLDLSDNQFSGKIPPQLGSLRLVFLNLSSNNLMGKIPTEYEDVAYATSFLN  600



>ref|XP_010095459.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXB60285.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1032

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 108/185 (58%), Gaps = 9/185 (5%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSV-TRISLSE  340
            SQSL T    ER+ILL L+Q WG P SL    NS+S PCDWP I C+ +G+V T + L E
Sbjct  29   SQSLDT----ERSILLKLRQQWGNPPSLSSW-NSSSLPCDWPEIQCSDDGTVVTGVLLRE  83

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
              +    PA+  IC L NL S++ + N + G  P  L +CS+L  LDLS N+ TG+I  +
Sbjct  84   KDITEKIPAT--ICDLKNLTSLDLALNYVPGDFPKVLYNCSELRFLDLSQNNFTGRIPDD  141

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
               +  LR L+L GN   G+IP  +  +S L  L++  N  NG+ P +IGN  NL  L L
Sbjct  142  IDRISGLRLLDLSGNNFSGDIPASIGQFSELRELNLHMNLFNGTFPSEIGNLSNLELLRL  201

Query  698  SMNSL  712
            + N L
Sbjct  202  AYNGL  206


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 76/136 (56%), Gaps = 2/136 (1%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            SN  + R++ + + +  S PA     +L NL  +  +  +L G IP + +    LE LDL
Sbjct  194  SNLELLRLAYNGLFIPASIPAE--FGKLKNLKELWMTGTNLEGNIPESFADLQNLEKLDL  251

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDI  664
            S+N L G I    F +K L+ L L  N L GEIP P+ A +L  +D+S N+L GSIP+D 
Sbjct  252  SMNKLDGSIPSGLFLLKNLKFLLLFHNRLSGEIPRPVQALNLSEIDISMNNLTGSIPEDF  311

Query  665  GNFYNLSYLDLSMNSL  712
            G   NLS L+L  N L
Sbjct  312  GKLSNLSVLNLFSNQL  327


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  S+N   G IP   S+   L     S N  +GKI  EF S+  L +L L GN  
Sbjct  458  NLSRLEISNNRFSGEIPTGASTWESLIVFKASNNQFSGKIPVEFTSLSRLTTLLLDGNRF  517

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GE+P  +V++ SL++L++S N+L+G IP  I +  NL YLDLS N L
Sbjct  518  SGELPLEVVSWKSLDTLNLSRNELSGQIPQSIASLPNLLYLDLSENQL  565


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 55/99 (56%), Gaps = 2/99 (2%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-  595
            N L G IP  + + + L  +D+S+N+LTG I  +F  +  L  LNL  N L G IP  + 
Sbjct  278  NRLSGEIPRPVQALN-LSEIDISMNNLTGSIPEDFGKLSNLSVLNLFSNQLSGVIPASLG  336

Query  596  VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +  +L+   V +N LNG++P ++G    L   ++S N L
Sbjct  337  LIPTLKLFRVFNNKLNGTLPPEMGLHSKLEAFEVSNNQL  375


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 58/103 (56%), Gaps = 3/103 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P +  +C+   L  +   +N+L G +P  L +CS L ++ L  N+ +G++  E +
Sbjct  375  LAGELPVN--LCENGALRGMIAFANNLSGELPRGLGNCSSLISIQLYGNNFSGEVPPELW  432

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
            +   L +L +  N  +GE+P+ +  ++L  L++S+N  +G IP
Sbjct  433  TAMNLSTLMISKNSFYGELPSKL-PWNLSRLEISNNRFSGEIP  474



>ref|XP_003517639.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1010

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 103/186 (55%), Gaps = 3/186 (2%)
 Frame = +2

Query  158  NYSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLS  337
            N++ S +   + ERA LL +K++   P  L     S+SS C WP I C S+GSVT ++LS
Sbjct  24   NHANSQSQLHDQERATLLKIKEYLENPEFLSHWTPSSSSHCSWPEIKCTSDGSVTGLTLS  83

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
               +  + P+   IC L NL  ++F +N + G  P  L +CSKLE LDLS N+  G I  
Sbjct  84   NSSITQTIPS--FICDLKNLTVVDFYNNYIPGEFPTTLYNCSKLEYLDLSQNNFVGSIPH  141

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
            +   +  L+ L+L      G+IP  +     L +L   ++ LNG+ P +IGN  NL  LD
Sbjct  142  DIDRLSNLQYLSLGYTNFSGDIPASIGRLKELRNLQFQNSLLNGTFPAEIGNLSNLDTLD  201

Query  695  LSMNSL  712
            LS N++
Sbjct  202  LSSNNM  207


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 75/149 (50%), Gaps = 28/149 (19%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNS--------------------------LWGTIPA  445
            ++ G+FPA   I  L+NL +++ SSN+                          L G IP 
Sbjct  182  LLNGTFPAE--IGNLSNLDTLDLSSNNMLPPSRLHDDWTRLNKLKFFFMFQSNLVGEIPE  239

Query  446  NLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDV  625
             + +   LE LDLS N+L+G I G  F ++ L  + L  N L GEIP  + A +L  +D+
Sbjct  240  TIVNMVALERLDLSQNNLSGPIPGGLFMLENLSIMFLSRNNLSGEIPDVVEALNLTIIDL  299

Query  626  SSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + N ++G IPD  G    L+ L LS+N+L
Sbjct  300  TRNFISGKIPDGFGKLQKLTGLALSINNL  328


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 61/124 (49%), Gaps = 3/124 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S++R+ +      G  P    +    N+V    S N L G+IP  L++  KL  L L  N
Sbjct  458  SISRLEIDYNQFSGRIPTG--VSSWTNVVVFKASENYLNGSIPKELTALPKLNILLLDQN  515

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             LTG +  +  S ++L +LNL  N L G IP  + +   L  LD+S N L+G +P  +  
Sbjct  516  QLTGSLPSDIISWQSLVTLNLSQNQLSGHIPDSIGLLPVLTILDLSENQLSGDVPSILPR  575

Query  671  FYNL  682
              NL
Sbjct  576  LTNL  579


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 67/134 (50%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++ R+ LS+  + G  P    +  L NL  +  S N+L G IP ++     L  +DL+ N
Sbjct  246  ALERLDLSQNNLSGPIPGGLFM--LENLSIMFLSRNNLSGEIP-DVVEALNLTIIDLTRN  302

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             ++GKI   F  ++ L  L L  N L GEIP  + +  SL    V  N+L+G +P D G 
Sbjct  303  FISGKIPDGFGKLQKLTGLALSINNLEGEIPASIGLLPSLVDFKVFFNNLSGILPPDFGR  362

Query  671  FYNLSYLDLSMNSL  712
            +  L    ++ NS 
Sbjct  363  YSKLETFLVANNSF  376



>ref|XP_002527459.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF34951.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=983

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 105/200 (53%), Gaps = 28/200 (14%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNS-NGSVTRISLSEMIMGGSF-  361
            E ++  LL  K +   P      WN  SSPC+W G+SCN  N  V  ++LS + + GS  
Sbjct  8    ETDKEALLAFKSNLEPPG--LPSWNQNSSPCNWTGVSCNRFNHRVIGLNLSSLDISGSIS  65

Query  362  ---------------------PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETL  478
                                      IC L  L ++N SSNSL G+I +NLS  S L  L
Sbjct  66   PYIGNLSFLRSLQLQNNHLRGTIPDEICNLFRLTAMNLSSNSLQGSISSNLSKLSDLTVL  125

Query  479  DLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSI  652
            DLS+N +TGKI  E  S+  L+ LNL  N+L G IP P +A   SLE L + +N L+G I
Sbjct  126  DLSMNKITGKIPEELTSLTKLQVLNLGRNVLSGAIP-PSIANLSSLEDLILGTNTLSGII  184

Query  653  PDDIGNFYNLSYLDLSMNSL  712
            P D+   +NL  LDL++N+L
Sbjct  185  PSDLSRLHNLKVLDLTINNL  204


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 76/132 (58%), Gaps = 6/132 (5%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ++L   ++ G+ P S  I  L++L  +   +N+L G IP++LS    L+ LDL+IN+LTG
Sbjct  149  LNLGRNVLSGAIPPS--IANLSSLEDLILGTNTLSGIIPSDLSRLHNLKVLDLTINNLTG  206

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSS---NDLNGSIPDDIGNFY  676
             +    ++M +L +L L  N L+GE+P+  V  +L +L V +   N   G+IP  + N  
Sbjct  207  SVPSNIYNMSSLVTLALASNQLWGELPSD-VGVTLPNLLVFNFCINKFTGTIPGSLHNLT  265

Query  677  NLSYLDLSMNSL  712
            N+  + ++ N L
Sbjct  266  NIKVIRMAHNLL  277


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            +L+ +    N ++G IPA++   S L  L+LS N +TG I  E   ++ L+ L L GN  
Sbjct  345  DLLQLYMGENQIYGGIPASIGHLSGLTLLNLSYNSITGSIPREIGQLEHLQFLGLAGNQF  404

Query  572  FGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP  +     L  +D+S N L G+IP   GNF +L  +DLS N L
Sbjct  405  SGSIPDSLGNLRKLNQIDLSRNGLVGAIPTTFGNFQSLLAMDLSNNKL  452


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 68/122 (56%), Gaps = 4/122 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PAS  I  L+ L  +N S NS+ G+IP  +     L+ L L+ N  +G I     ++
Sbjct  358  GGIPAS--IGHLSGLTLLNLSYNSITGSIPREIGQLEHLQFLGLAGNQFSGSIPDSLGNL  415

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLS-YLDLSMN  706
            + L  ++L  N L G IPT    + SL ++D+S+N LNGSI  +I N  +LS  L+LS N
Sbjct  416  RKLNQIDLSRNGLVGAIPTTFGNFQSLLAMDLSNNKLNGSIAKEILNLPSLSKILNLSNN  475

Query  707  SL  712
             L
Sbjct  476  FL  477


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 63/146 (43%), Gaps = 28/146 (19%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P S  +  L  L  I+ S N L G IP    +   L  +DLS N L G IA E  ++
Sbjct  406  GSIPDS--LGNLRKLNQIDLSRNGLVGAIPTTFGNFQSLLAMDLSNNKLNGSIAKEILNL  463

Query  533  KTLR-------------------------SLNLRGNMLFGEIPTPMV-AYSLESLDVSSN  634
             +L                          +++L  N L G+IP+ +    SLE L +S N
Sbjct  464  PSLSKILNLSNNFLSGNLSEDIGLLESVVTIDLSNNHLSGDIPSLIKNCESLEELYMSRN  523

Query  635  DLNGSIPDDIGNFYNLSYLDLSMNSL  712
              +G +P  +G    L  LDLS N L
Sbjct  524  SFSGPVPAVLGEMKGLETLDLSYNHL  549



>ref|XP_011048044.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein 
kinase At2g41820 [Populus euphratica]
Length=887

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 99/183 (54%), Gaps = 11/183 (6%)
 Frame = +2

Query  173  LTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSP-CDWPGISCNSNGS-VTRISLSEMI  346
            L T   D++AILL + +  G P      W + ++  C W GISC  N S V R+ LS + 
Sbjct  19   LVTAQLDDQAILLAINRELGVP-----GWGANNTNYCKWAGISCGLNHSMVERLDLSRLG  73

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+     +I +L  L  ++ SSNS  G IP+ + + S+LE LDLS+N   G I  E  
Sbjct  74   LRGNV---TLISELKALKQLDLSSNSFHGEIPSAIGNLSQLEFLDLSLNKFGGVIPMELG  130

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +K L+SLNL  NML G+IP        LE   +SSN LNGSIP  +GN  NLS      
Sbjct  131  GLKNLKSLNLSNNMLVGQIPDEFQGLEKLEDFQISSNKLNGSIPSWVGNLTNLSVFTAYE  190

Query  704  NSL  712
            N L
Sbjct  191  NDL  193


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P +  I  +++L     ++N + G I +  + CS L  L+L+ N  +G I  E   +
Sbjct  267  GVIPKA--IGNVSSLTYFEVANNHMSGEIVSEFAQCSNLILLNLASNGFSGVIPPELGQL  324

Query  533  KTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L+ L L GN LFG+IP  ++   SL  LD+S+N  NG++P+DI N   L YL L  NS
Sbjct  325  VNLQELILSGNSLFGDIPISIIGCKSLNKLDLSNNRFNGTVPNDICNMSRLQYLLLGQNS  384

Query  710  L  712
            +
Sbjct  385  I  385


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 64/123 (52%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + GS P+   +  L NL       N L G IP NL S S+L+ L+L  N L G I    F
Sbjct  169  LNGSIPS--WVGNLTNLSVFTAYENDLGGVIPDNLGSVSELKVLNLHSNMLEGPIPKSIF  226

Query  527  SMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            SM  L  L L  N L GE+P  +     L ++ + +NDL G IP  IGN  +L+Y +++ 
Sbjct  227  SMGKLEVLILTLNRLKGELPESVGNCRGLSNIRIGNNDLVGVIPKAIGNVSSLTYFEVAN  286

Query  704  NSL  712
            N +
Sbjct  287  NHM  289


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL NL  +  S NSL+G IP ++  C  L  LDLS N   G +  +  +M  L+ L L  
Sbjct  323  QLVNLQELILSGNSLFGDIPISIIGCKSLNKLDLSNNRFNGTVPNDICNMSRLQYLLLGQ  382

Query  563  NMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSY-LDLSMNSL  712
            N + GEIP  +     L  L + SN L G+IP +IG+  NL   L+LS N L
Sbjct  383  NSIKGEIPHEIGNCLKLLELQMGSNYLTGNIPPEIGHIRNLQIALNLSFNHL  434


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ ++ LS     G+ P    IC ++ L  +    NS+ G IP  + +C KL  L +  N
Sbjct  350  SLNKLDLSNNRFNGTVPND--ICNMSRLQYLLLGQNSIKGEIPHEIGNCLKLLELQMGSN  407

Query  494  DLTGKIAGEFFSMKTLR-SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG  667
             LTG I  E   ++ L+ +LNL  N L G +P  +     L SLDVS+N L+G+IP    
Sbjct  408  YLTGNIPPEIGHIRNLQIALNLSFNHLHGPLPPELGKLDKLVSLDVSNNQLSGTIPPSFK  467

Query  668  NFYNLSYLDLSMNSL  712
               +L  ++ S N L
Sbjct  468  GMLSLIEINFSNNLL  482


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 55/110 (50%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L  L     SSN L G+IP+ + + + L       NDL G I     S+  L+ LNL  N
Sbjct  156  LEKLEDFQISSNKLNGSIPSWVGNLTNLSVFTAYENDLGGVIPDNLGSVSELKVLNLHSN  215

Query  566  MLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            ML G IP  + +   LE L ++ N L G +P+ +GN   LS + +  N L
Sbjct  216  MLEGPIPKSIFSMGKLEVLILTLNRLKGELPESVGNCRGLSNIRIGNNDL  265



>ref|XP_011078243.1| PREDICTED: receptor-like protein kinase HSL1 [Sesamum indicum]
Length=1018

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 99/177 (56%), Gaps = 6/177 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            + E++ILL LKQHW  P SL   W  +S  C WP I+C ++GSVTRI++    +  + P 
Sbjct  35   DQEQSILLSLKQHWSNPSSL-SHWTPSSDHCSWPEIAC-TDGSVTRIAIINGSITETIPP  92

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK-TLR  544
            S  IC L NL  I+   N + G  P  L +C KLE LDLS N L G I  +   +   L+
Sbjct  93   S--ICDLKNLSYIDLQWNFIPGFFPTVLYNCPKLEYLDLSQNYLVGTIPDDINRLSPRLQ  150

Query  545  SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             LNL  N   G+IP  + +  SL SL + +N  NGS P +IGN  NL  L LS N+ 
Sbjct  151  YLNLAANNFTGDIPASVGSLPSLVSLQLVANLFNGSFPPEIGNLSNLEELVLSYNAF  207


 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 74/131 (56%), Gaps = 4/131 (3%)
 Frame = +2

Query  332  LSEMIMG-GSFPASAI---ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDL  499
            L E+++   +F   AI     +L  L ++  +  +L G IP ++ + S LE+LDLS+NDL
Sbjct  197  LEELVLSYNAFAPQAIPSSFTKLKKLRNLWMTEANLIGEIPDDIGNMSALESLDLSVNDL  256

Query  500  TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYN  679
             G I    F +K L  L L  N L G IP  + A  L+ LD+S+N LNG IPDD GN  +
Sbjct  257  RGNIPDGLFLLKNLTFLYLYKNRLSGPIPQRVEALKLQVLDLSNNSLNGKIPDDFGNLTS  316

Query  680  LSYLDLSMNSL  712
            L+ L L  N L
Sbjct  317  LTGLALFFNQL  327


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (52%), Gaps = 2/110 (2%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L NL  +    N L G IP  + +  KL+ LDLS N L GKI  +F ++ +L  L L  N
Sbjct  267  LKNLTFLYLYKNRLSGPIPQRVEAL-KLQVLDLSNNSLNGKIPDDFGNLTSLTGLALFFN  325

Query  566  MLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GE+P  +     L  + + SN+L+G +P D+G +  L    +S N  
Sbjct  326  QLSGEVPVSIGRLPQLVDIGLYSNNLSGELPPDLGRYSMLKRFQVSTNQF  375



>gb|EYU29298.1| hypothetical protein MIMGU_mgv1a000685mg [Erythranthe guttata]
Length=1018

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 97/179 (54%), Gaps = 6/179 (3%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            + +   ERA LL LKQ W  P +L + WN+TSSPCDWP I C+  GSVT I L    + G
Sbjct  29   SQFSPAERATLLNLKQVWDDPPAL-DSWNATSSPCDWPEIQCSGEGSVTGIFLKNCNLSG  87

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S   S  I  L NL  ++ S N   G  P  + +CS L+ LDLS N   G I      ++
Sbjct  88   SITDS--ISALANLTVLDLSYNFFPGNFPTAILNCSNLQHLDLSQNLFVGNIPANIDRLE  145

Query  536  TLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L  L+L  N   G+IP P +     L+SL +  N LNGS P +I N  NL +L L+ N
Sbjct  146  SLNYLDLGANNFTGDIP-PAIGNLTQLKSLYMYMNLLNGSYPVEISNLANLEHLGLAYN  203


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  +  I  +   ++G +P + S+ S L  LDLS ND+ G+I    F +K L  + L  
Sbjct  216  KLRRIKYIWMTHAKVFGEMPESFSNLSSLTHLDLSSNDMEGEIPSGLFLLKNLSKVYLYK  275

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIG  667
            N   G IP  + + +L  +D++ N L+G +P+D G
Sbjct  276  NRFSGSIPPVIESLNLVEIDLAMNKLSGEVPEDFG  310


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 58/128 (45%), Gaps = 23/128 (18%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL +   S N   G +PANL +   L  +    N+LTG+I     + +TLRS+ L  N  
Sbjct  362  NLEAFEVSDNHFTGNLPANLCAGKTLFGVVAFNNNLTGQIPKSLANCQTLRSVQLYSNSF  421

Query  572  FGEIPTPM-----------------------VAYSLESLDVSSNDLNGSIPDDIGNFYNL  682
             GE+P  +                       VA++L  L++S+N  +G IP D+ ++ NL
Sbjct  422  SGEVPPGLWSAENMTSMMLSDNSFSGQLPGRVAWNLTRLEISNNKFSGEIPSDVSSWANL  481

Query  683  SYLDLSMN  706
                 S N
Sbjct  482  IVFKASNN  489



>ref|XP_004301323.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011464595.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X1 [Fragaria vesca subsp. vesca]
Length=1027

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = +2

Query  263  STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIP  442
            + SSPC+W GISCN  GSVTRI+LS + + G+    + +    NL  +N S N L+ TIP
Sbjct  83   TKSSPCNWTGISCNKAGSVTRITLSNVHLQGTLQEFSFLA-FPNLAYVNLSMNKLFHTIP  141

Query  443  ANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESL  619
              +S  +KL +LDLS+N+L+G+I  E   +K L  L L  N L G IP  + +  SL  L
Sbjct  142  PEISHLTKLISLDLSLNNLSGRIPPEIGFLKNLTDLLLFRNNLSGSIPKEIGSLKSLVHL  201

Query  620  DVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            ++S+N L+GSIP   G+  NL   +LS N+L
Sbjct  202  ELSNNQLDGSIPTSFGDLTNLKTFNLSYNNL  232


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 73/123 (59%), Gaps = 5/123 (4%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + GS P    I  L +LV +  S+N L G+IP +    + L+T +LS N+L+G I  E  
Sbjct  184  LSGSIPKE--IGSLKSLVHLELSNNQLDGSIPTSFGDLTNLKTFNLSYNNLSGHIPKEIP  241

Query  527  SMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            +  +++ L LRGN L G IPT +    +L  L +  N L+G+IP++IGN  +L +L LS+
Sbjct  242  T--SIKILTLRGNQLDGSIPTSLGDLRNLTILYLRENQLSGTIPEEIGNLKSLVHLGLSV  299

Query  704  NSL  712
            N L
Sbjct  300  NQL  302


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 59/113 (52%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            +CQ  +L +++ + N   G +P  L +C+ L    L  N LTG I+ +F     L+ L L
Sbjct  359  LCQGGSLTNLSLNKNHFIGPVPKGLKNCTSLIRARLEENQLTGNISEDFGVYPNLKLLRL  418

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N  +GE+       S LE L ++ N+L G+IP +IG    L  L+LS N L
Sbjct  419  NDNNFYGEVSQNWGKCSDLEDLGMAGNNLTGTIPPEIGKATKLEELNLSSNRL  471


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            +L  +  + N+L GTIP  +   +KLE L+LS N L G I   F  + +L  L L  N L
Sbjct  436  DLEDLGMAGNNLTGTIPPEIGKATKLEELNLSSNRLVGIIPKIFARLSSLLRLRLNDNQL  495

Query  572  FGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP+   +   L+ LD+S+N  N SIP+ +G+   L YL+LS N  
Sbjct  496  SGRIPSEFGSLVKLDYLDLSANKFNDSIPEVLGDLLGLHYLNLSNNEF  543


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 54/109 (50%), Gaps = 3/109 (3%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  + N+ +G +  N   CS LE L ++ N+LTG I  E      L  LNL  N L
Sbjct  412  NLKLLRLNDNNFYGEVSQNWGKCSDLEDLGMAGNNLTGTIPPEIGKATKLEELNLSSNRL  471

Query  572  FGEIPTPMVAYSLESLDVSSND--LNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP  + A     L +  ND  L+G IP + G+   L YLDLS N  
Sbjct  472  VGIIPK-IFARLSSLLRLRLNDNQLSGRIPSEFGSLVKLDYLDLSANKF  519


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 66/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  ++L    + GS P S  +  L NL  +    N L GTIP  + +   L  L LS+N
Sbjct  243  SIKILTLRGNQLDGSIPTS--LGDLRNLTILYLRENQLSGTIPEEIGNLKSLVHLGLSVN  300

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIG  667
             L G +   F  +  L +LNLR N L G IP  +  +  +L  L + +N  +G +P ++ 
Sbjct  301  QLNGSVPISFGKLLNLETLNLRQNQLSGSIPQQLEKIITNLSQLHLDTNHFSGYLPQNLC  360

Query  668  NFYNLSYLDLSMN  706
               +L+ L L+ N
Sbjct  361  QGGSLTNLSLNKN  373


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +2

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            +N S+N     IP  L S   L TLD+S N LTG I  E  +M++L +LNL  N L G I
Sbjct  536  LNLSNNEFNQEIPPELGSLVHLSTLDVSYNSLTGNIPPEMSNMESLENLNLSHNSLSGRI  595

Query  584  PTPM-VAYSLESLDVSSNDLNGSIPD  658
            P        L  +D+S+ND  G++P+
Sbjct  596  PITFNNMRGLSYVDISNNDFEGTLPN  621


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P    I +   L  +N SSN L G IP   +  S L  L L+ N L+G+I  EF 
Sbjct  447  LTGTIPPE--IGKATKLEELNLSSNRLVGIIPKIFARLSSLLRLRLNDNQLSGRIPSEFG  504

Query  527  SMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            S+  L  L+L  N     IP  +     L  L++S+N+ N  IP ++G+  +LS LD+S 
Sbjct  505  SLVKLDYLDLSANKFNDSIPEVLGDLLGLHYLNLSNNEFNQEIPPELGSLVHLSTLDVSY  564

Query  704  NSL  712
            NSL
Sbjct  565  NSL  567


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 51/99 (52%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N L G IP+   S  KL+ LDLS N     I      +  L  LNL  N    EIP  + 
Sbjct  493  NQLSGRIPSEFGSLVKLDYLDLSANKFNDSIPEVLGDLLGLHYLNLSNNEFNQEIPPELG  552

Query  599  A-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +   L +LDVS N L G+IP ++ N  +L  L+LS NSL
Sbjct  553  SLVHLSTLDVSYNSLTGNIPPEMSNMESLENLNLSHNSL  591



>ref|XP_009587881.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=1026

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 102/183 (56%), Gaps = 8/183 (4%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEM  343
            SQS  T  E +  ILL +K+ WG P SL    NSTSSPCDWP I C+ +G VT I L E 
Sbjct  27   SQSPATTNESD--ILLKIKRQWGDPLSLSSW-NSTSSPCDWPEIECSDDGKVTGIILQEK  83

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             +    P+S  IC L NL  +N + N L G  P  L +CS LE LDLS N   G I  + 
Sbjct  84   DITVEIPSS--ICDLKNLTFLNLALNFLPGKFPTLLYNCSSLEHLDLSQNYFVGPIPADI  141

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
              ++ L+ L+L GN   G+IP P +     LESL +  N  +G+ P +IGN  NL  L L
Sbjct  142  HLLQKLKYLDLGGNNFTGDIP-PTIGNLTELESLYLHMNLFDGTFPAEIGNLTNLENLGL  200

Query  698  SMN  706
            + N
Sbjct  201  AFN  203


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 67/132 (51%), Gaps = 4/132 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  I L+   + G  P+   +  L NL      SN L G IPA  +  S L  LD+S N
Sbjct  243  SLEHIDLAYNNLEGEIPSG--LFWLKNLTYAYLYSNQLSGLIPAT-NKLSNLIELDISNN  299

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
             LTGKI   F  +K L  LNL  N L+GEIP  +    +L+   V  N LNGS+P ++G 
Sbjct  300  KLTGKIPESFGELKQLEILNLFSNELYGEIPQSIAKIPTLKEFKVFRNKLNGSLPSEMGL  359

Query  671  FYNLSYLDLSMN  706
               L   ++S N
Sbjct  360  HSTLEAFEVSQN  371


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 53/107 (50%), Gaps = 2/107 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P    +  L+ L  +    NSL G IPAN++S   L  LDL+ N L GKI      +
Sbjct  493  GQIPVE--LTSLSKLTRMELDGNSLSGEIPANITSWKSLAILDLARNKLFGKIPAAIGLI  550

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
              L SL+L  N   G IP  +    + SL++SSN L G IPD   N 
Sbjct  551  PDLVSLDLSQNQFSGPIPPQLGVKRITSLNLSSNQLIGKIPDAFANL  597


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  PA+    +L+NL+ ++ S+N L G IP +     +LE L+L  N+L G+I     
Sbjct  278  LSGLIPATN---KLSNLIELDISNNKLTGKIPESFGELKQLEILNLFSNELYGEIPQSIA  334

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI---GNFYNL  682
             + TL+   +  N L G +P+ M  +S LE+ +VS N   G++P  +   GN + +
Sbjct  335  KIPTLKEFKVFRNKLNGSLPSEMGLHSTLEAFEVSQNLFTGNLPQHLCAKGNLFGV  390


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 48/96 (50%), Gaps = 0/96 (0%)
 Frame = +2

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G IP +  +   LE +DL+ N+L G+I    F +K L    L  N L G IP      
Sbjct  230  LIGEIPESFGNFQSLEHIDLAYNNLEGEIPSGLFWLKNLTYAYLYSNQLSGLIPATNKLS  289

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L  LD+S+N L G IP+  G    L  L+L  N L
Sbjct  290  NLIELDISNNKLTGKIPESFGELKQLEILNLFSNEL  325



>ref|XP_009151498.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 [Brassica rapa]
Length=317

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 104/200 (52%), Gaps = 30/200 (15%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            DER+ LL LK+  G P SL   WN+TSSPCDW  I+C + G+VT ISL   I+  + P +
Sbjct  25   DERSTLLTLKRGLGDPPSL-RLWNTTSSPCDWSEITCFA-GNVTGISLKNKIITATVPTN  82

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLS---------------------  487
               C   NL +++ SSN   G  P  L +C+KL  LDLS                     
Sbjct  83   T--CDFPNLETLDLSSNRFSGDFPTVLYNCTKLRHLDLSHNYFNGSLPADIDRLSPQLEF  140

Query  488  ----INDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSI  652
                 N  +G I  E  S+  L+S+ L  N L GE+P  ++++ SL +L +S N L+G+I
Sbjct  141  LNLGANAFSGDIPTELTSLSKLKSIFLDSNNLSGELPEEIISWKSLVTLSLSKNKLSGNI  200

Query  653  PDDIGNFYNLSYLDLSMNSL  712
            P  +G    L  LDLS N L
Sbjct  201  PRALGLLPRLVDLDLSENEL  220



>ref|XP_011464596.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X2 [Fragaria vesca subsp. vesca]
Length=981

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = +2

Query  263  STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIP  442
            + SSPC+W GISCN  GSVTRI+LS + + G+    + +    NL  +N S N L+ TIP
Sbjct  83   TKSSPCNWTGISCNKAGSVTRITLSNVHLQGTLQEFSFLA-FPNLAYVNLSMNKLFHTIP  141

Query  443  ANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESL  619
              +S  +KL +LDLS+N+L+G+I  E   +K L  L L  N L G IP  + +  SL  L
Sbjct  142  PEISHLTKLISLDLSLNNLSGRIPPEIGFLKNLTDLLLFRNNLSGSIPKEIGSLKSLVHL  201

Query  620  DVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            ++S+N L+GSIP   G+  NL   +LS N+L
Sbjct  202  ELSNNQLDGSIPTSFGDLTNLKTFNLSYNNL  232


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 73/123 (59%), Gaps = 5/123 (4%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + GS P    I  L +LV +  S+N L G+IP +    + L+T +LS N+L+G I  E  
Sbjct  184  LSGSIPKE--IGSLKSLVHLELSNNQLDGSIPTSFGDLTNLKTFNLSYNNLSGHIPKEIP  241

Query  527  SMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            +  +++ L LRGN L G IPT +    +L  L +  N L+G+IP++IGN  +L +L LS+
Sbjct  242  T--SIKILTLRGNQLDGSIPTSLGDLRNLTILYLRENQLSGTIPEEIGNLKSLVHLGLSV  299

Query  704  NSL  712
            N L
Sbjct  300  NQL  302


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 59/113 (52%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            +CQ  +L +++ + N   G +P  L +C+ L    L  N LTG I+ +F     L+ L L
Sbjct  359  LCQGGSLTNLSLNKNHFIGPVPKGLKNCTSLIRARLEENQLTGNISEDFGVYPNLKLLRL  418

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N  +GE+       S LE L ++ N+L G+IP +IG    L  L+LS N L
Sbjct  419  NDNNFYGEVSQNWGKCSDLEDLGMAGNNLTGTIPPEIGKATKLEELNLSSNRL  471


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            +L  +  + N+L GTIP  +   +KLE L+LS N L G I   F  + +L  L L  N L
Sbjct  436  DLEDLGMAGNNLTGTIPPEIGKATKLEELNLSSNRLVGIIPKIFARLSSLLRLRLNDNQL  495

Query  572  FGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP+   +   L+ LD+S+N  N SIP+ +G+   L YL+LS N  
Sbjct  496  SGRIPSEFGSLVKLDYLDLSANKFNDSIPEVLGDLLGLHYLNLSNNEF  543


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 54/109 (50%), Gaps = 3/109 (3%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  + N+ +G +  N   CS LE L ++ N+LTG I  E      L  LNL  N L
Sbjct  412  NLKLLRLNDNNFYGEVSQNWGKCSDLEDLGMAGNNLTGTIPPEIGKATKLEELNLSSNRL  471

Query  572  FGEIPTPMVAYSLESLDVSSND--LNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP  + A     L +  ND  L+G IP + G+   L YLDLS N  
Sbjct  472  VGIIPK-IFARLSSLLRLRLNDNQLSGRIPSEFGSLVKLDYLDLSANKF  519


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 66/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  ++L    + GS P S  +  L NL  +    N L GTIP  + +   L  L LS+N
Sbjct  243  SIKILTLRGNQLDGSIPTS--LGDLRNLTILYLRENQLSGTIPEEIGNLKSLVHLGLSVN  300

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIG  667
             L G +   F  +  L +LNLR N L G IP  +  +  +L  L + +N  +G +P ++ 
Sbjct  301  QLNGSVPISFGKLLNLETLNLRQNQLSGSIPQQLEKIITNLSQLHLDTNHFSGYLPQNLC  360

Query  668  NFYNLSYLDLSMN  706
               +L+ L L+ N
Sbjct  361  QGGSLTNLSLNKN  373


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = +2

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            ++  L  L  +N S+N     IP  L S   L TLD+S N LTG I  E  +M++L +LN
Sbjct  526  VLGDLLGLHYLNLSNNEFNQEIPPELGSLVHLSTLDVSYNSLTGNIPPEMSNMESLENLN  585

Query  554  LRGNMLFGEIP-TPMVAYSLESLDVSSNDLNGSIPD  658
            L  N L G IP T      L  +D+S+ND  G++P+
Sbjct  586  LSHNSLSGRIPITFNNMRGLSYVDISNNDFEGTLPN  621


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P    I +   L  +N SSN L G IP   +  S L  L L+ N L+G+I  EF 
Sbjct  447  LTGTIPPE--IGKATKLEELNLSSNRLVGIIPKIFARLSSLLRLRLNDNQLSGRIPSEFG  504

Query  527  SMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            S+  L  L+L  N     IP  +     L  L++S+N+ N  IP ++G+  +LS LD+S 
Sbjct  505  SLVKLDYLDLSANKFNDSIPEVLGDLLGLHYLNLSNNEFNQEIPPELGSLVHLSTLDVSY  564

Query  704  NSL  712
            NSL
Sbjct  565  NSL  567


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 51/99 (52%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N L G IP+   S  KL+ LDLS N     I      +  L  LNL  N    EIP  + 
Sbjct  493  NQLSGRIPSEFGSLVKLDYLDLSANKFNDSIPEVLGDLLGLHYLNLSNNEFNQEIPPELG  552

Query  599  A-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +   L +LDVS N L G+IP ++ N  +L  L+LS NSL
Sbjct  553  SLVHLSTLDVSYNSLTGNIPPEMSNMESLENLNLSHNSL  591



>ref|XP_009367420.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1021

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 103/173 (60%), Gaps = 6/173 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            +++ILL LK  WG P S+ + WN +SSPCDWP ++C +NG+VT +SL  M +    PA+ 
Sbjct  32   DQSILLKLKAQWGNPPSI-QSWNPSSSPCDWPEVNC-TNGAVTGLSLRNMNITKRIPAT-  88

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK-TLRSL  550
             +C+L +L  ++ S N + G  P+ L +CS L+ LDLS N   G I  +   M  +L+ L
Sbjct  89   -LCELLSLTELDLSWNYIPGGFPSFLYNCSNLKVLDLSQNYFVGPIPADIDRMSPSLKYL  147

Query  551  NLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L GN   G+IP  +   + L ++ +  N  +GS+P +IGN  NL   ++  N
Sbjct  148  DLGGNNFSGDIPAAIGRLTELRTIRLYMNLFDGSVPREIGNLSNLEIFEMPYN  200


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 75/137 (55%), Gaps = 3/137 (2%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSIN---FSSNSLWGTIPANLSSCSKLETLD  481
            G+++ + + EM   G   A+ I  +  NL ++     +  +L G IP + S  S L+ L+
Sbjct  187  GNLSNLEIFEMPYNGKLAAARIPTEFGNLKNLKNLWMTQTNLIGEIPESFSGLSSLKHLN  246

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDD  661
            L+ N+L GKI    F +K L  L L  N   GEIP  + A SL  +D++ N+L+GSIP D
Sbjct  247  LARNNLEGKIPAGLFLLKNLSELLLFYNKFSGEIPKAVEALSLSQIDLAMNNLSGSIPQD  306

Query  662  IGNFYNLSYLDLSMNSL  712
             G   NL+ L+L  N L
Sbjct  307  FGKLKNLTVLNLYSNRL  323


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 4/121 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PAS +     NL  +  S+N   G IP  +SS  ++     S N  +GKI  E  ++
Sbjct  445  GQLPASKLAW---NLSRLEISNNRFSGEIPVQVSSWERMVVFKASGNLFSGKIPVELTNL  501

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L +L L GN L G++P+ ++++ SL +L++S N L+G IP  IG+  +L YLDLS N 
Sbjct  502  SQLNTLLLDGNQLSGDLPSQIMSWESLNTLNLSGNTLSGYIPAAIGSLPDLLYLDLSGNQ  561

Query  710  L  712
             
Sbjct  562  F  562


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 57/110 (52%), Gaps = 3/110 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSIN---FSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            G+  +  I  +L NL  +N      N L G +P+ + S   L TL+LS N L+G I    
Sbjct  487  GNLFSGKIPVELTNLSQLNTLLLDGNQLSGDLPSQIMSWESLNTLNLSGNTLSGYIPAAI  546

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
             S+  L  L+L GN   GEIP    +  L SL++SSN L+G IPD   N 
Sbjct  547  GSLPDLLYLDLSGNQFTGEIPAEFGSLRLTSLNLSSNKLSGKIPDVFDNL  596


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 54/99 (55%), Gaps = 2/99 (2%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-  595
            N   G IP  + + S L  +DL++N+L+G I  +F  +K L  LNL  N L G IP  + 
Sbjct  274  NKFSGEIPKAVEALS-LSQIDLAMNNLSGSIPQDFGKLKNLTVLNLYSNRLTGGIPESLG  332

Query  596  VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +  ++    V  N LNGS+P ++G   ++   ++S N L
Sbjct  333  LIPAMREFRVFKNMLNGSLPPELGLHSDVEAFEVSENQL  371


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 49/91 (54%), Gaps = 1/91 (1%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  I+ + N+L G+IP +      L  L+L  N LTG I      +  +R   +  NML 
Sbjct  289  LSQIDLAMNNLSGSIPQDFGKLKNLTVLNLYSNRLTGGIPESLGLIPAMREFRVFKNMLN  348

Query  575  GEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
            G +P  +  +S +E+ +VS N L+GS+P+ +
Sbjct  349  GSLPPELGLHSDVEAFEVSENQLSGSLPEHL  379



>gb|KJB54766.1| hypothetical protein B456_009G048200 [Gossypium raimondii]
Length=1012

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 95/173 (55%), Gaps = 8/173 (5%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            ER +LL  KQ  G P    + WNS+SSPCDWP I+C +N SVT + L +  +    P++ 
Sbjct  28   ERDVLLNFKQQLGNP-PFLQSWNSSSSPCDWPEINCTAN-SVTEVHLRDKNITTPIPST-  84

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             IC L NL  ++ + N + G  PA L +CSKL+TLDLS N   G I  E   +  L  L+
Sbjct  85   -ICDLKNLTFLDLAFNYIPGEFPA-LYNCSKLQTLDLSQNYFVGPIPDEIDRLSALVYLD  142

Query  554  LRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +  N   G IP P +     L++L +     NG+ P +IGN  NL  L L+ N
Sbjct  143  VGANNFSGNIP-PSIGRLPELQTLYMYQTQFNGTFPKEIGNLSNLEVLGLAYN  194


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  +  +  +L G IP + ++ + L+ LDL+ N+L G I    FS+K L  + L  
Sbjct  207  QLTKLSFLWMTFTNLIGEIPESFNNLTNLQHLDLARNNLEGPIPSRLFSLKNLTHVYLFK  266

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP P+ A +L+ +D+S N L GSIP+D G    L +L L  N L
Sbjct  267  NKLSGEIPKPVEALNLKEIDLSMNTLTGSIPEDFGKLQYLDFLSLFSNRL  316


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ +S+    G  P +  +    NLV    S+N   G IP  ++  S L TL L  ND
Sbjct  448  LSRVEISDNKFSGEIPVT--VATWTNLVVFQVSNNLFSGKIPKEITYLSDLTTLLLDGND  505

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
             +G++  E  S ++L +L+   N L GEIP  + +  +L +LD+S N  +G IP  IGN 
Sbjct  506  FSGELPSEIISWRSLTTLDASNNKLSGEIPAAIGSLPNLLNLDLSENQFSGGIPPGIGNM  565

Query  674  YNLSYLDLSMNSL  712
              L+ L+LS N L
Sbjct  566  -RLTSLNLSSNQL  577


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 2/118 (2%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P  + +  L NL  +    N L G IP  + + + L+ +DLS+N LTG I  +F  ++ L
Sbjct  248  PIPSRLFSLKNLTHVYLFKNKLSGEIPKPVEALN-LKEIDLSMNTLTGSIPEDFGKLQYL  306

Query  542  RSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              L+L  N L GE+PT + +  +L    V  N+L G  P + G    L   ++S N  
Sbjct  307  DFLSLFSNRLTGELPTSIGLLPALRDFRVFHNNLTGIFPPEFGLHSKLEGFEVSENQF  364



>gb|KJB54767.1| hypothetical protein B456_009G048200 [Gossypium raimondii]
Length=975

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 95/173 (55%), Gaps = 8/173 (5%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            ER +LL  KQ  G P    + WNS+SSPCDWP I+C +N SVT + L +  +    P++ 
Sbjct  28   ERDVLLNFKQQLGNP-PFLQSWNSSSSPCDWPEINCTAN-SVTEVHLRDKNITTPIPST-  84

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             IC L NL  ++ + N + G  PA L +CSKL+TLDLS N   G I  E   +  L  L+
Sbjct  85   -ICDLKNLTFLDLAFNYIPGEFPA-LYNCSKLQTLDLSQNYFVGPIPDEIDRLSALVYLD  142

Query  554  LRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +  N   G IP P +     L++L +     NG+ P +IGN  NL  L L+ N
Sbjct  143  VGANNFSGNIP-PSIGRLPELQTLYMYQTQFNGTFPKEIGNLSNLEVLGLAYN  194


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  +  +  +L G IP + ++ + L+ LDL+ N+L G I    FS+K L  + L  
Sbjct  207  QLTKLSFLWMTFTNLIGEIPESFNNLTNLQHLDLARNNLEGPIPSRLFSLKNLTHVYLFK  266

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP P+ A +L+ +D+S N L GSIP+D G    L +L L  N L
Sbjct  267  NKLSGEIPKPVEALNLKEIDLSMNTLTGSIPEDFGKLQYLDFLSLFSNRL  316


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ +S+    G  P +  +    NLV    S+N   G IP  ++  S L TL L  ND
Sbjct  448  LSRVEISDNKFSGEIPVT--VATWTNLVVFQVSNNLFSGKIPKEITYLSDLTTLLLDGND  505

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
             +G++  E  S ++L +L+   N L GEIP  + +  +L +LD+S N  +G IP  IGN 
Sbjct  506  FSGELPSEIISWRSLTTLDASNNKLSGEIPAAIGSLPNLLNLDLSENQFSGGIPPGIGNM  565

Query  674  YNLSYLDLSMNSL  712
              L+ L+LS N L
Sbjct  566  -RLTSLNLSSNQL  577


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 2/118 (2%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P  + +  L NL  +    N L G IP  + + + L+ +DLS+N LTG I  +F  ++ L
Sbjct  248  PIPSRLFSLKNLTHVYLFKNKLSGEIPKPVEALN-LKEIDLSMNTLTGSIPEDFGKLQYL  306

Query  542  RSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              L+L  N L GE+PT + +  +L    V  N+L G  P + G    L   ++S N  
Sbjct  307  DFLSLFSNRLTGELPTSIGLLPALRDFRVFHNNLTGIFPPEFGLHSKLEGFEVSENQF  364



>ref|XP_003527853.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1021

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 102/184 (55%), Gaps = 7/184 (4%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSE  340
            +SQS  T    E+ +LL LK+  G P SL     S S+PCDW  I C+ NGSVTR+ LS 
Sbjct  28   FSQSENT----EQTVLLSLKRELGDPPSLRSWEPSPSAPCDWAEIRCD-NGSVTRLLLSR  82

Query  341  M-IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
              I   +   S+ IC L +L  ++ SSN + G  P  L +CS L  LDLS N L G+I  
Sbjct  83   KNITTNTKNLSSTICNLKHLFKLDLSSNFISGEFPTTLYNCSDLRHLDLSDNYLAGQIPA  142

Query  518  EFFSMKTLRSLNLRGNMLFGEI-PTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
            +   +KTL  LNL  N   GEI P+      L++L +  N+ NG+I  +IGN  NL  L 
Sbjct  143  DVDRLKTLTHLNLGSNYFSGEIMPSIGNLPELQTLLLYKNNFNGTIRGEIGNLSNLEILG  202

Query  695  LSMN  706
            L+ N
Sbjct  203  LAYN  206


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 73/133 (55%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LS   + GS P S  +  L  L  +    NSL G IP+       L  LD S N+
Sbjct  249  LERLDLSRNNLTGSIPRS--LFSLKKLKFLYLYYNSLSGVIPSPTMQGLNLTELDFSKNN  306

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG I GE  ++K+L +L+L  N L GEIPT + +  SLE   V +N L+G++P D+G  
Sbjct  307  LTGSIPGELGNLKSLVTLHLYSNYLSGEIPTSLSLLPSLEYFRVFNNGLSGTLPPDLGLH  366

Query  674  YNLSYLDLSMNSL  712
              +  +++S N L
Sbjct  367  SRIVAVEVSENHL  379


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 71/138 (51%), Gaps = 4/138 (3%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSC-SKLETLD  481
            SN  +  ++ +  + G   P      +L  L  +  +  +L G IP    +  + LE LD
Sbjct  196  SNLEILGLAYNPKLKGAKIPLE--FAKLRKLRIMWMTQCNLIGEIPEYFGNILTNLERLD  253

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPD  658
            LS N+LTG I    FS+K L+ L L  N L G IP+P M   +L  LD S N+L GSIP 
Sbjct  254  LSRNNLTGSIPRSLFSLKKLKFLYLYYNSLSGVIPSPTMQGLNLTELDFSKNNLTGSIPG  313

Query  659  DIGNFYNLSYLDLSMNSL  712
            ++GN  +L  L L  N L
Sbjct  314  ELGNLKSLVTLHLYSNYL  331


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            N   I  ++N   G I   ++S + L   D   N L+G+I  E   +  L +L L GN L
Sbjct  462  NTKRIEIANNKFSGRISIGITSAANLVYFDARNNMLSGEIPRELTHLSQLSTLMLDGNQL  521

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G +P+ ++++ SL ++ +S N L+G IP  +    +L+YLDLS N +
Sbjct  522  SGALPSEIISWKSLSTMTLSRNKLSGKIPIAMTALPSLAYLDLSQNDI  569


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G  P    +  L+ L ++    N L G +P+ + S   L T+ LS N L+GKI    
Sbjct  496  MLSGEIPRE--LTHLSQLSTLMLDGNQLSGALPSEIISWKSLSTMTLSRNKLSGKIPIAM  553

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
             ++ +L  L+L  N + GEIP          L++SSN + G I D+  N
Sbjct  554  TALPSLAYLDLSQNDISGEIPPQFDRLRFVFLNLSSNQIYGKISDEFNN  602



>ref|XP_006367833.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Solanum tuberosum]
Length=409

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 106/188 (56%), Gaps = 5/188 (3%)
 Frame = +2

Query  158  NYSQSLTTYGEDERAILLILKQHWGYPFS-LFEQWNSTSSPCDWPGISCNS-NGSVTRIS  331
            +Y  + T    D+ A+L +  Q    PF  L E W+   + C W G++C S +  V  ++
Sbjct  43   HYVMTQTNITTDQLALLSLKSQISSDPFHYLNESWSPAINVCRWVGVTCGSRHQRVKSLN  102

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            LS+M + G+ P    +  L  L+S++  SN+  G +P  ++  S+L+ LDLS N   G+I
Sbjct  103  LSDMTLTGTIPRD--LGNLTFLISLDLGSNNFHGNLPQEIARLSRLKFLDLSFNKFRGEI  160

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
               F  ++ L+ LNLR N   G IP  +  A  LE+L++S+N L G+IP++IGN +NL+ 
Sbjct  161  PSWFGFLERLQVLNLRSNSFTGFIPPSLSNASRLETLEISANLLEGNIPEEIGNLHNLNL  220

Query  689  LDLSMNSL  712
            L +  N L
Sbjct  221  LSIQHNKL  228


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 58/129 (45%), Gaps = 25/129 (19%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  +  S N L G +P +LS+CS+L+ L LS ND  G I  E   +  L+ L L  N   
Sbjct  267  LKELRLSVNKLHGHMPKSLSNCSQLQKLSLSGNDFDGPIHSEIGRLSNLQILYLGANHFT  326

Query  575  GEIPT----------------------PMVAYSLESLDVSS---NDLNGSIPDDIGNFYN  679
            G IP                       P+  +++ SL   S   N+L GS+P +IGN   
Sbjct  327  GIIPQEIGNLVNLMKLAVEINQITSSIPISIFNISSLQEVSLWKNNLKGSLPREIGNLTK  386

Query  680  LSYLDLSMN  706
            + +L L  N
Sbjct  387  MQFLYLEEN  395



>ref|XP_003603644.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES73895.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1033

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 105/184 (57%), Gaps = 11/184 (6%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISL-S  337
            SQ+ TT    E+ ILL LK+    P SL E W  S SSPC+WP I+C + G+VT + L +
Sbjct  29   SQTTTT----EQTILLNLKRQLNNPPSL-ESWKPSLSSPCNWPEINC-TGGTVTELLLLN  82

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
            + I     P+  IIC L NL+ ++ S+NS+ G  P  L +CS L  LDLS N   G+I  
Sbjct  83   KNITTQKLPS--IICNLKNLIKLDLSNNSIAGDFPTWLQNCSNLRYLDLSQNYFAGQIPN  140

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
            +   +K+L   NL GN   G+IP  +     L++L +  N+ NG+ P +IG+  NL  L 
Sbjct  141  DISKLKSLTYFNLGGNSFTGDIPAAIGKLQILQTLHLFQNNFNGTFPKEIGDLSNLEILG  200

Query  695  LSMN  706
            L+ N
Sbjct  201  LAYN  204


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 67/116 (58%), Gaps = 3/116 (3%)
 Frame = +2

Query  374  IICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
            I  +  NL S+ F   S  +L G IP +  + + LE LDLS+N+LTG I     S+K L 
Sbjct  212  IPIEFGNLKSLKFMWISQCNLIGNIPESFENLTNLEQLDLSMNNLTGNIPTNLLSLKNLN  271

Query  545  SLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            SL L  N LFG IP  + A +L  +D++ N+L G+IP++ G   NL +L L  N L
Sbjct  272  SLFLFRNRLFGVIPNSVQALNLTHIDLAMNNLTGAIPEEFGKLQNLMFLHLYSNQL  327


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-  595
            N L+G IP ++ + + L  +DL++N+LTG I  EF  ++ L  L+L  N L GEIP  + 
Sbjct  278  NRLFGVIPNSVQALN-LTHIDLAMNNLTGAIPEEFGKLQNLMFLHLYSNQLSGEIPRSLG  336

Query  596  VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +  +L +  V  N LNG++P ++G +  L   ++S N L
Sbjct  337  LIPNLRNFRVFDNKLNGTLPSELGRYSKLVAFEVSENQL  375


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N L GT+P+ + S   L TL +S N ++G+I     S+  L  L+L  N + GEIP  +V
Sbjct  515  NQLSGTLPSEIISWQSLNTLTISRNKISGQIPIAMSSLPNLVYLDLSENNITGEIPAQLV  574

Query  599  AYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
                  L++SSN L G+IPDD   F NL+Y
Sbjct  575  KLKFIFLNLSSNKLTGNIPDD---FDNLAY  601



>ref|XP_003523755.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1011

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 100/183 (55%), Gaps = 5/183 (3%)
 Frame = +2

Query  167  QSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLS-EM  343
            Q ++     E+ ILL LK   G P SL     S S+PCDW  I C + GSVTR+ LS + 
Sbjct  26   QVISQSENTEQTILLTLKHELGDPPSLRSWIPSPSAPCDWAEIRC-AGGSVTRLLLSGKN  84

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            I   +   S+ IC L +L  ++FS N +    P  L +C+ L  LDLS N+L G I  + 
Sbjct  85   ITTTTKNLSSTICNLKHLFKLDFSGNFISDEFPTTLYNCTNLRHLDLSDNNLAGPIPADV  144

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
              ++TL  LNL  N   GEIP P +     L++L +  N+ NG+IP +IGN  NL  L L
Sbjct  145  DRLETLAYLNLGSNYFSGEIP-PAIGNLPELQTLLLYKNNFNGTIPREIGNLSNLEILGL  203

Query  698  SMN  706
            + N
Sbjct  204  AYN  206


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = +2

Query  425  LWGTIPANLSSC-SKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP-MV  598
            L G IP    +  + LE LDLS N+LTG I    FS++ L+ L L  N L G IP+P M 
Sbjct  234  LMGEIPEYFGNILTNLERLDLSRNNLTGSIPRSLFSLRKLKFLYLYYNRLSGVIPSPTMQ  293

Query  599  AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              +L  LD  +N L GSIP +IGN  +L  L L  N L
Sbjct  294  GLNLTELDFGNNILTGSIPREIGNLKSLVTLHLYSNHL  331


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 70/133 (53%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LS   + GS P S  +  L  L  +    N L G IP+       L  LD   N 
Sbjct  249  LERLDLSRNNLTGSIPRS--LFSLRKLKFLYLYYNRLSGVIPSPTMQGLNLTELDFGNNI  306

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG I  E  ++K+L +L+L  N L+GEIPT + +  SLE   V +N L+G++P ++G  
Sbjct  307  LTGSIPREIGNLKSLVTLHLYSNHLYGEIPTSLSLLPSLEYFRVFNNSLSGTLPPELGLH  366

Query  674  YNLSYLDLSMNSL  712
              L  +++S N L
Sbjct  367  SRLVVIEVSENHL  379


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 65/142 (46%), Gaps = 26/142 (18%)
 Frame = +2

Query  320  TRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDL  499
            TRI ++     G  P S  I    NLV  +  +N L G IP  L+  S+L TL L  N L
Sbjct  464  TRIEIANNKFSG--PVSVGITSATNLVYFDARNNMLSGEIPRELTCLSRLSTLMLDGNQL  521

Query  500  TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSND-------------  637
            +G +  E  S K+L ++ L GN L G+IP  M V  SL  LD+S ND             
Sbjct  522  SGALPSEIISWKSLSTITLSGNKLSGKIPIAMTVLPSLAYLDLSQNDISGEIPPQFDRMR  581

Query  638  ----------LNGSIPDDIGNF  673
                      L+G IPD+  N 
Sbjct  582  FVFLNLSSNQLSGKIPDEFNNL  603


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 63/121 (52%), Gaps = 5/121 (4%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P+   +    N   I  ++N   G +   ++S + L   D   N L+G+I  E   +
Sbjct  453  GPLPSKVFL----NTTRIEIANNKFSGPVSVGITSATNLVYFDARNNMLSGEIPRELTCL  508

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L +L L GN L G +P+ ++++ SL ++ +S N L+G IP  +    +L+YLDLS N 
Sbjct  509  SRLSTLMLDGNQLSGALPSEIISWKSLSTITLSGNKLSGKIPIAMTVLPSLAYLDLSQND  568

Query  710  L  712
            +
Sbjct  569  I  569



>ref|XP_010245908.1| PREDICTED: receptor-like protein kinase 2 [Nelumbo nucifera]
Length=571

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 97/175 (55%), Gaps = 5/175 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            E E+ ILL +KQ W  P      WNS++S C W GISC   G +T ISL  M + G+ P 
Sbjct  35   EKEQEILLKMKQEWRNP-PSLSSWNSSTSHCSWTGISC-VQGFITHISLFNMSITGAIPL  92

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
               I  L NL  I+FS N + G  PA L SCSKL+ LDLS N   G I  +  S+  L  
Sbjct  93   P--IANLRNLTYIDFSYNYMTGEFPAVLYSCSKLQYLDLSHNRFAGVIPDDIQSLSGLMF  150

Query  548  LNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            LNL  N   G+IP  +    +L++L + SN  NG+ P +IGN YNL  L LS N 
Sbjct  151  LNLGFNNFSGQIPVGIGRLVALQALYLDSNKFNGTFPVEIGNLYNLEELYLSHNE  205


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 71/129 (55%), Gaps = 2/129 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LSE  + G+ P + ++  L  L  +    N L G IP ++ + ++L TLDLS N L G
Sbjct  441  LDLSENNLNGTIPTNLVM--LKKLEILILHQNILSGEIPQSIDNLTELNTLDLSHNKLNG  498

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
             I    F +K L++L+L  N L GEIP  + A +L  + + +N+L G+IP+D G    L 
Sbjct  499  TIPRNLFKLKNLQNLHLAENSLSGEIPRQVEALNLIRIYLYNNNLTGTIPEDFGRLNKLE  558

Query  686  YLDLSMNSL  712
             L L  N L
Sbjct  559  ILSLHSNQL  567


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ++LS+  + G  P++  + +L NL  ++  +N L G IP  + + ++L  LDL  N L+G
Sbjct  345  LTLSKNKLNGMIPSN--LFELKNLQLLSLHTNRLAGEIPQTVGNATELLGLDLRHNKLSG  402

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNL  682
             I+G  F +K L+ L L  N L GEIP  +     L+ LD+S N+LNG+IP ++     L
Sbjct  403  TISGNLFQLKKLQELYLSNNRLSGEIPQSIGGVMELKILDLSENNLNGTIPTNLVMLKKL  462

Query  683  SYLDLSMNSL  712
              L L  N L
Sbjct  463  EILILHQNIL  472


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            + QL  L  +  S+N L G IP ++    +L+ LDLS N+L G I      +K L  L L
Sbjct  408  LFQLKKLQELYLSNNRLSGEIPQSIGGVMELKILDLSENNLNGTIPTNLVMLKKLEILIL  467

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N+L GEIP  +   + L +LD+S N LNG+IP ++    NL  L L+ NSL
Sbjct  468  HQNILSGEIPQSIDNLTELNTLDLSHNKLNGTIPRNLFKLKNLQNLHLAENSL  520



>ref|XP_007013026.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
 gb|EOY30645.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
Length=1006

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 103/180 (57%), Gaps = 8/180 (4%)
 Frame = +2

Query  182  YGEDERAILLILKQHWGYPFSLFEQW---NSTSSPCDWPGISCNSNGSVTRISLSEMIMG  352
            + E E+A+LL LK +W  P S F  W   +++SS C WP I+C  N SVT ++L+   + 
Sbjct  31   HDESEQALLLKLKTYWQNPPS-FNHWAPSSNSSSHCSWPEITC-LNDSVTGLTLANKGIN  88

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
             + P    IC L NL SI+ + N+L G  P  L +CSKLE LDLS N   G I  +  S+
Sbjct  89   EAIPP--FICDLKNLTSIDLNYNNLVGEFPKTLYNCSKLEYLDLSQNYFVGTIPDDIDSL  146

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L+SLNL GN   G+IP  +     L SL + SN  NGS P +IGN   L +L L+ N+
Sbjct  147  GQLQSLNLMGNNFSGQIPVAIGRLQDLRSLLLCSNQFNGSFPPEIGNLSKLEFLGLAYNT  206


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 61/110 (55%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L ++  +  SL G IP  +   + LE LDLS N+LTG I    F +K L  + L  
Sbjct  219  QLKKLKTLWMTEASLVGEIPDMIGDMTALEVLDLSSNNLTGNIPSALFLLKNLEGVYLFD  278

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L GEIP  + A +L  +D+S N+L G IP DIG   NLS L L  N L
Sbjct  279  SKLSGEIPQVIKASNLRVIDLSQNNLTGRIPSDIGKLENLSGLVLFFNQL  328


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 69/130 (53%), Gaps = 4/130 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + G+ P++  +  L NL  +    + L G IP  + + S L  +DLS N+LTG
Sbjct  250  LDLSSNNLTGNIPSALFL--LKNLEGVYLFDSKLSGEIPQVIKA-SNLRVIDLSQNNLTG  306

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            +I  +   ++ L  L L  N L GEIP  +   S L  + + SN+L G++P D G +  L
Sbjct  307  RIPSDIGKLENLSGLVLFFNQLSGEIPESIGRISTLTDVRLFSNNLWGTLPPDFGRYSML  366

Query  683  SYLDLSMNSL  712
             Y +++ N L
Sbjct  367  EYFEVASNRL  376


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 70/133 (53%), Gaps = 2/133 (2%)
 Frame = +2

Query  320  TRISLSEMIMGGSFPASAIICQL-NNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            T ++LS +++  +F    +  ++ +NL  +  S+N  +G IP  ++S   L     S N 
Sbjct  434  TSLNLSMLMISDNFFTGELPKKVSHNLSRLEISNNKFFGQIPVEVNSWRSLVVFKASNNL  493

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
                I     ++  L +L L  N L G +P+P++++ SL +L++  N L+G IP+DI   
Sbjct  494  FNSTIPKALTALPFLTTLLLDQNQLHGFLPSPIISWRSLVTLNLGQNQLSGQIPEDICVL  553

Query  674  YNLSYLDLSMNSL  712
             +L  LDLS N  
Sbjct  554  PSLLELDLSKNQF  566


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 3/121 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P S  I +++ L  +   SN+LWGT+P +    S LE  +++ N LTG++     
Sbjct  328  LSGEIPES--IGRISTLTDVRLFSNNLWGTLPPDFGRYSMLEYFEVASNRLTGRLPEHLC  385

Query  527  SMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
                L  L    N L GE+P  +    SL  +++ +N L GSIP  +    NLS L +S 
Sbjct  386  HGGKLLGLVAFDNNLAGELPKSLGNCNSLIMVNIRNNGLTGSIPSGLWTSLNLSMLMISD  445

Query  704  N  706
            N
Sbjct  446  N  446



>ref|XP_002983532.1| hypothetical protein SELMODRAFT_445533 [Selaginella moellendorffii]
 gb|EFJ15433.1| hypothetical protein SELMODRAFT_445533 [Selaginella moellendorffii]
Length=1469

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 4/154 (3%)
 Frame = +2

Query  257  WN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWG  433
            W+ S++S C+W GI+CN  G V  ++L  + + G   +S  +  L  L  +N SSN L G
Sbjct  59   WDVSSTSLCNWTGIACNPQGRVVSLALYNIPLKGQISSS--LGSLEFLELLNLSSNYLSG  116

Query  434  TIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-L  610
             IP+ L +C++L++LDL+ N+L GKI      +  L+SL L GN+L GEIP+ +  YS L
Sbjct  117  GIPSTLGNCTRLQSLDLTFNNLNGKIPESLGQLSMLQSLFLDGNLLGGEIPSSLARYSRL  176

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            E L    N L+G +P  +G   NL+ LDLS NSL
Sbjct  177  EKLSCCCNRLSGQLPSFLGQLRNLTLLDLSYNSL  210


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIP--ANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLR  559
            + NL +++ + N+LWG++P   NL+S SKL   DLS N LTG I     +  +L +L+L 
Sbjct  443  MANLGTLDLARNNLWGSLPQACNLASISKL---DLSFNSLTGSIPSCLGNSSSLWTLDLS  499

Query  560  GNMLFGEIPTPMVAYS--LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            GN + GEIP+ + A +  L  LD+S N L GS+P  +GN  +LS L ++ N L
Sbjct  500  GNQISGEIPSSLGANASQLYYLDLSQNLLVGSLPASLGNCSSLSILMVARNQL  552


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 25/156 (16%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            VT++ LS   + G  P S +   L+ L + + + N+L G IP +L  C K+  +D+ +N+
Sbjct  349  VTKLDLSRNRLTGVIP-SELGRNLSALTNFDVAFNTLDGEIPVSLPLCIKMSRIDMGVNN  407

Query  497  LTGK------------------------IAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
             TG+                        I  E+F+M  L +L+L  N L+G +P      
Sbjct  408  FTGQLLPEISKLELLSNFFISTNRLVGTIPLEYFNMANLGTLDLARNNLWGSLPQACNLA  467

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            S+  LD+S N L GSIP  +GN  +L  LDLS N +
Sbjct  468  SISKLDLSFNSLTGSIPSCLGNSSSLWTLDLSGNQI  503


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 75/162 (46%), Gaps = 32/162 (20%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPA----------------N  448
            +T + LS   + GS P       L++L  +N   N L G IP                 N
Sbjct  200  LTLLDLSYNSLNGSIPRG--FANLSSLEELNLEGNDLEGEIPTFLLVSKSLVGLHLHANN  257

Query  449  LSSCS-------------KLETLDLSINDLTGKIAGEFFS-MKTLRSLNLRGNMLFGEIP  586
            L S S             ++E L+L  N +TG I  +FFS +  L+ ++LR N L G IP
Sbjct  258  LESFSSEFQEISPENNQGRMEVLELGYNQITGSIPSQFFSYLPALKFISLRNNNLTGGIP  317

Query  587  TPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                   LE++ +S+N+L G IP+ + +   ++ LDLS N L
Sbjct  318  EFGDHCVLETIILSTNNLTGEIPESVLHCSQVTKLDLSRNRL  359


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++GG  P+S  + + + L  ++   N L G +P+ L     L  LDLS N L G I   F
Sbjct  161  LLGGEIPSS--LARYSRLEKLSCCCNRLSGQLPSFLGQLRNLTLLDLSYNSLNGSIPRGF  218

Query  524  FSMKTLRSLNLRGNMLFGEIPT-PMVAYSLESLDVSSNDL  640
             ++ +L  LNL GN L GEIPT  +V+ SL  L + +N+L
Sbjct  219  ANLSSLEELNLEGNDLEGEIPTFLLVSKSLVGLHLHANNL  258


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS-  529
            GS P +   C L ++  ++ S NSL G+IP+ L + S L TLDLS N ++G+I     + 
Sbjct  458  GSLPQA---CNLASISKLDLSFNSLTGSIPSCLGNSSSLWTLDLSGNQISGEIPSSLGAN  514

Query  530  MKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
               L  L+L  N+L G +P  +    SL  L V+ N L G I  D    ++L +LDLS N
Sbjct  515  ASQLYYLDLSQNLLVGSLPASLGNCSSLSILMVARNQL-GKIDMDFSQIHSLVHLDLSHN  573


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 71/155 (46%), Gaps = 29/155 (19%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ISL    + G  P     C L  ++    S+N+L G IP ++  CS++  LDLS N LTG
Sbjct  305  ISLRNNNLTGGIPEFGDHCVLETII---LSTNNLTGEIPESVLHCSQVTKLDLSRNRLTG  361

Query  506  KIAGEF-FSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLD-------------------  622
             I  E   ++  L + ++  N L GEIP  + +   +  +D                   
Sbjct  362  VIPSELGRNLSALTNFDVAFNTLDGEIPVSLPLCIKMSRIDMGVNNFTGQLLPEISKLEL  421

Query  623  -----VSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                 +S+N L G+IP +  N  NL  LDL+ N+L
Sbjct  422  LSNFFISTNRLVGTIPLEYFNMANLGTLDLARNNL  456



>gb|KHG24857.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=1012

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 94/172 (55%), Gaps = 6/172 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            ER +LL  KQ  G P    + WNS+SSPCDWP I+C +N SVT + L +  +    P++ 
Sbjct  28   ERDVLLNFKQRLGNP-PFLQSWNSSSSPCDWPEINCTAN-SVTEVHLHDKNITTPIPST-  84

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             IC L NL  ++ + N + G  PA L +CSKL+TLDLS N   G I  E   +  L  L+
Sbjct  85   -ICDLKNLTLLDLAFNYIPGEFPA-LYNCSKLQTLDLSQNYFVGPIPDEIDRLSALVYLD  142

Query  554  LRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +  N   G IP  +     L++L +     NG+ P +IGN  NL  L L+ N
Sbjct  143  VGANNFSGNIPASIGRLPELQTLYMYQTQFNGTFPKEIGNLSNLEVLGLAYN  194


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  +  +  +L G IP + ++ + L+ LDL+ N+L G I    FS+K L  + L  
Sbjct  207  QLTKLSFLWMTFTNLIGEIPKSFNNLTNLQHLDLARNNLEGPIPSRLFSLKNLTHVYLFK  266

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP P+ A +L+ +D+S N L GSIP+D G    L +L L  N L
Sbjct  267  NKLSGEIPKPVEALNLKEIDLSMNTLTGSIPEDFGKLQYLDFLSLFSNRL  316


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 2/118 (2%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P  + +  L NL  +    N L G IP  + + + L+ +DLS+N LTG I  +F  ++ L
Sbjct  248  PIPSRLFSLKNLTHVYLFKNKLSGEIPKPVEALN-LKEIDLSMNTLTGSIPEDFGKLQYL  306

Query  542  RSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              L+L  N L GE+PT + +  +L    V  N+L G  P + G    L   ++S N  
Sbjct  307  DFLSLFSNRLTGELPTSIGLLPALRDFRVFHNNLTGIFPPEFGLHSKLEGFEVSENQF  364


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ +S+    G  P +  I    NLV    S+N   G +   ++  S L TL L  ND
Sbjct  448  LSRVEISDNKFSGEIPVT--IATWTNLVVFQASNNLFSGKMAKEITYLSDLTTLLLDGND  505

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
             +G++  E  S ++L +L++  N L GEIP  + +  +L +LD+S N  +G IP  +G+ 
Sbjct  506  FSGELPSEIISWRSLTTLDVSNNKLSGEIPAAIGSLPNLLNLDLSENQFSGGIPPGVGDM  565

Query  674  YNLSYLDLSMNSL  712
              L+ L+LS N L
Sbjct  566  -RLTSLNLSSNQL  577



>ref|XP_007012181.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
 gb|EOY29800.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
Length=1017

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 96/173 (55%), Gaps = 7/173 (4%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            ER +LL LK+  G P SL   WNS+SSPCDW  I C +N SVT + L ++ +    P + 
Sbjct  28   ERTVLLNLKRQLGNPPSL-GHWNSSSSPCDWQEIGC-TNNSVTAVILRKIPITVRIPPT-  84

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             IC L NL+ ++ S N + G  P  L +CSKL+ LD+S N   G I  +   + TL  L+
Sbjct  85   -ICDLKNLIGLDLSFNMIPGEFPTTLYNCSKLKYLDISQNLFVGPIPDDIDRLSTLTYLD  143

Query  554  LRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +  N   G IP P +     L++L++  N  NG+ P +IG+  NL  L  + N
Sbjct  144  ICANNFSGNIP-PSIGRLPELQTLNIHQNQFNGTFPKEIGDLSNLEALRTAYN  195


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  +    N+L G IP + ++ S L   DLS+N+L G +  +    K L +L L  
Sbjct  208  QLRKLQYLWMVRNNLIGEIPESFNNLSSLVHFDLSVNNLEGPMPSKLLLFKNLTNLYLFH  267

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP P+ A +L  +D+S N+L GSIP+D G   +L +L+L+ N L
Sbjct  268  NKLSGEIPKPIEALNLVEVDLSMNNLTGSIPEDFGKLQSLVFLNLNTNQL  317


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 78/133 (59%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ +S+    G  P +  +   +NLV    S+N   G IP  +++ S+L TL L  ND
Sbjct  449  MSRLEISDNKFSGEIPTA--VASWSNLVVFKASNNLFSGKIPKEITNLSRLNTLSLDDND  506

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
             +G++  E  S ++L +LN+  N L G+IP  + +   L +LD+S N L+G IP +IGN 
Sbjct  507  FSGELPSEIISWRSLVTLNVSNNKLSGKIPAAIGSLPDLINLDLSENQLSGEIPLEIGNL  566

Query  674  YNLSYLDLSMNSL  712
              L++L+LS N L
Sbjct  567  -KLTFLNLSSNQL  578


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            +  G  P    I  L+ L +++   N   G +P+ + S   L TL++S N L+GKI    
Sbjct  482  LFSGKIPKE--ITNLSRLNTLSLDDNDFSGELPSEIISWRSLVTLNVSNNKLSGKIPAAI  539

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
             S+  L +L+L  N L GEIP  +    L  L++SSN L G IP+ + N  Y  S+LD
Sbjct  540  GSLPDLINLDLSENQLSGEIPLEIGNLKLTFLNLSSNQLTGKIPNQLDNPAYENSFLD  597


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 72/140 (51%), Gaps = 4/140 (3%)
 Frame = +2

Query  296  SCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLET  475
            S N+  S+    LS   + G  P+  ++    NL ++    N L G IP  + + + +E 
Sbjct  229  SFNNLSSLVHFDLSVNNLEGPMPSKLLL--FKNLTNLYLFHNKLSGEIPKPIEALNLVE-  285

Query  476  LDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSI  652
            +DLS+N+LTG I  +F  +++L  LNL  N L GE+PT + +  +L    V  N L G +
Sbjct  286  VDLSMNNLTGSIPEDFGKLQSLVFLNLNTNQLTGELPTSIGLLPNLTDFRVFKNKLTGFL  345

Query  653  PDDIGNFYNLSYLDLSMNSL  712
            P + G    L   ++S N +
Sbjct  346  PPEFGLHSKLEGFEVSQNQI  365


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 57/108 (53%), Gaps = 3/108 (3%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
             L     S N + G +P NL +   L+ +    N+L+G++     +  TLR+  L+ N  
Sbjct  354  KLEGFEVSQNQISGPLPENLCAAGVLQGVVAHTNNLSGQVPKSLGNCPTLRTFQLQNNKF  413

Query  572  FGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GEIP  +   ++L SL +S+N  +G +P D+   +N+S L++S N  
Sbjct  414  SGEIPRGLWTTFNLSSLMLSNNSFSGELPSDLA--WNMSRLEISDNKF  459


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SL +    G  P+   I    +LV++N S+N L G IPA + S   L  LDLS N L+G
Sbjct  500  LSLDDNDFSGELPSE--IISWRSLVTLNVSNNKLSGKIPAAIGSLPDLINLDLSENQLSG  557

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
            +I  E  ++K L  LNL  N L G+IP  +   + E+  + + DL   +P
Sbjct  558  EIPLEIGNLK-LTFLNLSSNQLTGKIPNQLDNPAYENSFLDNADLCADVP  606



>ref|XP_010249486.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=1034

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 100/180 (56%), Gaps = 7/180 (4%)
 Frame = +2

Query  170  SLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIM  349
            S TTY  DE++ILL LKQ W     + + W S+   C+W GI+C+ NGSVT IS     +
Sbjct  31   SQTTY--DEQSILLKLKQDWKNQPPM-DSWKSSLPFCNWTGITCD-NGSVTGISFGNWNI  86

Query  350  GGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
             G  P   IIC L+NL  ++ + N + G  P  L +CSKL  LDLS N   G+I  +   
Sbjct  87   NGPIPP--IICNLSNLNHLDLTLNYITGEFPTFLYNCSKLVYLDLSQNYFVGRIPDDIHR  144

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +  L  LNL  N   G+IP  +   S L++L +  N  NG+ P +IG+  NL +L ++ N
Sbjct  145  LSRLTYLNLEANNFTGDIPAAIGRLSELKTLSLVQNLFNGTFPPEIGDLSNLEFLQMAYN  204


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 73/136 (54%), Gaps = 2/136 (1%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAII--CQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            G ++ +   +M   G  P+   +   +L  L  +  +S +L G IP ++ + ++L+ LDL
Sbjct  191  GDLSNLEFLQMAYNGFLPSRLPVQFGRLKKLTLLWMASTNLIGEIPESIGNITELQHLDL  250

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDI  664
            S+N++ G I G  F +  L++L L  N   GEIP  +   SL +LD+S N L G IP+D 
Sbjct  251  SVNNMNGSIPGSVFLLNKLKNLYLYNNKFSGEIPRRIECLSLNNLDISINKLTGPIPEDF  310

Query  665  GNFYNLSYLDLSMNSL  712
            G    L YL +  N L
Sbjct  311  GKLNKLQYLFMYYNRL  326


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 69/148 (47%), Gaps = 29/148 (20%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +TR+ +S     G  P+   I    NLV    S+N   G IP NL++ S L  L L  N 
Sbjct  458  LTRLEISYNRFSGEIPS--YIAFSTNLVVFLASNNQFSGKIPTNLTALSHLTILKLDGNR  515

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIP------------------------TPMVAY  604
            L+G++  +  S K+L SLNL  N L G+IP                        + + + 
Sbjct  516  LSGELPSDIVSWKSLTSLNLSRNQLSGDIPRAIGLLPNLIDLDLSENQLSGDIPSEIGSL  575

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSY  688
             L  L++SSN L G IPD+   F N++Y
Sbjct  576  RLTFLNLSSNQLTGMIPDE---FENMAY  600


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 78/183 (43%), Gaps = 49/183 (27%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            + G +T +SL    + G   AS   C  N+L  I   +N   G  PANL S   L TL +
Sbjct  384  AGGVLTGVSLFSNHLSGEVSASLGNC--NSLTDIQLYNNGFSGEFPANLWSSINLTTLMI  441

Query  485  SINDLTGKI------------------AGEF-------------------FSMKT-----  538
            S N  +GK+                  +GE                    FS K      
Sbjct  442  SNNSFSGKLPSKLAWNLTRLEISYNRFSGEIPSYIAFSTNLVVFLASNNQFSGKIPTNLT  501

Query  539  ----LRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
                L  L L GN L GE+P+ +V++ SL SL++S N L+G IP  IG   NL  LDLS 
Sbjct  502  ALSHLTILKLDGNRLSGELPSDIVSWKSLTSLNLSRNQLSGDIPRAIGLLPNLIDLDLSE  561

Query  704  NSL  712
            N L
Sbjct  562  NQL  564


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 52/95 (55%), Gaps = 2/95 (2%)
 Frame = +2

Query  431  GTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-S  607
            G IP  +  C  L  LD+SIN LTG I  +F  +  L+ L +  N L GEIP  +    +
Sbjct  281  GEIPRRIE-CLSLNNLDISINKLTGPIPEDFGKLNKLQYLFMYYNRLSGEIPASIGRLPA  339

Query  608  LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+ + + +N+  G +P D+G +  L  L++S N L
Sbjct  340  LKDIRLFNNNFTGVLPPDLGLYSKLISLEVSNNRL  374



>emb|CDX88207.1| BnaA06g27980D [Brassica napus]
Length=348

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 104/200 (52%), Gaps = 30/200 (15%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            DER+ LL LK+  G P SL   WN+TSSPCDW  I+C + G+VT ISL   I+  + P +
Sbjct  25   DERSTLLTLKRGLGDPPSL-RLWNTTSSPCDWSEITCFA-GNVTGISLKNKIISATVPTN  82

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLS---------------------  487
              IC    L +++ SSN   G  P  L +C+KL  LDLS                     
Sbjct  83   --ICDFPKLETLDLSSNRFSGDFPTVLYNCTKLGHLDLSHNYFNGSLPADIDRLSPQLEF  140

Query  488  ----INDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSI  652
                 N  +G I  E  S+  L+S+ L  N L GE+P  ++++ SL +L +S N L+G+I
Sbjct  141  LNLGANAFSGDIPTELTSLSKLKSIFLYSNNLSGELPEEIISWKSLVTLSLSKNKLSGNI  200

Query  653  PDDIGNFYNLSYLDLSMNSL  712
            P  +G    L  LDLS N L
Sbjct  201  PRALGLLPRLVDLDLSENEL  220



>ref|XP_004501091.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1030

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 99/183 (54%), Gaps = 5/183 (3%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISL-SE  340
            S+ ++     E  ILL LK+  G P SL     S SSPC+WP I C    +VT + L SE
Sbjct  25   SKVISQTTNSEETILLTLKRQLGNPPSLQSWKPSPSSPCNWPEIRC-IGSTVTELLLPSE  83

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
             I     P++  IC L NL  ++ S+NS+ G  P  L +C+ L  LDLS N   G+I  +
Sbjct  84   NITTQKLPST--ICDLKNLTKLDLSNNSIAGEFPTWLYNCTNLRYLDLSQNYFAGEIPND  141

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
               +KTL  LNL GN   G+IP      + L++L +  N+ NG+ P +IG+  NL  L L
Sbjct  142  IDRLKTLTYLNLGGNSFIGDIPAATGKLANLQTLHLFQNNFNGTFPKEIGDLSNLETLGL  201

Query  698  SMN  706
            + N
Sbjct  202  AYN  204


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 62/114 (54%), Gaps = 5/114 (4%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G FP    +  L+ + ++    N L GT+P+ + S   L TL +S N ++G+I     
Sbjct  494  LSGEFPNE--LTSLSQITTLRLDGNQLSGTLPSEIISWQSLSTLTISRNKISGQIPVAMS  551

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
            S+  L  L+L  N + GEIP  +V      L++SSN L G+IPD+   F NL+Y
Sbjct  552  SLPNLIELDLSENNITGEIPPQLVQLRFIFLNLSSNKLTGNIPDE---FDNLAY  602


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 3/117 (3%)
 Frame = +2

Query  371  AIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            AI  +   + S+ F   S  +L   IP +  + + LE LDLS N+LTG I     S+K L
Sbjct  211  AIPSEFGKMKSLKFMWISQCNLIENIPESFVNLTNLEYLDLSTNNLTGNIPRNLLSLKNL  270

Query  542  RSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             SL L  N L G IP  + A +L ++D+++N+L GSIP + G   NL++L L  N L
Sbjct  271  NSLFLYQNRLIGVIPNSVQALNLTNIDLATNNLTGSIPKEFGKLQNLTFLHLYSNQL  327


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 2/100 (2%)
 Frame = +2

Query  416  SNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM  595
             N L G IP ++ + + L  +DL+ N+LTG I  EF  ++ L  L+L  N L GEIP+ +
Sbjct  277  QNRLIGVIPNSVQALN-LTNIDLATNNLTGSIPKEFGKLQNLTFLHLYSNQLSGEIPSSL  335

Query  596  -VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             +  +L +  V  N LNG++P ++G +  L   +++ N L
Sbjct  336  GLIPNLRNFRVFDNKLNGTLPSELGKYSKLVAFEVADNKL  375



>ref|XP_004501092.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Cicer arietinum]
Length=889

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 99/183 (54%), Gaps = 5/183 (3%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISL-SE  340
            S+ ++     E  ILL LK+  G P SL     S SSPC+WP I C    +VT + L SE
Sbjct  25   SKVISQTTNSEETILLTLKRQLGNPPSLQSWKPSPSSPCNWPEIRC-IGSTVTELLLPSE  83

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
             I     P++  IC L NL  ++ S+NS+ G  P  L +C+ L  LDLS N   G+I  +
Sbjct  84   NITTQKLPST--ICDLKNLTKLDLSNNSIAGEFPTWLYNCTNLRYLDLSQNYFAGEIPND  141

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
               +KTL  LNL GN   G+IP      + L++L +  N+ NG+ P +IG+  NL  L L
Sbjct  142  IDRLKTLTYLNLGGNSFIGDIPAATGKLANLQTLHLFQNNFNGTFPKEIGDLSNLETLGL  201

Query  698  SMN  706
            + N
Sbjct  202  AYN  204


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 62/114 (54%), Gaps = 5/114 (4%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G FP    +  L+ + ++    N L GT+P+ + S   L TL +S N ++G+I     
Sbjct  494  LSGEFPNE--LTSLSQITTLRLDGNQLSGTLPSEIISWQSLSTLTISRNKISGQIPVAMS  551

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
            S+  L  L+L  N + GEIP  +V      L++SSN L G+IPD+   F NL+Y
Sbjct  552  SLPNLIELDLSENNITGEIPPQLVQLRFIFLNLSSNKLTGNIPDE---FDNLAY  602


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 3/117 (3%)
 Frame = +2

Query  371  AIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            AI  +   + S+ F   S  +L   IP +  + + LE LDLS N+LTG I     S+K L
Sbjct  211  AIPSEFGKMKSLKFMWISQCNLIENIPESFVNLTNLEYLDLSTNNLTGNIPRNLLSLKNL  270

Query  542  RSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             SL L  N L G IP  + A +L ++D+++N+L GSIP + G   NL++L L  N L
Sbjct  271  NSLFLYQNRLIGVIPNSVQALNLTNIDLATNNLTGSIPKEFGKLQNLTFLHLYSNQL  327


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 2/100 (2%)
 Frame = +2

Query  416  SNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM  595
             N L G IP ++ + + L  +DL+ N+LTG I  EF  ++ L  L+L  N L GEIP+ +
Sbjct  277  QNRLIGVIPNSVQALN-LTNIDLATNNLTGSIPKEFGKLQNLTFLHLYSNQLSGEIPSSL  335

Query  596  -VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             +  +L +  V  N LNG++P ++G +  L   +++ N L
Sbjct  336  GLIPNLRNFRVFDNKLNGTLPSELGKYSKLVAFEVADNKL  375



>ref|XP_002308032.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE91555.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=887

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 98/183 (54%), Gaps = 11/183 (6%)
 Frame = +2

Query  173  LTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSP-CDWPGISCNSNGS-VTRISLSEMI  346
            L T   D++AILL + +  G P      W + ++  C W GISC  N S V  + LS + 
Sbjct  19   LVTAQLDDQAILLAINRELGVP-----GWGANNTNYCKWAGISCGLNHSMVEGLDLSRLG  73

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+     +I +L  L  ++ SSNS  G IP+ + + S+LE LDLS+N   G I  E  
Sbjct  74   LRGNV---TLISELKALKQLDLSSNSFHGEIPSAIGNLSQLEFLDLSLNKFGGVIPMELC  130

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            S+K L+SLNL  NML G+IP        LE   +SSN LNGSIP  +GN  NL       
Sbjct  131  SLKNLKSLNLSNNMLVGQIPDEFQGLEKLEDFQISSNKLNGSIPSWVGNLTNLRVFTAYE  190

Query  704  NSL  712
            N L
Sbjct  191  NDL  193


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 62/122 (51%), Gaps = 4/122 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PA   + QL NL  +  S NSL G IP ++  C  L  LDLS N   G +     +M
Sbjct  315  GVIPAE--LGQLVNLQELILSGNSLIGDIPISIIGCKSLNKLDLSNNRFNGTVPNGICNM  372

Query  533  KTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSY-LDLSMN  706
              L+ L L  N + GEIP  +     L  L + SN L G+IP +IG+  NL   L+LS N
Sbjct  373  SRLQYLLLGQNSIKGEIPHEIGNCLKLLELQMGSNYLTGNIPPEIGHIRNLQIALNLSFN  432

Query  707  SL  712
             L
Sbjct  433  HL  434


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 69/148 (47%), Gaps = 6/148 (4%)
 Frame = +2

Query  281  DWPGISCNSNGSVTRISLSEMI---MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANL  451
            D  G+   + G+V+ ++  E+    M G   +     Q +NL+ +N +SN   G IPA L
Sbjct  264  DLVGVIPKAIGNVSSLTYFEVANNHMSGEIVSE--FAQCSNLILLNLASNGFTGVIPAEL  321

Query  452  SSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVS  628
                 L+ L LS N L G I       K+L  L+L  N   G +P  +   S L+ L + 
Sbjct  322  GQLVNLQELILSGNSLIGDIPISIIGCKSLNKLDLSNNRFNGTVPNGICNMSRLQYLLLG  381

Query  629  SNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             N + G IP +IGN   L  L +  N L
Sbjct  382  QNSIKGEIPHEIGNCLKLLELQMGSNYL  409


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 5/146 (3%)
 Frame = +2

Query  281  DWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSC  460
            D P IS     S+ ++ LS     G+ P    IC ++ L  +    NS+ G IP  + +C
Sbjct  340  DIP-ISIIGCKSLNKLDLSNNRFNGTVPNG--ICNMSRLQYLLLGQNSIKGEIPHEIGNC  396

Query  461  SKLETLDLSINDLTGKIAGEFFSMKTLR-SLNLRGNMLFGEIPTPMVAY-SLESLDVSSN  634
             KL  L +  N LTG I  E   ++ L+ +LNL  N L G +P  +     L SLDVS+N
Sbjct  397  LKLLELQMGSNYLTGNIPPEIGHIRNLQIALNLSFNHLHGPLPPELGKLDKLVSLDVSNN  456

Query  635  DLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+G+IP       +L  ++ S N L
Sbjct  457  QLSGTIPPLFKGMLSLIEINFSNNLL  482


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 6/153 (4%)
 Frame = +2

Query  266  TSSPCDWPGISCNSNGSVTRIS---LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGT  436
            T+   D  G   ++ GSV+ +    L   ++ G  P S  I  +  L  +  + N L G 
Sbjct  187  TAYENDLGGAIPDNLGSVSELKVLNLHSNMLEGPIPKS--IFSMGKLEVLILTLNRLKGE  244

Query  437  IPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LE  613
            +P ++ +C  L  + +  NDL G I     ++ +L    +  N + GEI +     S L 
Sbjct  245  LPESVGNCRGLSNIRIGNNDLVGVIPKAIGNVSSLTYFEVANNHMSGEIVSEFAQCSNLI  304

Query  614  SLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+++SN   G IP ++G   NL  L LS NSL
Sbjct  305  LLNLASNGFTGVIPAELGQLVNLQELILSGNSL  337



>ref|XP_010910570.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710, partial [Elaeis guineensis]
Length=416

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 97/174 (56%), Gaps = 7/174 (4%)
 Frame = +2

Query  197  RAILLILKQHWGYPFSLFEQWNST--SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            R ILL +K+ WG P S+   WN +  +S C+W GI C+++GSVT I+LS   +  + PA+
Sbjct  30   RQILLRIKEDWGNP-SVLSSWNDSIPTSHCNWTGIQCSTDGSVTNITLSNQNIAQTIPAA  88

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK-TLRS  547
              IC+L NL  ++ S N + GT P +L +CS L  LDLS N L G I  + + +   L  
Sbjct  89   --ICKLKNLSILDLSYNDIPGTFPTSLYNCSNLLYLDLSSNHLVGVIPSDIYRLSPRLTD  146

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L L  N   GEIP  +   S +E L +  N  + S P ++GN  NL  L L  N
Sbjct  147  LILSDNNFTGEIPPSIGRLSAIEHLSLYDNFFDASFPAELGNLSNLQTLRLGGN  200


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 4/122 (3%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L +  + GS PA   I  L NL  +    N   G IP ++   +++  L L+ N L+G I
Sbjct  246  LQQNSLSGSIPAG--IWNLKNLSVLYMFDNRFSGEIPESIGELTEMTELVLAENSLSGSI  303

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPT--PMVAYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
                +++K LR L L  N L G I    P+ A  LE +DVS+N LNGS P++ G   NL+
Sbjct  304  PNGIWNLKKLRILYLYANNLTGAINIDGPIGALELEQIDVSANQLNGSFPEEFGKLQNLA  363

Query  686  YL  691
             L
Sbjct  364  IL  365



>ref|XP_007152972.1| hypothetical protein PHAVU_004G175800g [Phaseolus vulgaris]
 gb|ESW24966.1| hypothetical protein PHAVU_004G175800g [Phaseolus vulgaris]
Length=1016

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 103/185 (56%), Gaps = 5/185 (3%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSE  340
            SQS +   + E AILL +K+++  P      W S++ S C WP I C+ + SVT ++LS 
Sbjct  32   SQSQSQLHDQEHAILLRIKEYFENP-PFLSHWTSSNFSHCSWPEIKCSDDDSVTGLTLSN  90

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
              +  + P+   IC L NL  ++F +N + G  P  L +CSKLE LDLS N+  G I  +
Sbjct  91   NSIHQTIPS--FICDLKNLTHVDFYNNYIPGEFPTYLVNCSKLEYLDLSQNNFVGSIPRD  148

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
              +   L+ LNL    L G+IP+ +     L +L + +   NG+IP +IGN  NL  L+L
Sbjct  149  IGNFSNLQYLNLAYTNLSGDIPSSIGTLKELRNLQLQNCLFNGTIPAEIGNLTNLEILEL  208

Query  698  SMNSL  712
            S N +
Sbjct  209  SGNPM  213


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G IP  + +   LE LDLS+NDL+G+I    F +K+L  + L  N L G IP  + A 
Sbjct  239  LVGEIPDTIGNMVALERLDLSVNDLSGQIPSGLFMLKSLNIIFLSRNNLSGVIPDVVEAL  298

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L  +D++ N ++G IPD  G   +L+ L LS+N+L
Sbjct  299  NLTIIDLTQNSISGKIPDGFGKLQSLTGLALSINNL  334


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 67/134 (50%), Gaps = 7/134 (5%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S++R+ +      G  P    +    N+V    S N L  +IP +L++  KL TL L  N
Sbjct  464  SISRLEIDYNQFYGRIPKG--VSSWTNVVVFKASKNYLNESIPRDLTALPKLTTLLLDQN  521

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
              TG +  +  S K+L +LNLR N L G IP  +     L  LD+S N  +G IP    N
Sbjct  522  HFTGSLPSDIISWKSLSNLNLRQNQLSGHIPDSIGHLPVLSQLDLSENQFSGQIP----N  577

Query  671  FYNLSYLDLSMNSL  712
               L+ L+LS NSL
Sbjct  578  LPRLTNLNLSSNSL  591



>ref|XP_007025533.1| HAESA-like 1 isoform 2 [Theobroma cacao]
 gb|EOY28155.1| HAESA-like 1 isoform 2 [Theobroma cacao]
Length=997

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 101/174 (58%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNS-NGSVTRISLSEMIMGGSFPA  367
            E   LL +K     P S    WNS   +PC+W G+SC+S  GSVT ++LS   + G FP+
Sbjct  23   EGLYLLQVKASLADPDSALSSWNSRDPTPCNWRGVSCDSATGSVTSLNLSSTNLAGPFPS  82

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              ++C+L NL S++   N++  TIP+++S+C  L  LDLS N LTG++      +  L+ 
Sbjct  83   --LLCRLQNLTSVSLYYNNINSTIPSDISTCQNLIHLDLSQNLLTGELPHTLADLPNLKY  140

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN L G+IP     +  LE L +  N L+G+IP  +GN   L  L+LS N
Sbjct  141  LDLTGNNLSGDIPVSFGRFQRLEVLSLVYNLLDGTIPAFLGNISTLKMLNLSYN  194


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 66/127 (52%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L  L  ++ + N L G IP++L+  + +  ++L  N LTG++
Sbjct  216  LTECNLVGEIPDS--VGRLKKLTDLDLAINHLVGKIPSSLTELTSVVQIELYNNSLTGEL  273

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
               F ++  LR L+   N L G IP  +    LESL++  N+  G++P  I +   L  L
Sbjct  274  PRRFSNLTKLRLLDASMNELTGTIPDELTQLPLESLNLYQNNFEGALPPSIADSPALYEL  333

Query  692  DLSMNSL  712
             +  N L
Sbjct  334  RIFQNRL  340


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 73/145 (50%), Gaps = 6/145 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I+  +N S+  IS +E    GS P    I  ++NLV 
Sbjct  421  WGLPHVYLLELVNNSFSGQIGKSIANAANLSLLVISRNEFT--GSLPEE--IGSVDNLVQ  476

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            I+   N   G +P ++ +   L  L+L  N+L G++     S+K L  LNL  N   G+I
Sbjct  477  ISAGENKFSGPLPKSIVNLDGLGILNLHGNELEGELPTGIESLKKLNELNLANNKFSGKI  536

Query  584  PTPMVAYS-LESLDVSSNDLNGSIP  655
            P  + + S L  LD+S+N L G IP
Sbjct  537  PDGIGSLSVLNYLDLSNNQLTGRIP  561



>ref|XP_007025532.1| HAESA-like 1 isoform 1 [Theobroma cacao]
 gb|EOY28154.1| HAESA-like 1 isoform 1 [Theobroma cacao]
Length=996

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 101/174 (58%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNS-NGSVTRISLSEMIMGGSFPA  367
            E   LL +K     P S    WNS   +PC+W G+SC+S  GSVT ++LS   + G FP+
Sbjct  23   EGLYLLQVKASLADPDSALSSWNSRDPTPCNWRGVSCDSATGSVTSLNLSSTNLAGPFPS  82

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              ++C+L NL S++   N++  TIP+++S+C  L  LDLS N LTG++      +  L+ 
Sbjct  83   --LLCRLQNLTSVSLYYNNINSTIPSDISTCQNLIHLDLSQNLLTGELPHTLADLPNLKY  140

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN L G+IP     +  LE L +  N L+G+IP  +GN   L  L+LS N
Sbjct  141  LDLTGNNLSGDIPVSFGRFQRLEVLSLVYNLLDGTIPAFLGNISTLKMLNLSYN  194


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 66/127 (52%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L  L  ++ + N L G IP++L+  + +  ++L  N LTG++
Sbjct  216  LTECNLVGEIPDS--VGRLKKLTDLDLAINHLVGKIPSSLTELTSVVQIELYNNSLTGEL  273

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
               F ++  LR L+   N L G IP  +    LESL++  N+  G++P  I +   L  L
Sbjct  274  PRRFSNLTKLRLLDASMNELTGTIPDELTQLPLESLNLYQNNFEGALPPSIADSPALYEL  333

Query  692  DLSMNSL  712
             +  N L
Sbjct  334  RIFQNRL  340


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 73/145 (50%), Gaps = 6/145 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I+  +N S+  IS +E    GS P    I  ++NLV 
Sbjct  421  WGLPHVYLLELVNNSFSGQIGKSIANAANLSLLVISRNEFT--GSLPEE--IGSVDNLVQ  476

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            I+   N   G +P ++ +   L  L+L  N+L G++     S+K L  LNL  N   G+I
Sbjct  477  ISAGENKFSGPLPKSIVNLDGLGILNLHGNELEGELPTGIESLKKLNELNLANNKFSGKI  536

Query  584  PTPMVAYS-LESLDVSSNDLNGSIP  655
            P  + + S L  LD+S+N L G IP
Sbjct  537  PDGIGSLSVLNYLDLSNNQLTGRIP  561



>ref|XP_002280395.1| PREDICTED: receptor-like protein kinase 5 [Vitis vinifera]
Length=1021

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 96/186 (52%), Gaps = 9/186 (5%)
 Frame = +2

Query  170  SLTTYG-----EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISL  334
            SLT YG     + E +ILL LKQHW  P ++    +S SS C WP I C  +GSVT ISL
Sbjct  22   SLTFYGNSQASDQELSILLKLKQHWHNPPAIDHWTSSNSSYCTWPEIECAEDGSVTGISL  81

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
              + +    P    IC L N+ +I+   N + G  P  L +C+KLE LDLS N   G I 
Sbjct  82   VNINITNEIP--PFICDLKNITTIDLQLNYIPGGFPTGLYNCTKLEYLDLSQNYFVGPIP  139

Query  515  GEFFSMK-TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSY  688
             +   +   L  L L GN   G+IP  +     L  L ++ N  NGS P +IGN   L +
Sbjct  140  ADVDRLSPRLYLLFLVGNNFSGDIPAAIGRLPELRFLRLTQNQFNGSFPPEIGNLSKLEH  199

Query  689  LDLSMN  706
            L ++ N
Sbjct  200  LGMAYN  205


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 61/110 (55%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L NL  +  + ++L G IP  +   + L+ LDLS N+L+GKI    F +K L  L L+ 
Sbjct  218  KLKNLKYLWMAQSNLIGEIPEMIGEMTALQYLDLSSNNLSGKIPSSLFLLKNLTELYLQV  277

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N   GEI   + A +L  +D+S N+L+G+IP+D G    L  L L  N  
Sbjct  278  NQFSGEIGPTIEAINLLRIDLSKNNLSGTIPEDFGRLSKLEVLVLYSNQF  327


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 70/134 (52%), Gaps = 6/134 (4%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ + + +  G+ PA   +    NLV  +  +N L G IP+ L++   L TL L  N 
Sbjct  459  LSRLEIRDNMFYGNIPAG--VASWKNLVVFDARNNQLSGPIPSELTALPSLTTLFLDRNL  516

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGN  670
              G +  +  S K+L  LNL  N + G IP   + Y   L  LD+S N L+G IP +IG 
Sbjct  517  FDGHLPSKIVSWKSLNFLNLSRNQISGMIPAE-IGYLPDLSELDLSENQLSGEIPPEIG-  574

Query  671  FYNLSYLDLSMNSL  712
                ++L+LS N L
Sbjct  575  LLTFTFLNLSSNHL  588


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL+ I+ S N+L GTIP +    SKLE L L  N  TG+I     ++  LR + L  N L
Sbjct  292  NLLRIDLSKNNLSGTIPEDFGRLSKLEVLVLYSNQFTGEIPESIGNLTALRDVRLFSNNL  351

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
             G +P     YS LE+ +V+SN   G +P+++
Sbjct  352  SGILPPDFGRYSMLEAFEVASNSFTGRLPENL  383


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 6/123 (5%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT-GKIAGEFFS  529
            G  PA+  I +L  L  +  + N   G+ P  + + SKLE L ++ ND    +I   F  
Sbjct  161  GDIPAA--IGRLPELRFLRLTQNQFNGSFPPEIGNLSKLEHLGMAYNDFRPSEIPLNFTK  218

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            +K L+ L +  + L GEIP  M+    +L+ LD+SSN+L+G IP  +    NL+ L L +
Sbjct  219  LKNLKYLWMAQSNLIGEIPE-MIGEMTALQYLDLSSNNLSGKIPSSLFLLKNLTELYLQV  277

Query  704  NSL  712
            N  
Sbjct  278  NQF  280


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 2/114 (2%)
 Frame = +2

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            +I ++  L  ++ SSN+L G IP++L     L  L L +N  +G+I     ++  LR ++
Sbjct  239  MIGEMTALQYLDLSSNNLSGKIPSSLFLLKNLTELYLQVNQFSGEIGPTIEAINLLR-ID  297

Query  554  LRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L  N L G IP      S LE L + SN   G IP+ IGN   L  + L  N+L
Sbjct  298  LSKNNLSGTIPEDFGRLSKLEVLVLYSNQFTGEIPESIGNLTALRDVRLFSNNL  351



>ref|XP_011007100.1| PREDICTED: receptor-like protein kinase HSL1, partial [Populus 
euphratica]
Length=697

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 94/174 (54%), Gaps = 6/174 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
             ++A+LL LK HW  P SL EQW  S SS C+WPG+ CN N  VT++ L    + G+ P 
Sbjct  27   HDQAVLLRLKHHWQNPLSL-EQWTPSNSSHCNWPGVVCNDN-YVTQLILDNKNISGTIPP  84

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              ++  L NL  +N S+N++ G  P  + + SKLE LDLS N + G I  +  S+  L  
Sbjct  85   --LLSDLKNLTFLNLSNNNIIGKFPVAVHNLSKLEILDLSQNYIVGTIPDDIDSLARLSY  142

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            LNL  N   G IP  +       +L +  N  NG+ P +IGN   L  L ++ N
Sbjct  143  LNLYANNFSGNIPAAIGRLPEQRTLRLYENQFNGTFPPEIGNLSKLEELSMAHN  196


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 71/136 (52%), Gaps = 2/136 (1%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPAS--AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            G+++++    M   G  P+   +   QL  L ++  S  +L G IP  +     LE LDL
Sbjct  183  GNLSKLEELSMAHNGFSPSRLHSSFTQLKKLKTLWISGANLIGEIPQMIGEMVSLEHLDL  242

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDI  664
            S N LTG I G  F +  LR L L  N L GEIP  + A +L S+D+S N+L G+IP D 
Sbjct  243  SSNKLTGNIPGSLFMLMNLRVLRLYKNKLSGEIPRVVEALNLTSVDLSDNNLTGTIPVDF  302

Query  665  GNFYNLSYLDLSMNSL  712
            G    LS L L  N L
Sbjct  303  GKLDKLSGLRLFFNQL  318


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 58/108 (54%), Gaps = 2/108 (2%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL   N S+N   GTIP  L++   L  L L  N LTG +  +  S K+L +LNL  N L
Sbjct  473  NLEVFNASNNQFTGTIPLELTALPNLTVLLLDKNQLTGALPSDIISWKSLTTLNLSQNQL  532

Query  572  FGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G+IP  + +   L  LD+S N  +G IP   G    L+YL+LS N L
Sbjct  533  SGQIPEEIAILPHLLELDLSDNQFSGDIPTQFG-LLRLTYLNLSSNHL  579


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +    N L G +P+++ S   L TL+LS N L+G+I  E   +
Sbjct  486  GTIPLE--LTALPNLTVLLLDKNQLTGALPSDIISWKSLTTLNLSQNQLSGQIPEEIAIL  543

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
              L  L+L  N   G+IPT      L  L++SSN L G IP +  N  Y+ S+L+
Sbjct  544  PHLLELDLSDNQFSGDIPTQFGLLRLTYLNLSSNHLVGKIPAEYENAAYSSSFLN  598


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 4/121 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  + LS   + G+ P S  +  L NL  +    N L G IP  + + + L ++DLS N
Sbjct  236  SLEHLDLSSNKLTGNIPGS--LFMLMNLRVLRLYKNKLSGEIPRVVEALN-LTSVDLSDN  292

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  +F  +  L  L L  N L G+IP  +    +L+     SN+L+GSIP D+G 
Sbjct  293  NLTGTIPVDFGKLDKLSGLRLFFNQLSGQIPESIGRLPALKYFRFFSNNLSGSIPPDLGR  352

Query  671  F  673
            +
Sbjct  353  Y  353



>ref|XP_004245143.1| PREDICTED: receptor-like protein kinase HSL1 [Solanum lycopersicum]
Length=1043

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 96/185 (52%), Gaps = 7/185 (4%)
 Frame = +2

Query  158  NYSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLS  337
            N+     T    ER  LL +K+ WG P S  + WNSTSSPC WP I C+ +G VT I L 
Sbjct  38   NFIPIFVTPATTERDTLLKIKRQWGNP-SALDSWNSTSSPCSWPEIECD-DGKVTGIILQ  95

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
            E  +    P S  IC+L NL  +N   N L G  P  L  CS L+ LDLS N   G I  
Sbjct  96   EKDITVEIPTS--ICELKNLTLLNLRLNYLPGEFPTFLYKCSNLQHLDLSQNYFVGTIPE  153

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
            +   +  L+ LNL GN   G+IP P V     LE+L +  N  NGS P +IGN  NL  L
Sbjct  154  DIHRLGKLKYLNLGGNNFTGDIP-PSVGNLTELETLCMDLNLFNGSFPAEIGNLANLESL  212

Query  692  DLSMN  706
             L  N
Sbjct  213  GLEFN  217


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 64/123 (52%), Gaps = 4/123 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+   +  L NL  +   +N L G IP    S SKL  LD+S N+LTG I   F 
Sbjct  268  LEGKIPSGLFL--LKNLTMMYLFNNRLSGRIPETFES-SKLMELDVSNNNLTGTIPESFG  324

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
              K L+ +NL  N L+G IP  +    SL+   V  N LNGS+P ++G    L   ++S+
Sbjct  325  EFKHLKIMNLFANHLYGPIPESIANIPSLKVFKVFRNKLNGSLPSEMGLHSKLESFEVSV  384

Query  704  NSL  712
            NS 
Sbjct  385  NSF  387


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 53/99 (54%), Gaps = 0/99 (0%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            +  L+ +  +    NSL G +PA++ S   L  LDLS N L+GKI      +  L +L+L
Sbjct  513  LTSLSQITQLELDGNSLSGELPADIISWKSLSILDLSRNKLSGKIPAALGLIPDLVALDL  572

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
              N L G IP  +    + SL+VSSN L G+IPD   N 
Sbjct  573  SQNQLLGPIPPQLGVRRITSLNVSSNQLTGNIPDAFANL  611


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  +  I      L G IP +      LE +D + N+L GKI    F +K L  + L  
Sbjct  230  KLKKIKYIWMRDTKLIGEIPESFGDFLNLELIDFAHNNLEGKIPSGLFLLKNLTMMYLFN  289

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G IP    +  L  LDVS+N+L G+IP+  G F +L  ++L  N L
Sbjct  290  NRLSGRIPETFESSKLMELDVSNNNLTGTIPESFGEFKHLKIMNLFANHL  339



>ref|XP_006382632.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
 gb|ERP60429.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
Length=1060

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 104/198 (53%), Gaps = 24/198 (12%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNS-NGSVTRISLSEMIMGGSFPA  367
            D+ A+L +  Q    P +    WN++SSPC+W  +SCN  N  V  + LS + + GS   
Sbjct  69   DKEALLSLKSQVTTDPSNTLSSWNNSSSPCNWTRVSCNQVNQRVIGLDLSGLRLTGSISP  128

Query  368  SA----------------------IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            +                        I  L+ L  +N S NS+ G IP N + C  L+ LD
Sbjct  129  NIGNLSLLRSLHLQGNQFTGLIPDQIGALSRLSVLNISFNSINGPIPLNTTMCLNLQILD  188

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPD  658
            L  N+++G I  E  S+K L  LNL GN L+G IP       SL +L++++N+L G IPD
Sbjct  189  LMQNEISGAIPEELSSLKNLEILNLGGNKLWGTIPPSFANISSLLTLNLATNNLGGMIPD  248

Query  659  DIGNFYNLSYLDLSMNSL  712
            D G F NL +LDLS+N+L
Sbjct  249  DFGRFKNLKHLDLSINNL  266


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 73/135 (54%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  +++S   + G  P    I +L NL  ++ ++N + G IP +L    KL  +DLS N
Sbjct  431  SLALLNISYNYVSGEIPPE--IGELTNLQELHLAANKISGRIPNSLGKLQKLNEIDLSSN  488

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS--LESLDVSSNDLNGSIPDDIG  667
            DL G +   F + + L S++L  N L G IP  + + S    +L++SSN L GS P +I 
Sbjct  489  DLVGSLPTTFVNFQQLVSMDLSSNRLNGSIPKAIFSLSSLSATLNLSSNQLTGSFPQEIK  548

Query  668  NFYNLSYLDLSMNSL  712
               N++ +D S N L
Sbjct  549  GLENVAAVDFSHNHL  563


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P    +  L NL  +N   N LWGTIP + ++ S L TL+L+ N+L G I  +F 
Sbjct  194  ISGAIPEE--LSSLKNLEILNLGGNKLWGTIPPSFANISSLLTLNLATNNLGGMIPDDFG  251

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
              K L+ L+L  N L G +P  +    SL  L V+SN L G IP D+G+
Sbjct  252  RFKNLKHLDLSINNLTGNVPLSLYNISSLVFLAVASNQLRGEIPVDVGD  300


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 68/122 (56%), Gaps = 4/122 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PAS  I  L +L  +N S N + G IP  +   + L+ L L+ N ++G+I      +
Sbjct  420  GRIPAS--IRHLRSLALLNISYNYVSGEIPPEIGELTNLQELHLAANKISGRIPNSLGKL  477

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSY-LDLSMN  706
            + L  ++L  N L G +PT  V +  L S+D+SSN LNGSIP  I +  +LS  L+LS N
Sbjct  478  QKLNEIDLSSNDLVGSLPTTFVNFQQLVSMDLSSNRLNGSIPKAIFSLSSLSATLNLSSN  537

Query  707  SL  712
             L
Sbjct  538  QL  539


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 70/131 (53%), Gaps = 4/131 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNL-VSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            + LS   + GS P +  I  L++L  ++N SSN L G+ P  +     +  +D S N L+
Sbjct  507  MDLSSNRLNGSIPKA--IFSLSSLSATLNLSSNQLTGSFPQEIKGLENVAAVDFSHNHLS  564

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYN  679
            G I     S K+L  L +  NM  G IP  +     LE LD+SSN ++G IP+++GN   
Sbjct  565  GSIPDTIGSWKSLEKLFMDNNMFSGAIPATLGDVKGLEILDLSSNQISGIIPNNLGNLQA  624

Query  680  LSYLDLSMNSL  712
            L  L+LS N L
Sbjct  625  LYLLNLSFNDL  635



>ref|XP_006387571.1| hypothetical protein POPTR_0830s00200g, partial [Populus trichocarpa]
 gb|ERP46485.1| hypothetical protein POPTR_0830s00200g, partial [Populus trichocarpa]
Length=589

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 98/175 (56%), Gaps = 6/175 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFP  364
            + E+AILL LKQ+W  P SL ++W  S+SS C WPG++C +N S+T++ L    + G+ P
Sbjct  30   DQEQAILLRLKQYWQNPSSL-DRWTPSSSSHCTWPGVAC-ANNSITQLLLDNKDITGTIP  87

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
                I  L NL  +NFS+NS+ G  P  + + SKLE LDLS N   G I  +  S+  L 
Sbjct  88   P--FISDLKNLKVLNFSNNSIIGKFPVAVYNFSKLEILDLSQNYFVGTIPDDIDSLSRLS  145

Query  545  SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             LNL  N   G IP  +     L +L +  N  NG+ P +IGN   L  L +S N
Sbjct  146  YLNLCANNFTGNIPAAIGRIPELRTLYLHDNLFNGTFPAEIGNLSKLEELYMSHN  200


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 71/136 (52%), Gaps = 2/136 (1%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPAS--AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            G+++++    M   G  P+   +   QL  L  +     +L G IP  +     LE LDL
Sbjct  187  GNLSKLEELYMSHNGFLPSKLPSSFTQLKKLRELWIFEANLIGEIPQMIGEMVALEHLDL  246

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDI  664
            S N+LTG I    F +K L+ L L  N+L GEIP  + A +   +D+S N+LNG+IP D 
Sbjct  247  SKNELTGSIPNGLFMLKNLKFLFLYKNLLSGEIPQVVEALNSIVIDLSWNNLNGTIPVDF  306

Query  665  GNFYNLSYLDLSMNSL  712
            G    LS L LS N L
Sbjct  307  GKLDKLSGLSLSFNQL  322


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 60/108 (56%), Gaps = 2/108 (2%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NLV  N S+N   GTIP  L++   L  L L  N LTG +  +  S K+L +LNL  N L
Sbjct  477  NLVVFNASNNQFTGTIPLELTALPNLTVLLLDKNQLTGALPSDIISWKSLTTLNLSQNQL  536

Query  572  FGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G+IP  + +   L  LD+S N  +G IP  +G    L+YL+LS N L
Sbjct  537  SGQIPEEIAILPHLLELDLSDNQFSGQIPPQLG-LLRLTYLNLSSNHL  583


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++  + LS+  + GS P    +  L NL  +    N L G IP  + + + +  +DLS N
Sbjct  240  ALEHLDLSKNELTGSIPNG--LFMLKNLKFLFLYKNLLSGEIPQVVEALNSI-VIDLSWN  296

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +L G I  +F  +  L  L+L  N L GEIP  +    +L+   + SN+L+G IP D+G 
Sbjct  297  NLNGTIPVDFGKLDKLSGLSLSFNQLSGEIPESIGRLPALKDFALFSNNLSGPIPPDLGR  356

Query  671  FYNLSYLDLSMNSL  712
            +  L    ++ N L
Sbjct  357  YSALDGFQVASNRL  370



>ref|XP_009793567.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nicotiana sylvestris]
Length=1163

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 90/161 (56%), Gaps = 6/161 (4%)
 Frame = +2

Query  236  PFSLFEQWNSTS--SPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSIN  409
            P      W+S S  +PCDW GI C  NGSV+ + L  + + G  P +A I  L  L  ++
Sbjct  78   PIGALNNWDSKSLSAPCDWRGIVC-LNGSVSELRLPRLQLSG--PLTAEIANLRMLRKLS  134

Query  410  FSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT  589
              SN   GTIPA+LS C+ L+T+ L  N  +G+I  E   +K L + N+ GN L+GEIP 
Sbjct  135  LRSNFFNGTIPASLSKCTLLDTVYLQYNSFSGEIPPEISKLKQLFTFNVAGNQLYGEIPG  194

Query  590  PMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             + A SL   D+S N L+GSIP+ I     L+  ++S N  
Sbjct  195  ELPA-SLRYFDISENSLSGSIPEKISELSQLTLFNISYNQF  234


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 67/130 (52%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ISL E  + G  P       L  L  +N SSNS  G IP+     + L  L LS N+++G
Sbjct  569  ISLQENKLSGDVPEG--FSSLMGLQYLNLSSNSFSGHIPSTFGFLTSLVVLSLSNNNISG  626

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
             +  +  +   L +LNLR N L G+IP+ +   S L  LD+  N+L G IP  I N  +L
Sbjct  627  SVPPDLGNSSALDALNLRSNALIGQIPSDLARLSHLSVLDLGRNNLTGEIPGVISNCSSL  686

Query  683  SYLDLSMNSL  712
            + L L MN L
Sbjct  687  TSLVLDMNHL  696


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 76/158 (48%), Gaps = 27/158 (17%)
 Frame = +2

Query  308  NGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLS  487
            N ++  + LS  +  G  P S  I  L  L  +  ++NS  G IP  ++ CS L  LDL 
Sbjct  371  NSTLRSLDLSGNLFSGKIPGS--IGNLLRLEQLRMANNSFEGDIPIGITKCSGLTVLDLE  428

Query  488  INDLTGKIAG------------------------EFFSMKTLRSLNLRGNMLFGEIPTP-  592
             N L G+I G                         F ++ +L SLNL GN L G +P   
Sbjct  429  GNRLIGEIPGFLGDLRSLKILSLGRNQFSGLIPSSFGNITSLESLNLEGNRLTGSLPEEL  488

Query  593  MVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            M+  +L  L++S N L+GSIP  IGNF  LS L+LS N
Sbjct  489  MLLSNLSILNLSGNKLSGSIPVGIGNFQQLSVLNLSRN  526


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + GS P    I     L  +N S N   G+IP+ L +  KL  LDLS  +L+G++  +  
Sbjct  504  LSGSIPVG--IGNFQQLSVLNLSRNEFSGSIPSTLGTLYKLVALDLSGQNLSGELPSDLA  561

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +  L+ ++L+ N L G++P    +   L+ L++SSN  +G IP   G   +L  L LS 
Sbjct  562  GLPNLQVISLQENKLSGDVPEGFSSLMGLQYLNLSSNSFSGHIPSTFGFLTSLVVLSLSN  621

Query  704  NSL  712
            N++
Sbjct  622  NNI  624


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  +SLS   + GS P    +   + L ++N  SN+L G IP++L+  S L  LDL  N
Sbjct  613  SLVVLSLSNNNISGSVPPD--LGNSSALDALNLRSNALIGQIPSDLARLSHLSVLDLGRN  670

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT-PMVAYSLESLDVSSNDLNGSIPDDIGN  670
            +LTG+I G   +  +L SL L  N L G IP       SL +LD+S N+LNG IP+++  
Sbjct  671  NLTGEIPGVISNCSSLTSLVLDMNHLSGNIPASLSSLSSLNTLDLSGNNLNGEIPENLTM  730

Query  671  FYNLSYLDLSMNSL  712
               L   ++S N L
Sbjct  731  LLALVNFNVSNNKL  744


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 65/140 (46%), Gaps = 5/140 (4%)
 Frame = +2

Query  308  NGSVTRISLSEMIMGGSFPASAIICQLNNLVS----INFSSNSLWGTIPANLSSCSKLET  475
            NGSV   SL  + +  +     +  QL+  VS    ++   N + G  P  L+  S L +
Sbjct  317  NGSVNPPSLRIIQLNHNAFTEILQPQLSTCVSFLQVLDLQQNQIDGIFPTFLTDNSTLRS  376

Query  476  LDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSI  652
            LDLS N  +GKI G   ++  L  L +  N   G+IP  +   S L  LD+  N L G I
Sbjct  377  LDLSGNLFSGKIPGSIGNLLRLEQLRMANNSFEGDIPIGITKCSGLTVLDLEGNRLIGEI  436

Query  653  PDDIGNFYNLSYLDLSMNSL  712
            P  +G+  +L  L L  N  
Sbjct  437  PGFLGDLRSLKILSLGRNQF  456


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 66/134 (49%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  +SL      G  P+S     + +L S+N   N L G++P  L   S L  L+LS N
Sbjct  445  SLKILSLGRNQFSGLIPSS--FGNITSLESLNLEGNRLTGSLPEELMLLSNLSILNLSGN  502

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             L+G I     + + L  LNL  N   G IP+ +   Y L +LD+S  +L+G +P D+  
Sbjct  503  KLSGSIPVGIGNFQQLSVLNLSRNEFSGSIPSTLGTLYKLVALDLSGQNLSGELPSDLAG  562

Query  671  FYNLSYLDLSMNSL  712
              NL  + L  N L
Sbjct  563  LPNLQVISLQENKL  576



>ref|XP_010049140.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
Length=1023

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 101/183 (55%), Gaps = 9/183 (5%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSE  340
            SQS  T    E  +LL LKQ W  P +L + WNS+S +PC WP ++C S G+VT + L +
Sbjct  28   SQSQAT---SELTVLLNLKQQWSNPRAL-QSWNSSSPTPCGWPKVNCTS-GTVTGLLLHD  82

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
            M +    P S  IC L NL  ++ S N + G  P  L +CSKL+ LDLS N   G I  +
Sbjct  83   MNITEPIPPS--ICDLKNLTQLDLSLNYIPGGFPKALYNCSKLQFLDLSQNYFVGPIPSD  140

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
               +  L  L++ GN   G+IP  +   S L++L +  N+ NG+ P +I +  NL  L +
Sbjct  141  VDQLSGLTYLDVGGNNFSGDIPVEIGRLSGLQTLSLHQNEFNGTFPKEIADLANLEVLTM  200

Query  698  SMN  706
            + N
Sbjct  201  AYN  203


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  +  +  +L   IP + S+ S L+ LDLS N LTG I G  FS++ LR + L  
Sbjct  217  QLKKLRFLWMTQCNLIDGIPESFSNLSSLQRLDLSGNALTGGIPGGLFSLQNLRYVYLYH  276

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GE+ T + + +L  +D++ N+L GSIP+D G   +L  L+L  N L
Sbjct  277  NKLSGELSTSISSMNLIEIDLAMNNLTGSIPEDFGKLQSLRLLNLYGNQL  326


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL+ I+ + N+L G+IP +      L  L+L  N L+G I      +  LR   + GN L
Sbjct  291  NLIEIDLAMNNLTGSIPEDFGKLQSLRLLNLYGNQLSGHIPVSIARLPLLRVFRVFGNKL  350

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
             GE+P     YS LE+ ++S+N+ +G +P ++
Sbjct  351  SGELPPKFGLYSPLEAFEISNNEFSGELPKNL  382


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 71/133 (53%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ +S     G  P    +   ++L  +N S+N   G +P  L+S S+L  L +  N 
Sbjct  458  LSRVEISNNKFSGPIPTE--VSSWSSLAVLNASNNLFSGNVPEELTSLSRLIVLAMDGNQ  515

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
            L+G++  +  S K+L +LNL  N L G+IP  +     L  LD+S N  +G IP ++G  
Sbjct  516  LSGELPSKIISWKSLTTLNLSKNKLSGQIPAAVGSLPDLLDLDLSDNQFSGVIPPELGKL  575

Query  674  YNLSYLDLSMNSL  712
              L+ L+LS N L
Sbjct  576  -RLTTLNLSSNQL  587



>ref|XP_011008121.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=1012

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 98/175 (56%), Gaps = 6/175 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFP  364
            + E+AILL LKQ+W  P SL ++W  S+SS C WPG++C +N SVT++ L  M + G  P
Sbjct  30   DQEQAILLRLKQYWQNPSSL-DRWTPSSSSHCTWPGVAC-TNNSVTQLLLDNMNIPGKIP  87

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
                I  L NL  +NFS+NS+ G  P  + + SKLE LDLS N   G I  +  S+  L 
Sbjct  88   P--FISDLKNLKVLNFSNNSIIGKFPVAVYNFSKLEILDLSQNYFVGTIPDDIDSLSRLS  145

Query  545  SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             LNL  N   G IP  +     L +L +  N  +G+ P +IGN   L  L ++ N
Sbjct  146  YLNLCANNFTGNIPAAIGRIPELRTLYLHDNLFDGTFPAEIGNLSKLEELYMAHN  200


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 71/136 (52%), Gaps = 2/136 (1%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPAS--AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            G+++++    M   G  P+   +   QL  L  +  S  +L G IP  +     LE LDL
Sbjct  187  GNLSKLEELYMAHNGFLPSKLPSSFTQLKKLRELWISEANLIGEIPQMVGEMVALERLDL  246

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDI  664
            S N+LTG I    F +K L+ L L  N+L GEIP  + A +   +D+S N+L G+IP D 
Sbjct  247  SKNELTGSIPDGLFMLKNLKFLFLYKNLLSGEIPQVVEALNSIVIDLSWNNLTGTIPVDF  306

Query  665  GNFYNLSYLDLSMNSL  712
            G    LS L LS N L
Sbjct  307  GKLDKLSGLSLSFNQL  322


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 70/134 (52%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++ R+ LS+  + GS P    +  L NL  +    N L G IP  + + + +  +DLS N
Sbjct  240  ALERLDLSKNELTGSIPDGLFM--LKNLKFLFLYKNLLSGEIPQVVEALNSI-VIDLSWN  296

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  +F  +  L  L+L  N L GEIP  +    +L+   + SN+L+G IP D+G 
Sbjct  297  NLTGTIPVDFGKLDKLSGLSLSFNQLSGEIPESIGRLPALKDFALFSNNLSGPIPPDLGR  356

Query  671  FYNLSYLDLSMNSL  712
            +  L    ++ N L
Sbjct  357  YSALEGFQVATNRL  370


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +    N L G +P+++ S   L T++LS N L+G+I  E   +
Sbjct  490  GTIPLE--LTALPNLTVLLLDKNQLTGALPSDIISWKSLTTINLSQNQLSGQIPEEIAIL  547

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
              L  L+L  N   G+IPT      L  L++SSN L G IP +  N  Y+ S+L+
Sbjct  548  PHLLELDLSDNQFSGDIPTQFGLLRLTYLNLSSNHLVGKIPAEYENAAYSSSFLN  602



>ref|XP_011072724.1| PREDICTED: receptor-like protein kinase isoform X1 [Sesamum indicum]
Length=1107

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 100/172 (58%), Gaps = 5/172 (3%)
 Frame = +2

Query  206  LLILKQHWG-YPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAII  379
            LL L +HW   P ++   WN S S+PC W G+ CN N  V  ++LS + + G       I
Sbjct  31   LLSLVRHWKMVPPTMKFSWNASDSTPCSWFGVRCNPNNFVDELNLSNLGISGQLGPE--I  88

Query  380  CQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLR  559
              L +L SI+ S+NS  G+IP+ L +CS+LE L+LS+N  +G++      ++ L  L+L 
Sbjct  89   AYLKHLTSIDLSNNSFSGSIPSELGNCSRLEALELSLNSFSGQVPESLGDLQNLEYLSLF  148

Query  560  GNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             N L GEIP  +     L+++ +++N L+GSIP  +GN   L+YL L  N L
Sbjct  149  SNSLVGEIPESLFRTPFLDTISLNNNGLSGSIPSIVGNMSELAYLYLDYNQL  200


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 4/132 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++TR+ L +  + G+ P      +  NL+ ++ S+NS  G IP++L + + + ++DLS+N
Sbjct  477  TLTRLILKQNNLTGTLPE---FVENPNLLFMDLSNNSFRGAIPSSLGNLTSITSMDLSLN  533

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGN  670
             LTG I  E  S+  L +LNL  N L G +P+ +   Y L  LD+S N LNG+IP  + +
Sbjct  534  KLTGHIPSELGSLVELEALNLSHNALEGWLPSELSGCYKLSKLDMSHNILNGTIPSSLRS  593

Query  671  FYNLSYLDLSMN  706
               L+ LDLS N
Sbjct  594  LKELTILDLSEN  605


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 70/137 (51%), Gaps = 6/137 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T + LS   + G  P+   +  L  L ++N S N+L G +P+ LS C KL  LD+S N
Sbjct  524  SITSMDLSLNKLTGHIPSE--LGSLVELEALNLSHNALEGWLPSELSGCYKLSKLDMSHN  581

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG-  667
             L G I     S+K L  L+L  N   G IPT +     L  L + SN L GSIP  IG 
Sbjct  582  ILNGTIPSSLRSLKELTILDLSENRFGGGIPTSIFQLGKLSFLQLGSNQLGGSIPPSIGL  641

Query  668  --NFYNLSYLDLSMNSL  712
                 +L  L+LS N L
Sbjct  642  GIEAQSLRLLNLSSNRL  658


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 4/136 (3%)
 Frame = +2

Query  308  NGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLS  487
            N S+T++  +     GS P +  +C    L  +    N   G+IP+++ +C  L  L L 
Sbjct  427  NSSLTQVDFTRNKFTGSIPPN--LCFRKQLRKLILGQNHFQGSIPSDIGNCFTLTRLILK  484

Query  488  INDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDI  664
             N+LTG +  EF     L  ++L  N   G IP+ +    S+ S+D+S N L G IP ++
Sbjct  485  QNNLTGTLP-EFVENPNLLFMDLSNNSFRGAIPSSLGNLTSITSMDLSLNKLTGHIPSEL  543

Query  665  GNFYNLSYLDLSMNSL  712
            G+   L  L+LS N+L
Sbjct  544  GSLVELEALNLSHNAL  559


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 4/118 (3%)
 Frame = +2

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
            M  GG  P       L  L +I   S +L G IP++L   +KL  L LS N L+G I  E
Sbjct  271  MFSGGVPPGLGNCSSLTKLAAI---SCNLSGHIPSSLGRLTKLILLYLSENQLSGAIPPE  327

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              + K L  L L GN L G IP+ + +  +L++L + +N L G IP  I    +L  L
Sbjct  328  LGNCKALSDLQLYGNQLEGGIPSELGMLNALQTLMLFTNRLGGEIPTSIWKIQSLQNL  385



>ref|XP_011072726.1| PREDICTED: receptor-like protein kinase isoform X2 [Sesamum indicum]
Length=1007

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 101/172 (59%), Gaps = 5/172 (3%)
 Frame = +2

Query  206  LLILKQHWG-YPFSLFEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAII  379
            LL L +HW   P ++   WN++ S+PC W G+ CN N  V  ++LS + + G       I
Sbjct  31   LLSLVRHWKMVPPTMKFSWNASDSTPCSWFGVRCNPNNFVDELNLSNLGISGQLGPE--I  88

Query  380  CQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLR  559
              L +L SI+ S+NS  G+IP+ L +CS+LE L+LS+N  +G++      ++ L  L+L 
Sbjct  89   AYLKHLTSIDLSNNSFSGSIPSELGNCSRLEALELSLNSFSGQVPESLGDLQNLEYLSLF  148

Query  560  GNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             N L GEIP  +     L+++ +++N L+GSIP  +GN   L+YL L  N L
Sbjct  149  SNSLVGEIPESLFRTPFLDTISLNNNGLSGSIPSIVGNMSELAYLYLDYNQL  200


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 4/132 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++TR+ L +  + G+ P      +  NL+ ++ S+NS  G IP++L + + + ++DLS+N
Sbjct  477  TLTRLILKQNNLTGTLPE---FVENPNLLFMDLSNNSFRGAIPSSLGNLTSITSMDLSLN  533

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGN  670
             LTG I  E  S+  L +LNL  N L G +P+ +   Y L  LD+S N LNG+IP  + +
Sbjct  534  KLTGHIPSELGSLVELEALNLSHNALEGWLPSELSGCYKLSKLDMSHNILNGTIPSSLRS  593

Query  671  FYNLSYLDLSMN  706
               L+ LDLS N
Sbjct  594  LKELTILDLSEN  605


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 70/137 (51%), Gaps = 6/137 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T + LS   + G  P+   +  L  L ++N S N+L G +P+ LS C KL  LD+S N
Sbjct  524  SITSMDLSLNKLTGHIPSE--LGSLVELEALNLSHNALEGWLPSELSGCYKLSKLDMSHN  581

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG-  667
             L G I     S+K L  L+L  N   G IPT +     L  L + SN L GSIP  IG 
Sbjct  582  ILNGTIPSSLRSLKELTILDLSENRFGGGIPTSIFQLGKLSFLQLGSNQLGGSIPPSIGL  641

Query  668  --NFYNLSYLDLSMNSL  712
                 +L  L+LS N L
Sbjct  642  GIEAQSLRLLNLSSNRL  658


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 4/136 (3%)
 Frame = +2

Query  308  NGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLS  487
            N S+T++  +     GS P +  +C    L  +    N   G+IP+++ +C  L  L L 
Sbjct  427  NSSLTQVDFTRNKFTGSIPPN--LCFRKQLRKLILGQNHFQGSIPSDIGNCFTLTRLILK  484

Query  488  INDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDI  664
             N+LTG +  EF     L  ++L  N   G IP+ +    S+ S+D+S N L G IP ++
Sbjct  485  QNNLTGTLP-EFVENPNLLFMDLSNNSFRGAIPSSLGNLTSITSMDLSLNKLTGHIPSEL  543

Query  665  GNFYNLSYLDLSMNSL  712
            G+   L  L+LS N+L
Sbjct  544  GSLVELEALNLSHNAL  559


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 56/109 (51%), Gaps = 4/109 (4%)
 Frame = +2

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
            M  GG  P       L  L +I   S +L G IP++L   +KL  L LS N L+G I  E
Sbjct  271  MFSGGVPPGLGNCSSLTKLAAI---SCNLSGHIPSSLGRLTKLILLYLSENQLSGAIPPE  327

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDI  664
              + K L  L L GN L G IP+ + +  +L++L + +N L G IP  I
Sbjct  328  LGNCKALSDLQLYGNQLEGGIPSELGMLNALQTLMLFTNRLGGEIPTSI  376



>ref|XP_011014419.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=1012

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 98/175 (56%), Gaps = 6/175 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFP  364
            + E+AILL LKQ+W  P SL ++W  S+SS C WPG++C +N SVT++ L  M + G  P
Sbjct  30   DQEQAILLRLKQYWQNPSSL-DRWTPSSSSHCTWPGVAC-TNNSVTQLLLDNMNIPGKIP  87

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
                I  L NL  +NFS+NS+ G  P  + + SKLE LDLS N   G I  +  S+  L 
Sbjct  88   P--FISDLKNLKVLNFSNNSIIGKFPVAVYNFSKLEILDLSQNYFVGTIPDDIDSLSRLS  145

Query  545  SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             LNL  N   G IP  +     L +L +  N  +G+ P +IGN   L  L ++ N
Sbjct  146  YLNLCANNFTGNIPAAIGRIPELRTLYLHDNLFDGTFPAEIGNLSKLEELYMAHN  200


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 71/136 (52%), Gaps = 2/136 (1%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPAS--AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            G+++++    M   G  P+   +   QL  L  +  S  +L G IP  +     LE LDL
Sbjct  187  GNLSKLEELYMAHNGFLPSKLPSSFTQLKKLRELWISEANLIGEIPQMVGEMVALERLDL  246

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDI  664
            S N+LTG I    F +K L+ L L  N+L GEIP  + A +   +D+S N+L G+IP D 
Sbjct  247  SKNELTGSIPDGLFMLKNLKFLFLYKNLLSGEIPQVVEALNSIVIDLSWNNLTGTIPVDF  306

Query  665  GNFYNLSYLDLSMNSL  712
            G    LS L LS N L
Sbjct  307  GKLDKLSGLSLSFNQL  322


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 70/134 (52%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++ R+ LS+  + GS P    +  L NL  +    N L G IP  + + + +  +DLS N
Sbjct  240  ALERLDLSKNELTGSIPDGLFM--LKNLKFLFLYKNLLSGEIPQVVEALNSI-VIDLSWN  296

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  +F  +  L  L+L  N L GEIP  +    +L+   + SN+L+G IP D+G 
Sbjct  297  NLTGTIPVDFGKLDKLSGLSLSFNQLSGEIPESIGRLPALKDFALFSNNLSGPIPPDLGR  356

Query  671  FYNLSYLDLSMNSL  712
            +  L    ++ N L
Sbjct  357  YSALEGFQVATNRL  370


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +    N L G +P+++ S   L T++LS N L+G+I  E   +
Sbjct  490  GTIPLE--LTALPNLTVLLLDKNQLTGALPSDIISWKSLTTINLSQNQLSGQIPEEIAIL  547

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
              L  L+L  N   G+IP  +    L  L++SSN L G IP +  N  Y+ S+L+
Sbjct  548  PDLLELDLSDNQFSGQIPPQLGLLRLTYLNLSSNHLVGKIPAEYENAAYSSSFLN  602



>ref|XP_011036960.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Populus euphratica]
Length=1022

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 105/198 (53%), Gaps = 24/198 (12%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNS-NGSVTRISLSEMIMGGSFPA  367
            D+ A+L +  Q    P +    WN+ SSPC+W  +SCN  N  V  + LS + + GS   
Sbjct  38   DKEALLSLKSQVTTDPSNTLFSWNNNSSPCNWTRVSCNQVNQRVVGLDLSGLRLTGSISP  97

Query  368  SA----------------------IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            +                        I  L+ L  +N S NS+ G IP N++ C  L+ LD
Sbjct  98   NIGNLSFLRSLHLQGNQFTGLIPDQIGALSRLSVLNISFNSITGRIPLNITKCLNLQILD  157

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPD  658
            L  N+++G I  E  ++K+L  L L GN L+G IP       SL +L++++N+L G IPD
Sbjct  158  LMQNEISGAIPEELSNLKSLEILKLGGNKLWGTIPPSFANITSLLTLNLATNNLGGMIPD  217

Query  659  DIGNFYNLSYLDLSMNSL  712
            D G F NL++LDLS+N+L
Sbjct  218  DFGRFKNLNHLDLSINNL  235


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 73/135 (54%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  +++S   + G  P    I +L NL  ++ ++N + G IP +L    KL  +DLS N
Sbjct  400  SLALLNISYNYVSGEIPPE--IGELTNLQELHLAANKISGRIPNSLGKLQKLNEIDLSTN  457

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS--LESLDVSSNDLNGSIPDDIG  667
            DL G +   F + + L S++L  N + G IP  + + S    +L++S N L GS+P +I 
Sbjct  458  DLVGSLPTTFVNFQQLVSMDLSSNRINGSIPKEIFSLSSLSATLNLSGNQLTGSLPQEIK  517

Query  668  NFYNLSYLDLSMNSL  712
               N++ +D S N L
Sbjct  518  GLENVAAVDFSHNHL  532


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 69/122 (57%), Gaps = 4/122 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PAS  I  L +L  +N S N + G IP  +   + L+ L L+ N ++G+I      +
Sbjct  389  GRIPAS--IRHLRSLALLNISYNYVSGEIPPEIGELTNLQELHLAANKISGRIPNSLGKL  446

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSY-LDLSMN  706
            + L  ++L  N L G +PT  V +  L S+D+SSN +NGSIP +I +  +LS  L+LS N
Sbjct  447  QKLNEIDLSTNDLVGSLPTTFVNFQQLVSMDLSSNRINGSIPKEIFSLSSLSATLNLSGN  506

Query  707  SL  712
             L
Sbjct  507  QL  508


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 4/106 (4%)
 Frame = +2

Query  365  ASAIICQLNNLVSI---NFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            + AI  +L+NL S+       N LWGTIP + ++ + L TL+L+ N+L G I  +F   K
Sbjct  164  SGAIPEELSNLKSLEILKLGGNKLWGTIPPSFANITSLLTLNLATNNLGGMIPDDFGRFK  223

Query  536  TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
             L  L+L  N L G +P  +    SL  L V+SN L G IP D+G+
Sbjct  224  NLNHLDLSINNLTGNVPLSLYNISSLVFLAVASNQLRGEIPVDVGD  269


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 4/131 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNL-VSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            + LS   + GS P    I  L++L  ++N S N L G++P  +     +  +D S N L+
Sbjct  476  MDLSSNRINGSIPKE--IFSLSSLSATLNLSGNQLTGSLPQEIKGLENVAAVDFSHNHLS  533

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYN  679
            G I       K+L  L +  NM  G IP  +     LE LD+SSN ++G IP+++ N   
Sbjct  534  GSIPDTIGGWKSLEKLFMENNMFSGVIPATLGDVKGLEILDLSSNQISGIIPNNLENLQA  593

Query  680  LSYLDLSMNSL  712
            L  L+LS N L
Sbjct  594  LHLLNLSFNDL  604



>ref|XP_008242543.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=938

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 102/186 (55%), Gaps = 12/186 (6%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW---NSTSSPCDW-PGISCNSNGSVTRIS  331
            SQSL    + E+A+LL LK +   P      W    S +S C W P I+C +N SVT +S
Sbjct  30   SQSLQ---DQEQAVLLKLKSYLQSP-PFLSHWIPSTSNTSHCSWRPEITC-TNNSVTGLS  84

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L +M +  S P    IC L NL  ++ S N   G  P  L +CSKLE LDLS N   GKI
Sbjct  85   LVDMNITLSVPP--FICDLKNLTLVDLSYNYFPGEFPKALYNCSKLEYLDLSQNYFVGKI  142

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
              +  S+  LR L+L GN   G+IP  +   + L +L +  N+ NGS+P +IGN  NL  
Sbjct  143  PDDIDSLPRLRYLSLAGNNFSGDIPAAIGRLHELRNLQLFMNEFNGSVPPEIGNLSNLKD  202

Query  689  LDLSMN  706
            L+LS N
Sbjct  203  LNLSSN  208


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL NL ++    ++L G +P  L   + LE LDL+ N L G I    F +K L  + L  
Sbjct  222  QLKNLKTLWIRESNLIGQLPRTLGEMAALEELDLAKNRLNGAIPSCLFLLKNLSIIYLFK  281

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            N L G+IP  + A +L+ +D+S N L G IP+D G    L+ L L  N
Sbjct  282  NRLSGDIPQVVEALNLKVIDLSDNLLTGPIPEDYGKLTKLTGLALFYN  329


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P    +C L  LV +    N+L G +P++L +C+ L  + +  N    K  G F 
Sbjct  379  LAGKLPDH--LCYLGKLVGLVAHENNLTGELPSSLGNCTSLVIVKVYDNGFLRKCLGIFR  436

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
              K+   +    N L G +P+ ++++ SL +L+ S N L+G IP+ +G    L+ LDLS 
Sbjct  437  GWKS--EITGFQNQLTGFLPSEIISWKSLNTLNFSGNQLSGPIPEKLGLLPVLTELDLSE  494

Query  704  NSL  712
            N L
Sbjct  495  NQL  497


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = +2

Query  416  SNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM  595
             N L G +P+ + S   L TL+ S N L+G I  +   +  L  L+L  N L G+IP  +
Sbjct  446  QNQLTGFLPSEIISWKSLNTLNFSGNQLSGPIPEKLGLLPVLTELDLSENQLSGQIPALL  505

Query  596  VAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
                L   ++SSN L+G IP +  N  Y+ S+LD
Sbjct  506  GRLKLNHFNLSSNHLSGKIPFEFENPAYDRSFLD  539



>ref|XP_010910207.1| PREDICTED: receptor-like protein kinase HSL1, partial [Elaeis 
guineensis]
Length=711

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 99/185 (54%), Gaps = 7/185 (4%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTS--SPCDWPGISCNSNGSVTRISLS  337
            + S T   + ER ILL +++ WG P S+   WN ++    C W GI C+++GSVT I+LS
Sbjct  22   AASQTKTEDGERQILLRIRKDWGNP-SVLGSWNDSTPTRHCKWTGIQCSADGSVTNITLS  80

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
               +    PA+  IC+L NL  ++ S N + GT P +L +CS L  LDLS N L G I  
Sbjct  81   NQNIAQPIPAA--ICKLKNLSILDLSYNDIPGTFPTSLYNCSNLLYLDLSSNHLVGVIPS  138

Query  518  EFFSMK-TLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYL  691
            + + +   L  L L  N   GEIP  +   S +E L + +N  N S P  +GN  NL  L
Sbjct  139  DIYRLSPRLTDLILSDNNFTGEIPPSIGRLSAIEHLSLYTNFFNASFPAGLGNLSNLQTL  198

Query  692  DLSMN  706
             L  N
Sbjct  199  RLGRN  203


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L +  + GS PA   I  L +L  +    N   G IP ++   +++  L L+ N L+G I
Sbjct  249  LQQNSLSGSIPAG--IWNLKSLSVLYMFDNRFSGEIPESIGELTEMTELALAENSLSGSI  306

Query  512  AGEFFSMKTLRSLNLRGNMLFGEI--PTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
                +++K LR+L L  N L G I    P+ A  LE +DVS+N LNGS P++ G   NL+
Sbjct  307  PNGIWNLKKLRTLYLYANNLTGAINIDRPIGALGLEQIDVSANQLNGSFPEEFGKLQNLA  366

Query  686  YLDL  697
             LD+
Sbjct  367  ILDM  370


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 64/117 (55%), Gaps = 3/117 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ G+ P   ++  ++ LV +    N + G IP  +S    L  L+LS N L G+I    
Sbjct  417  LLSGNIPV--VLTGISELVVLYLGGNQISGQIPPGISELKYLSVLNLSSNHLVGEIPAAI  474

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYL  691
             S++ L+SL+L  N L G IP+ +    L  L++SSN L+G IP  + +  YN S+L
Sbjct  475  GSLQVLKSLDLSTNQLSGSIPSEIGDLRLPKLNLSSNRLSGEIPISLQDAAYNRSFL  531


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 67/157 (43%), Gaps = 32/157 (20%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + +I +S   + GSFP      +L NL  ++   N   GT+P  L     L  LD++ N 
Sbjct  341  LEQIDVSANQLNGSFPEE--FGKLQNLAILDMFDNRFSGTLPDKLPP--GLRWLDIANNK  396

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-----------------------  607
             +G I     + K+LRSL    N+L G IP  +   S                       
Sbjct  397  FSGNIPS---TAKSLRSLTAYNNLLSGNIPVVLTGISELVVLYLGGNQISGQIPPGISEL  453

Query  608  --LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              L  L++SSN L G IP  IG+   L  LDLS N L
Sbjct  454  KYLSVLNLSSNHLVGEIPAAIGSLQVLKSLDLSTNQL  490



>gb|KDP33800.1| hypothetical protein JCGZ_07371 [Jatropha curcas]
Length=978

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 102/182 (56%), Gaps = 9/182 (5%)
 Frame = +2

Query  170  SLTTYGED-ERAILLILKQHWGYPFSLFEQWN--STSSPCDWPGISCNSNG-SVTRISLS  337
            +L  Y  D E+ ILL LKQHW  P S+  QW+  ++SS C WPG++C+SN  S++ + L+
Sbjct  21   TLLAYAFDHEKEILLGLKQHWRNP-SVLHQWSPSTSSSYCTWPGVNCSSNNFSISGLRLA  79

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
             M + G+ P    IC L +L  ++F +NS  GT P +L +CS LE L+L+ N   GK+  
Sbjct  80   NMNISGTIPP--FICDLKDLKVVDFYNNSFTGTFPVSLLNCSNLEHLNLAQNYFVGKLPD  137

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
            +   +  L  LNL  N   G +P  +     L +L +  N  NG  P +IG  +NL  L 
Sbjct  138  DIDLLSRLSYLNLYANNFTGNVPVAIGRLQELRNLLLQQNQFNG-FPSEIGELFNLEVLY  196

Query  695  LS  700
            ++
Sbjct  197  MA  198


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  + FS+++L G IP  +     LE LDLS N+L+GKI      +K L  L L  
Sbjct  213  QLKKLKELWFSNSNLIGEIPHMIGEMVALERLDLSGNELSGKIPSSLLMLKNLSVLYLYK  272

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L+GEIP  + A +L  +D+S N+L G+IPDD G    LS L L  N L
Sbjct  273  NKLYGEIPHVVEALNLTVIDLSDNNLTGTIPDDFGKLTKLSELQLFFNQL  322


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ +S     G  P         NLV  N S+N L GTIP  L++   L TL L  N 
Sbjct  454  LQRLEISNNRFSGKIPTGD---SWRNLVVFNASNNQLSGTIPQELTALPFLTTLLLDRNQ  510

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
            L+G I  +  S K+L +LNL  N L GEIP  +    +L +LD+S+N ++G IP    + 
Sbjct  511  LSGAIPSDIISWKSLNTLNLSRNQLSGEIPGELAFLPTLVALDLSNNQISGKIPPQCSSL  570

Query  674  YNLSYLDLSMNSL  712
              L++L+LS N L
Sbjct  571  -KLTFLNLSSNHL  582


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 66/117 (56%), Gaps = 3/117 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P    +  L  L ++    N L G IP+++ S   L TL+LS N L+G+I GE  
Sbjct  487  LSGTIPQE--LTALPFLTTLLLDRNQLSGAIPSDIISWKSLNTLNLSRNQLSGEIPGELA  544

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
             + TL +L+L  N + G+IP    +  L  L++SSN L+G IP +  N  YN S+L+
Sbjct  545  FLPTLVALDLSNNQISGKIPPQCSSLKLTFLNLSSNHLSGEIPSEFQNAAYNNSFLN  601


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (55%), Gaps = 4/119 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++ R+ LS   + G  P+S ++  L NL  +    N L+G IP  + + + L  +DLS N
Sbjct  240  ALERLDLSGNELSGKIPSSLLM--LKNLSVLYLYKNKLYGEIPHVVEALN-LTVIDLSDN  296

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG  667
            +LTG I  +F  +  L  L L  N L GEIP  +    +L ++ + SN+L+G IP + G
Sbjct  297  NLTGTIPDDFGKLTKLSELQLFFNQLSGEIPEGIARLPALVNISLFSNNLSGLIPQEFG  355



>ref|XP_011015844.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein 
kinase At2g41820 [Populus euphratica]
Length=888

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 11/184 (6%)
 Frame = +2

Query  170  SLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSP-CDWPGISCNSNGS-VTRISLSEM  343
             L T   DE+AILL +K+  G P      W + ++  C+W GI+C  N S V  + LS +
Sbjct  19   QLVTAQMDEQAILLAIKRELGVP-----GWGANNTNYCNWAGINCGLNHSMVEGLDLSRL  73

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             + G+     ++ +L  L  ++ SSNS  G IP+   + S+LE LDLS+N   G I  E 
Sbjct  74   GLRGNV---TLVSELKALKQLDLSSNSFHGEIPSAFGNLSQLEFLDLSLNKFGGVIPMEL  130

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
             S++ L+SLNL  NML G IP        LE   +SSN LNGSIP  +GN  NL      
Sbjct  131  GSLRNLKSLNLSNNMLVGWIPDEFQGLEKLEDFQISSNKLNGSIPSWVGNLTNLRVFTAY  190

Query  701  MNSL  712
             N L
Sbjct  191  ENEL  194


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P +  I  +++L     ++N + G I +  + CS L  L+L+ N  TG I  E   +
Sbjct  268  GVIPKA--IGNVSSLTYFEVANNHISGEIVSEFARCSNLTLLNLASNGFTGVIPPELGQL  325

Query  533  KTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L+ L L GN LFG+IP  ++   SL  LD+S+N  NG++P+DI N   L YL L  NS
Sbjct  326  VNLQELILSGNSLFGDIPISIIGCKSLNKLDLSNNRFNGTVPNDICNMSRLQYLLLGQNS  385

Query  710  L  712
            +
Sbjct  386  I  386


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL NL  +  S NSL+G IP ++  C  L  LDLS N   G +  +  +M  L+ L L  
Sbjct  324  QLVNLQELILSGNSLFGDIPISIIGCKSLNKLDLSNNRFNGTVPNDICNMSRLQYLLLGQ  383

Query  563  NMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSY-LDLSMNSL  712
            N + GEIP  +     L  L + SN L GSIP +IG+  NL   L+LS N L
Sbjct  384  NSIKGEIPHEIGNCMKLLELQMGSNYLTGSIPPEIGHIRNLQIALNLSFNHL  435


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ ++ LS     G+ P    IC ++ L  +    NS+ G IP  + +C KL  L +  N
Sbjct  351  SLNKLDLSNNRFNGTVPND--ICNMSRLQYLLLGQNSIKGEIPHEIGNCMKLLELQMGSN  408

Query  494  DLTGKIAGEFFSMKTLR-SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG  667
             LTG I  E   ++ L+ +LNL  N L G +P  +     L SLDVS+N L+G+IP    
Sbjct  409  YLTGSIPPEIGHIRNLQIALNLSFNHLHGALPPELGKLDKLVSLDVSNNQLSGTIPPSFK  468

Query  668  NFYNLSYLDLSMN  706
               +L  ++ S N
Sbjct  469  GMLSLIEVNFSNN  481



>ref|XP_011033329.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein 
kinase At2g41820 [Populus euphratica]
Length=888

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 11/184 (6%)
 Frame = +2

Query  170  SLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSP-CDWPGISCNSNGS-VTRISLSEM  343
             L T   DE+AILL +K+  G P      W + ++  C+W GI+C  N S V  + LS +
Sbjct  19   QLVTAQMDEQAILLAIKRELGVP-----GWGANNTNYCNWAGINCGLNHSMVEGLDLSRL  73

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             + G+     ++ +L  L  ++ SSNS  G IP+   + S+LE LDLS+N   G I  E 
Sbjct  74   GLRGNV---TLVSELKALKQLDLSSNSFHGEIPSAFGNLSQLEFLDLSLNKFGGVIPMEL  130

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
             S++ L+SLNL  NML G IP        LE   +SSN LNGSIP  +GN  NL      
Sbjct  131  GSLRNLKSLNLSNNMLVGWIPDEFQGLEKLEDFQISSNKLNGSIPSWVGNLTNLRVFTAY  190

Query  701  MNSL  712
             N L
Sbjct  191  ENEL  194


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P +  I  +++L     ++N + G I +  + CS L  L+L+ N  TG I  E   +
Sbjct  268  GVIPKA--IGNVSSLTYFEVANNHISGEIVSEFARCSNLTLLNLASNGFTGVIPPELGQL  325

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L+ L L GN L+G+IP  ++ + SL  LD+S+N  NG++P+DI N   L +L L  NS
Sbjct  326  ANLQELILSGNSLYGDIPKSILGWKSLNKLDLSNNRFNGTVPNDICNMSRLQFLLLGQNS  385

Query  710  L  712
            +
Sbjct  386  I  386


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL NL  +  S NSL+G IP ++     L  LDLS N   G +  +  +M  L+ L L  
Sbjct  324  QLANLQELILSGNSLYGDIPKSILGWKSLNKLDLSNNRFNGTVPNDICNMSRLQFLLLGQ  383

Query  563  NMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSY-LDLSMNSL  712
            N + GEIP  +     L  L + SN L GSIP +IG+  NL   L+LS N L
Sbjct  384  NSIKGEIPHEIGNCMKLLELQMGSNYLTGSIPPEIGHIRNLQIALNLSFNHL  435


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ ++ LS     G+ P    IC ++ L  +    NS+ G IP  + +C KL  L +  N
Sbjct  351  SLNKLDLSNNRFNGTVPND--ICNMSRLQFLLLGQNSIKGEIPHEIGNCMKLLELQMGSN  408

Query  494  DLTGKIAGEFFSMKTLR-SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG  667
             LTG I  E   ++ L+ +LNL  N L G +P  +     L SLDVS+N L+G+IP    
Sbjct  409  YLTGSIPPEIGHIRNLQIALNLSFNHLHGALPPELGKLDKLVSLDVSNNQLSGTIPPSFK  468

Query  668  NFYNLSYLDLSMN  706
               +L  ++ S N
Sbjct  469  GMLSLIEVNFSNN  481



>emb|CBI20587.3| unnamed protein product [Vitis vinifera]
Length=944

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 99/172 (58%), Gaps = 6/172 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            +DER+ILL +KQ  G P    + WNS+SSPCDW  I+C  N +VT ISL    +    PA
Sbjct  275  DDERSILLDVKQQLGNP-PSLQSWNSSSSPCDWREITCTDN-TVTAISLHNKTIREKIPA  332

Query  368  SAIICQLNNLV--SINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            +  IC L NL+   +  +  +L G IP + +  S LE LDLS+N L G I G   ++K L
Sbjct  333  T--ICDLKNLILKYLWMTQANLIGEIPESFNHLSSLEHLDLSLNKLEGTIPGVMLTLKNL  390

Query  542  RSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
             +L L  N L G IP+ + A +L+ +D+S N L GSIP   G   NL+   L
Sbjct  391  TNLYLFNNRLSGRIPSSIEALNLKEIDLSKNHLTGSIPAGFGKLQNLTAFGL  442


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 80/162 (49%), Gaps = 29/162 (18%)
 Frame = +2

Query  308  NGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLS  487
            +  + R  +S+  + G  P    +C    L+ +  S+N+L G +P +L +C+ L T+ LS
Sbjct  443  HSELKRFEVSKNKLSGELPQH--LCARGALLGVVASNNNLSGEVPKSLGNCTSLLTIQLS  500

Query  488  IN--------------------------DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT  589
             N                            +GKI  E  S++ +  + L GN   GE+P+
Sbjct  501  NNRFSGEIPSDIWTSPDMIWVIVEISNNKFSGKIPVELTSLRNISVMLLDGNQFSGELPS  560

Query  590  PMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             ++++ SL +L++S N L+G IP  +G+  NL+YLDLS N  
Sbjct  561  EIISWKSLNNLNLSRNKLSGPIPKALGSLPNLNYLDLSENQF  602



>ref|NP_174166.1| receptor-like protein kinase HSL1 [Arabidopsis thaliana]
 sp|Q9SGP2.1|HSL1_ARATH RecName: Full=Receptor-like protein kinase HSL1; AltName: Full=Protein 
HAESA-LIKE1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF16764.1|AC010155_17 F3M18.12 [Arabidopsis thaliana]
 gb|AAM13234.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAP68247.1| At1g28440 [Arabidopsis thaliana]
 dbj|BAE99237.1| hypothetical protein [Arabidopsis thaliana]
 gb|ACN59235.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE30977.1| receptor-like protein kinase HSL1 [Arabidopsis thaliana]
Length=996

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 98/171 (57%), Gaps = 5/171 (3%)
 Frame = +2

Query  203  ILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCNSN-GSVTRISLSEMIMGGSFPASAI  376
            IL  +K     P S    WNS  +SPC W G+SC  +  SVT + LS   + G FP+  +
Sbjct  22   ILQQVKLSLDDPDSYLSSWNSNDASPCRWSGVSCAGDFSSVTSVDLSSANLAGPFPS--V  79

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            IC+L+NL  ++  +NS+  T+P N+++C  L+TLDLS N LTG++      + TL  L+L
Sbjct  80   ICRLSNLAHLSLYNNSINSTLPLNIAACKSLQTLDLSQNLLTGELPQTLADIPTLVHLDL  139

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             GN   G+IP     +  LE L +  N L+G+IP  +GN   L  L+LS N
Sbjct  140  TGNNFSGDIPASFGKFENLEVLSLVYNLLDGTIPPFLGNISTLKMLNLSYN  190


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + QL+ LV ++ + N L G IP +L   + +  ++L  N LTG+I
Sbjct  212  LTECHLVGQIPDS--LGQLSKLVDLDLALNDLVGHIPPSLGGLTNVVQIELYNNSLTGEI  269

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G+IP  +    LESL++  N+L G +P  I    NL  +
Sbjct  270  PPELGNLKSLRLLDASMNQLTGKIPDELCRVPLESLNLYENNLEGELPASIALSPNLYEI  329

Query  692  DLSMNSL  712
             +  N L
Sbjct  330  RIFGNRL  336


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 2/113 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S     GS P S  +  L  L +++   N   G + + + S  KL  L+L+ N+
Sbjct  470  LNQLSASGNKFSGSLPDS--LMSLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNE  527

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
             TGKI  E  S+  L  L+L GNM  G+IP  + +  L  L++S N L+G +P
Sbjct  528  FTGKIPDEIGSLSVLNYLDLSGNMFSGKIPVSLQSLKLNQLNLSYNRLSGDLP  580


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 83/164 (51%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPF-SLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P  +L E  N++ S      I   SN S+  +S +E    GS P    I  L+NL  
Sbjct  417  WGLPHVNLLELVNNSFSGEISKSIGGASNLSLLILSNNEFT--GSLPEE--IGSLDNLNQ  472

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N   G++P +L S  +L TLDL  N  +G++     S K L  LNL  N   G+I
Sbjct  473  LSASGNKFSGSLPDSLMSLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNEFTGKI  532

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  + +   L+ L+LS N L
Sbjct  533  PDEIGSLSVLNYLDLSGNMFSGKIPVSLQSL-KLNQLNLSYNRL  575



>ref|XP_009387282.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=261

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 96/191 (50%), Gaps = 20/191 (10%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGY----PFSLFEQWNSTSSPCDWPGISCN------SNGSVTR  325
             + G   RA+L     HW      P SL   WN  SSPC+W G++CN          VT 
Sbjct  29   ASLGSQGRALL-----HWKATLRSPQSL-RSWNLNSSPCNWTGVTCNYPVAGRGRSVVTE  82

Query  326  ISLSEMIMGGSFPASAI-ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            ISL  M + G  P  A+    L +L+ +N S N L G IP  +S+ S+L +LD + N   
Sbjct  83   ISLPRMGLAG--PLDALDFSALGSLLRLNLSYNQLGGAIPPTISALSRLVSLDFTSNQFR  140

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYN  679
             KI     SMK LR L+L  N + G IP  +   + L SL +  N L G IP ++G  + 
Sbjct  141  SKIPVGIGSMKELRFLSLSQNQMVGAIPPSLSNLTVLVSLHLEDNKLVGVIPKELGRLHE  200

Query  680  LSYLDLSMNSL  712
            L YLD+ +N L
Sbjct  201  LMYLDIGVNRL  211


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 3/108 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SLS+  M G+ P S  +  L  LVS++   N L G IP  L    +L  LD+ +N L+G
Sbjct  156  LSLSQNQMVGAIPPS--LSNLTVLVSLHLEDNKLVGVIPKELGRLHELMYLDIGVNRLSG  213

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNG  646
             I     ++  L  L+L  N L G IP  +    +L  L ++ N+L G
Sbjct  214  SIPSNLGNLTKLYHLDLYQNQLIGVIPRELKNLVNLVYLSIADNNLTG  261



>ref|XP_011078428.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1153

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 98/184 (53%), Gaps = 5/184 (3%)
 Frame = +2

Query  170  SLTTYGEDERAILLILKQHWGYPFSLFEQ-WNSTSSPCDWPGISCNS-NGSVTRISLSEM  343
            +LT    DE A+L +  +    P  +  + W+ ++S C W G++C S +  VT + +S M
Sbjct  2    ALTNITTDESALLALKSRLAIDPSHILSRNWSDSTSVCSWIGVTCGSRHQRVTALDISTM  61

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             + G+ P    +  L  LVS+N SSNS  G++P  L+   +LE +D   ND  G +   F
Sbjct  62   GLAGNLPPD--MGNLTFLVSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWF  119

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
              +  L+ LNLR N   G  PT +   S LE LD+S N L G IPD+IGN +NL  L L 
Sbjct  120  GFLGELQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYNSLQGKIPDEIGNLHNLKRLSLQ  179

Query  701  MNSL  712
             N  
Sbjct  180  FNKF  183


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = +2

Query  281  DWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSC  460
            D  G  C S   +  + LS   + G  P++  I Q + L  ++ S N   G++P+ + + 
Sbjct  210  DLQGDLCGSLPRLIELYLSSNELDGQIPSN--ISQCSQLRLLSLSHNKFSGSVPSGIGNL  267

Query  461  SKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSND  637
            + LE L L  NDLTG+I  E   ++ L+ L +  N L G IP+ +    SL+ +++++ +
Sbjct  268  TALEILYLGSNDLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISSLQYINIANCN  327

Query  638  LNGSIPDDI  664
            L G++P D+
Sbjct  328  LTGALPADM  336


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 1/106 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L  L+ +  SSN L G IP+N+S CS+L  L LS N  +G +     ++  L  L L  N
Sbjct  219  LPRLIELYLSSNELDGQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSN  278

Query  566  MLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
             L G+IP  +    +L+ L +  N L GSIP  I N  +L Y++++
Sbjct  279  DLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISSLQYINIA  324


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 61/111 (55%), Gaps = 1/111 (1%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +LN+L+ +N +SN L G++  ++ +      LDLS+N  +G I      M  L +L+L  
Sbjct  681  RLNDLLQLNLTSNVLVGSLSPDIGNLKTATVLDLSMNQFSGTIPPSVGDMHDLINLSLAH  740

Query  563  NMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N   G IP  +    +L  LD+S N+L+G+IP  +     L+Y ++S N L
Sbjct  741  NKFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSLERILYLTYFNVSFNDL  791


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 69/135 (51%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQ-LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
            S+  I+++   + G+ PA   +C   + L  + F  N L G +P  +  CS L+T  LS 
Sbjct  317  SLQYINIANCNLTGALPAD--MCSGSSRLQEVFFHVNELVGELPERIGECSALQTWSLSY  374

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIG  667
            N++TG I     ++  L++  +  N L G IP  +    SL+ L +  N+L GSIP +I 
Sbjct  375  NNITGVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNLQSLQVLYLGVNNLRGSIPTEIF  434

Query  668  NFYNLSYLDLSMNSL  712
            N   L  + + MN L
Sbjct  435  NISTLQSITVLMNQL  449


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANL-SSCSKLETLDLSIN  493
            + R+SL      G  P +  I  +++L S+  + NSL G +  +L  S  +L  L LS N
Sbjct  173  LKRLSLQFNKFDGLIPTT--IFNISSLESLALTGNSLSGDLQGDLCGSLPRLIELYLSSN  230

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +L G+I         LR L+L  N   G +P+ +    +LE L + SNDL G IP+++G+
Sbjct  231  ELDGQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDLTGQIPEELGD  290

Query  671  FYNLSYLDLSMNSL  712
              NL  L +  N L
Sbjct  291  LRNLKELGMGDNFL  304



>ref|XP_008780256.1| PREDICTED: receptor-like protein kinase HSL1, partial [Phoenix 
dactylifera]
Length=273

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 103/186 (55%), Gaps = 10/186 (5%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSP--CDWPGISCNSNGSVTRISLS  337
            SQ  TT GE  R ILL +K+ W  P S  E WN+++S   C W GI C++NGSVT I+L 
Sbjct  24   SQPATTDGE--RQILLQIKKDWRNP-SALESWNNSTSANHCTWTGIGCSANGSVTNITLV  80

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
               +    PA+  IC+L +L  ++ S N +  + P +L +CSKL+ LDLS N   G I  
Sbjct  81   NQNISQPIPAT--ICELRSLSFLDLSYNYITTSFPKSLYNCSKLQYLDLSQNYFVGVIPS  138

Query  518  EFFSMK-TLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
            + + +   L +L L  N L G+IP  +  +   +E L +  N  N S P ++GN  NL  
Sbjct  139  DIYRLSPRLTTLILSANNLTGDIPRSIGRLPAMIEYLALDDNLFNVSFPAELGNLSNLQT  198

Query  689  LDLSMN  706
            L L+ N
Sbjct  199  LWLAYN  204



>gb|KEH27214.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=953

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 100/183 (55%), Gaps = 5/183 (3%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCD-WPGISCNSNGSVTRISLSE  340
            SQS       E   L+ +KQH+  P +L    +S +S C  WP I+C +NGSVT ++L  
Sbjct  24   SQSQQNLHNQEHETLMKIKQHFQNPPNLNHWTSSNTSYCSSWPEITC-TNGSVTGLTLFN  82

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
              +  + P+   IC L NL  ++F++N + G  P +L +CSKLE LDLS+N+  GKI   
Sbjct  83   YNINQTIPS--FICDLKNLTHVDFNNNYIPGMFPTDLYNCSKLEYLDLSMNNFVGKIPEN  140

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
             F++  L  LNL       +IP+ +     L  L +     NG+ PD+IG+  NL  LDL
Sbjct  141  IFTLSNLNYLNLSYTNFTDDIPSSIGKLKKLRFLALQVCLFNGTFPDEIGDLVNLETLDL  200

Query  698  SMN  706
            S N
Sbjct  201  SNN  203


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L+G +P ++     LE LD+S N LTGKI    F +K LR L L  N L GE+P  + A 
Sbjct  230  LFGEMPESMGEMVSLEDLDISQNGLTGKIPSGLFMLKNLRRLLLATNDLSGELPDVVEAL  289

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L +++++ N+L G IPDD G    L+ L LS+N+ 
Sbjct  290  NLTNIELTQNNLTGKIPDDFGKLQKLTELSLSLNNF  325


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 58/109 (53%), Gaps = 6/109 (6%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            N+V    S N+L G+IP  ++S  KL+TL L  N L G +  +  S  +L +LNL  N L
Sbjct  480  NVVEFIASKNNLNGSIPQEITSLHKLQTLSLDQNQLKGPLPFDVISWNSLLTLNLSQNQL  539

Query  572  FGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GEIP   + Y   L  LD+S N  +G IP        ++ LDLS N L
Sbjct  540  SGEIPAS-IGYLPDLSVLDLSDNQFSGEIPSIAP---RITVLDLSSNRL  584


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 61/134 (46%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +T +SLS     G  P S  I QL +L+      N+L GT+P +    SKL +  ++ N
Sbjct  314  KLTELSLSLNNFSGEIPQS--IGQLPSLIDFKVFMNNLSGTLPPDFGLHSKLRSFHVTTN  371

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
               G++         L++L    N L GE+P  +    SL  + +  ND  G+IP  +  
Sbjct  372  RFEGRLPENLCYHGELQNLTAYENHLSGELPESLGNCSSLLEMKIYKNDFYGNIPSGLWR  431

Query  671  FYNLSYLDLSMNSL  712
              NL Y  +S N  
Sbjct  432  SENLGYFMISHNKF  445



>ref|XP_010062723.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 [Eucalyptus grandis]
Length=1120

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 99/188 (53%), Gaps = 5/188 (3%)
 Frame = +2

Query  155  PNYSQSLTTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRIS  331
            P Y   +T   E E + LL  K     P    + WN S   PC+W GI+C+ +  V  ++
Sbjct  35   PFYVLVVTCLNE-EGSTLLEFKSSLIDPNDNLQNWNFSDPDPCNWTGIACSVDSKVISVN  93

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L  + + GS   S I+C +  LV +N S N   G IP  ++ C KLE LDL  N   G++
Sbjct  94   LHRLSLSGSL--SPILCGMPELVELNVSKNLFSGPIPPEIAQCGKLEILDLCTNKFHGEL  151

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSY  688
                 ++ TLR L+L  N L+G+IP+ +   S LE L++ SN+L G IP  IGN  +L  
Sbjct  152  PVPLSNITTLRKLSLCENYLYGDIPSEIGRLSMLEELELYSNNLTGPIPQMIGNLKSLRI  211

Query  689  LDLSMNSL  712
            +    NSL
Sbjct  212  IRAGSNSL  219


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 61/118 (52%), Gaps = 1/118 (1%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P   +I  L +L  I   SNSL G IP+ +  C  L+ L L+ N L G +  E + ++ L
Sbjct  198  PIPQMIGNLKSLRIIRAGSNSLSGVIPSEIGECESLQVLGLAQNRLQGPLPRELYKLQNL  257

Query  542  RSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             SL L  N+L GE+P  M   S LE L +  N L+G+IP + G    L  L L  N L
Sbjct  258  SSLLLYQNILSGEVPPEMGNMSNLELLALYKNSLSGAIPKEFGKLTRLKRLYLYTNEL  315


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 70/135 (52%), Gaps = 5/135 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    + ++ NL  ++   N L G+IP+ L     LE+LDLSIN
Sbjct  328  SAVEIDLSENQLSGIIPKE--LGRIPNLRLVHLFENLLQGSIPSELGQLRLLESLDLSIN  385

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIG  667
            +LTG I     ++  L    L  N L G IP P++    +L  LD+S+N L G IP  + 
Sbjct  386  NLTGTIPIGLQNLTYLIDFQLFDNQLHGTIP-PLLGLNTNLSILDLSANKLVGRIPAHLC  444

Query  668  NFYNLSYLDLSMNSL  712
             + +L +L +  N L
Sbjct  445  QYQSLMFLSIGSNHL  459


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 73/160 (46%), Gaps = 30/160 (19%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             + R+ LS+    G  P    +  L  LV+ N SSN L G+IP  L +C +L+ LDLS N
Sbjct  520  KLERLLLSDNNFVGVIPPE--LGDLVQLVAFNVSSNRLSGSIPLELGNCIRLQRLDLSRN  577

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM--------------------------  595
              +G +  E   +  L  L L  N L G+IP+ +                          
Sbjct  578  RFSGSLPKELGMLVNLELLKLSDNRLTGQIPSTLGNLRRLTELQMGGNLFSGGIPFEFGH  637

Query  596  -VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              A  + +L+VS N+L GSIP+ +GN   L  L L+ N L
Sbjct  638  LTALQI-ALNVSHNNLTGSIPEQLGNLQMLESLYLNDNQL  676


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 6/116 (5%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P      +L  L  +   +N L GTIP  L  C     +DLS N L+G I  E  
Sbjct  291  LSGAIPKE--FGKLTRLKRLYLYTNELNGTIPRELGDCVSAVEIDLSENQLSGIIPKELG  348

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYL  691
             +  LR ++L  N+L G IP+ +     LESLD+S N+L G+IP  IG   NL+YL
Sbjct  349  RIPNLRLVHLFENLLQGSIPSELGQLRLLESLDLSINNLTGTIP--IG-LQNLTYL  401


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 53/108 (49%), Gaps = 1/108 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L  L+      N L GTIP  L   + L  LDLS N L G+I       ++L  L++  N
Sbjct  398  LTYLIDFQLFDNQLHGTIPPLLGLNTNLSILDLSANKLVGRIPAHLCQYQSLMFLSIGSN  457

Query  566  MLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             L G IP  + V  SL  L +  N L GS+P ++    NLS L+L  N
Sbjct  458  HLSGNIPHNLKVCKSLARLMLGDNQLTGSLPVELQKLQNLSALELQQN  505


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 67/134 (50%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LS     GS P    +  L NL  +  S N L G IP+ L +  +L  L +  N 
Sbjct  569  LQRLDLSRNRFSGSLPKE--LGMLVNLELLKLSDNRLTGQIPSTLGNLRRLTELQMGGNL  626

Query  497  LTGKIAGEFFSMKTLR-SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             +G I  EF  +  L+ +LN+  N L G IP  +     LESL ++ N L G IP+ IG 
Sbjct  627  FSGGIPFEFGHLTALQIALNVSHNNLTGSIPEQLGNLQMLESLYLNDNQLVGEIPNMIGE  686

Query  671  FYNLSYLDLSMNSL  712
              +L   +LS N+L
Sbjct  687  LLSLLVCNLSNNNL  700


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 3/128 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L + I+ G  P    +  ++NL  +    NSL G IP      ++L+ L L  N+L G I
Sbjct  262  LYQNILSGEVPPE--MGNMSNLELLALYKNSLSGAIPKEFGKLTRLKRLYLYTNELNGTI  319

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSY  688
              E     +   ++L  N L G IP  +    +L  + +  N L GSIP ++G    L  
Sbjct  320  PRELGDCVSAVEIDLSENQLSGIIPKELGRIPNLRLVHLFENLLQGSIPSELGQLRLLES  379

Query  689  LDLSMNSL  712
            LDLS+N+L
Sbjct  380  LDLSINNL  387



>ref|XP_002969057.1| hypothetical protein SELMODRAFT_90370 [Selaginella moellendorffii]
 gb|EFJ30173.1| hypothetical protein SELMODRAFT_90370 [Selaginella moellendorffii]
Length=1095

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 80/135 (59%), Gaps = 3/135 (2%)
 Frame = +2

Query  284  WPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCS  463
            W G+SC+SNG V  +SL  + + G  P   +   L+ L  +N SS +L G+IP  L SCS
Sbjct  56   WLGVSCSSNGHVVELSLGGLPLYGRIPT--VFGFLSELKVLNLSSTNLTGSIPEELGSCS  113

Query  464  KLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDL  640
            KL+ LDLS+N LTG++      +K LRSLNL+ N L G IP  +    SLE L +  N L
Sbjct  114  KLQLLDLSVNSLTGRVPSSIGRLKELRSLNLQDNQLQGSIPKEIGNCTSLEELQLFDNQL  173

Query  641  NGSIPDDIGNFYNLS  685
            NGSIP +IG    L 
Sbjct  174  NGSIPPEIGQLAKLQ  188


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 75/132 (57%), Gaps = 3/132 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T + L   ++ G  P    + QL+NL  ++   N L G IPA+L  CS LE LDLS+N
Sbjct  355  SLTFLELDTNMLTGPIPPE--LGQLSNLKLLHLWQNKLTGNIPASLGRCSLLEMLDLSMN  412

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
             LTG I  E F++  L+ + L  N L G +P       SL  L +++N L+GS+P  +G 
Sbjct  413  QLTGTIPPEIFNLSKLQRMLLLFNNLSGTLPNNAGNCISLLRLRLNNNMLSGSLPISLGQ  472

Query  671  FYNLSYLDLSMN  706
              NL++LDL  N
Sbjct  473  LRNLNFLDLHDN  484


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 71/133 (53%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T + L+   + GS P S    +L NL S+      + G IP  L  C+KL+++ L  N 
Sbjct  212  LTVLGLAVTALSGSIPGS--YGELKNLESLILYGAGISGRIPPELGGCTKLQSIYLYENR  269

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
            LTG I  E   +K LRSL +  N + G +P  +     LE +D SSNDL+G IP +IG  
Sbjct  270  LTGPIPPELGRLKQLRSLLVWQNAITGSVPRELSQCPLLEVIDFSSNDLSGDIPPEIGML  329

Query  674  YNLSYLDLSMNSL  712
             NL    LS N++
Sbjct  330  RNLQQFYLSQNNI  342


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 67/129 (52%), Gaps = 4/129 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + L + +  G  P    I  L++L  ++   N L G  PA   S S LE LD S N+L+G
Sbjct  479  LDLHDNMFSGPLPTG--ISNLSSLQMLDVHDNQLSGPFPAEFGSLSNLEILDASFNNLSG  536

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNL  682
             I  E   M  L  LNL  N L G+IP  M     L  LD+SSN L+G++P D+G   +L
Sbjct  537  PIPAEIGKMNLLSQLNLSMNQLSGDIPPEMGRCKELLLLDLSSNQLSGNLPPDLGMITSL  596

Query  683  SY-LDLSMN  706
            +  LDL  N
Sbjct  597  TITLDLHKN  605


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P    I  L NL     S N++ G IP  L +CS L  L+L  N LTG I  E  
Sbjct  318  LSGDIPPE--IGMLRNLQQFYLSQNNITGIIPPELGNCSSLTFLELDTNMLTGPIPPELG  375

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +  L+ L+L  N L G IP  +   S LE LD+S N L G+IP +I N   L  + L  
Sbjct  376  QLSNLKLLHLWQNKLTGNIPASLGRCSLLEMLDLSMNQLTGTIPPEIFNLSKLQRMLLLF  435

Query  704  NSL  712
            N+L
Sbjct  436  NNL  438


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 68/119 (57%), Gaps = 3/119 (3%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P  A I ++N L  +N S N L G IP  +  C +L  LDLS N L+G +  +   + 
Sbjct  535  SGPIPAEIGKMNLLSQLNLSMNQLSGDIPPEMGRCKELLLLDLSSNQLSGNLPPDLGMIT  594

Query  536  TLR-SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L  +L+L  N   G IP+     S LE LD+SSN+L G++ D +G   +L+++++S N
Sbjct  595  SLTITLDLHKNRFMGLIPSAFARLSQLERLDISSNELTGNL-DVLGKLNSLNFVNVSFN  652


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 65/130 (50%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            I L E  + G  P    + +L  L S+    N++ G++P  LS C  LE +D S NDL+G
Sbjct  263  IYLYENRLTGPIPPE--LGRLKQLRSLLVWQNAITGSVPRELSQCPLLEVIDFSSNDLSG  320

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNL  682
             I  E   ++ L+   L  N + G IP  +    SL  L++ +N L G IP ++G   NL
Sbjct  321  DIPPEIGMLRNLQQFYLSQNNITGIIPPELGNCSSLTFLELDTNMLTGPIPPELGQLSNL  380

Query  683  SYLDLSMNSL  712
              L L  N L
Sbjct  381  KLLHLWQNKL  390


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 65/133 (49%), Gaps = 25/133 (19%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ L+  ++ GS P S  + QL NL  ++   N   G +P  +S+ S L+ LD+  N
Sbjct  451  SLLRLRLNNNMLSGSLPIS--LGQLRNLNFLDLHDNMFSGPLPTGISNLSSLQMLDVHDN  508

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
             L+G    EF S+                        +LE LD S N+L+G IP +IG  
Sbjct  509  QLSGPFPAEFGSLS-----------------------NLEILDASFNNLSGPIPAEIGKM  545

Query  674  YNLSYLDLSMNSL  712
              LS L+LSMN L
Sbjct  546  NLLSQLNLSMNQL  558



>ref|XP_007152973.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
 gb|ESW24967.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
Length=1005

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 97/183 (53%), Gaps = 7/183 (4%)
 Frame = +2

Query  167  QSLTTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEM  343
             S T   + E A+LL +KQH   P S    W  S +S C WP I+C S+ SVT ++L   
Sbjct  19   HSQTQLQDQEHAVLLRIKQHLQNP-SFLTHWTPSNTSHCSWPEITCTSD-SVTGLTLFNS  76

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             +  + P    +C L NL  +NFS+NS+ G  P  L  CSKL +LDL  N+ TG I  + 
Sbjct  77   GIHQTLPN--FLCDLKNLTHVNFSTNSIPGEFPTFLYKCSKLVSLDLEGNEFTGSIPNDI  134

Query  524  FSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIP-DDIGNFYNLSYLDL  697
              +  L+ LNL    L+G+IPT +     L  L +     NG+ P + I N  NL +LD+
Sbjct  135  DKLVNLQHLNLGSTNLYGDIPTSIGRLKHLRVLQLHYCLFNGTFPAESIANLLNLEFLDM  194

Query  698  SMN  706
            S N
Sbjct  195  SSN  197


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
             FP+   + QL  +   +  S +L+G IP  +     LE LDLS ++ +G+I    F ++
Sbjct  204  KFPSG--LTQLKKVKFFHMYSCNLFGEIPETIGEMVALENLDLSRSNFSGEIPKGLFMLR  261

Query  536  TLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L  L L  N L GEIP  + A +L  LD++ N+L G IP D G    L +L LS+N+L
Sbjct  262  NLSILYLFNNSLSGEIPGEIEALNLTDLDLAQNNLAGKIPQDFGKLQKLRWLSLSLNNL  320


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++  + LS     G  P    +  L NL  +   +NSL G IP  + + + L  LDL+ N
Sbjct  238  ALENLDLSRSNFSGEIPKGLFM--LRNLSILYLFNNSLSGEIPGEIEALN-LTDLDLAQN  294

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
            +L GKI  +F  ++ LR L+L  N L GEIP  +    SLE   +  N+L+G +P D G 
Sbjct  295  NLAGKIPQDFGKLQKLRWLSLSLNNLSGEIPQSLGRLASLEHFHIMFNNLSGILPPDFGG  354

Query  671  FYNLSYLDLSMNSL  712
            +  L    ++ NS 
Sbjct  355  YSELKTFLVANNSF  368


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 62/125 (50%), Gaps = 5/125 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S++R+ +      G  P    +    N+V    S N L G++P  L++  KL TL L  N
Sbjct  450  SISRLEIDYNQFYGRIPTG--VSSWTNVVVFKASENYLNGSVPKELTNLPKLTTLLLDHN  507

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIG  667
             LTG +  +  S K+L +LNL  N L G+I T  + Y   L  LD+S N  +G +P  + 
Sbjct  508  QLTGPLPSDIISWKSLENLNLSHNQLSGKI-TDGIGYLPVLNQLDLSENQFSGQVPSILP  566

Query  668  NFYNL  682
               NL
Sbjct  567  RLTNL  571


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (56%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N  +G IP  +SS + +     S N L G +  E  ++  L +L L  N L G +P+ ++
Sbjct  459  NQFYGRIPTGVSSWTNVVVFKASENYLNGSVPKELTNLPKLTTLLLDHNQLTGPLPSDII  518

Query  599  AY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            ++ SLE+L++S N L+G I D IG    L+ LDLS N  
Sbjct  519  SWKSLENLNLSHNQLSGKITDGIGYLPVLNQLDLSENQF  557



>gb|EYU30701.1| hypothetical protein MIMGU_mgv1a000689mg [Erythranthe guttata]
Length=1017

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 98/180 (54%), Gaps = 7/180 (4%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEM  343
            +Q+ TT  + E+AILL LKQ W  P SL   W  +S  C WP I+C +  SVT++ L   
Sbjct  26   TQNNTTLNQ-EQAILLTLKQQWSNPASL-SHWTPSSDHCTWPEITCTATSSVTKLELINK  83

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             +    P+   IC+L NL  I+   N + G  P  L +C+ LE LDLS N  TGK+  + 
Sbjct  84   TIAEIPPS---ICRLENLTHIDLQWNEITGIFPTALYNCTNLEYLDLSYNYFTGKLPDDI  140

Query  524  FSMK-TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
              +   LR LNL  N   G+IP  + +  SL +L + +N  NGS P +IG+  NL  L+ 
Sbjct  141  NLLSPHLRFLNLGVNNFTGDIPKSIGSLSSLVTLQLYTNLFNGSFPPEIGDLANLEELNF  200


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P+S    +L  L ++  ++ +L G +P  + + S LE++DLS N+L+G I   FF +K
Sbjct  209  SIPSS--FTRLKKLRNLWMTATNLIGELPDGIENMSALESVDLSENNLSGTIPDGFFLLK  266

Query  536  TLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L  L L  N   G IP  + A +L+ LD+S N LNG+IPDD G   NL+ L L  N L
Sbjct  267  NLTILFLYKNRFSGSIPKRVEALNLQILDLSDNTLNGTIPDDFGKLTNLTGLALYFNQL  325


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 59/123 (48%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P S  + +L  LV+I   +N+L G +P +    S LE   +S N  TG++     
Sbjct  325  LSGKVPIS--LGRLPKLVNIGIFNNNLSGELPPDFGRYSMLERFQVSSNQFTGEVPKYLC  382

Query  527  SMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            + K    L +  N L GE+P  +    SLE +    N  +G IPD +    NL+ L LS 
Sbjct  383  ANKVFTGLIVFQNKLTGELPNSLGDCSSLEVVRAYDNKFSGKIPDGLWTSTNLTTLMLSN  442

Query  704  NSL  712
            NS 
Sbjct  443  NSF  445



>ref|XP_004291157.1| PREDICTED: receptor-like protein kinase 5 [Fragaria vesca subsp. 
vesca]
Length=1020

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 105/174 (60%), Gaps = 5/174 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            + +R+ILL LKQ WG P    + WNS+SSPCDWP ISC + G+VT + L E  +    PA
Sbjct  26   DSDRSILLKLKQEWGDP-PSIQSWNSSSSPCDWPEISCTA-GAVTGLLLGEKNITEEIPA  83

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            +  IC L NL  +N S N + G  P  L +C KL+ LDLS N L G+I G+   + +L+ 
Sbjct  84   T--ICDLRNLTVLNLSWNYIPGEFPVVLYNCFKLQYLDLSQNYLVGEIPGDIDRISSLQY  141

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L++ GN   G+IP  +   + L+ L+++ N  NG+ P DIG   NL  LD+S N
Sbjct  142  LDVSGNNFSGDIPAAIGNLTQLKVLNLNLNLFNGTFPSDIGKLSNLEILDMSFN  195


 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 73/137 (53%), Gaps = 3/137 (2%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAI---ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G ++ + + +M   G   A+ I     +L  L       ++L G IP   S+   L+ LD
Sbjct  182  GKLSNLEILDMSFNGEMMAAQIPEEFGKLGKLKEFRMRLSNLIGQIPETFSNLVSLQELD  241

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDD  661
            L+IN L GKI    F +K LR L L  N L GEIP  + A SLE +D++ N+L GSIP D
Sbjct  242  LAINKLEGKIPDGLFLLKDLRILFLFHNRLTGEIPVTVGAMSLEQIDLAMNNLTGSIPPD  301

Query  662  IGNFYNLSYLDLSMNSL  712
             G   NL+ L+L  N L
Sbjct  302  FGKLSNLTVLNLYTNKL  318


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  S+N   G IP  +SS   L     S N  TGKI  E  S+  L +L+L GN  
Sbjct  450  NLSRLEISNNRFSGEIPVQVSSWQTLVVFKASGNLFTGKIPVELTSLSKLNTLSLDGNRF  509

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GE+P+ ++A+ SL +LD+S N+L+G IP  IG+  +L YLDLS N  
Sbjct  510  SGELPSEIIAWTSLTTLDLSRNELSGYIPTAIGSLPDLLYLDLSGNKF  557


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 64/115 (56%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P    +  L+ L +++   N   G +P+ + + + L TLDLS N+L+G I     S+
Sbjct  487  GKIPVE--LTSLSKLNTLSLDGNRFSGELPSEIIAWTSLTTLDLSRNELSGYIPTAIGSL  544

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
              L  L+L GN   G+IP+ +    L SL++SSN+L+G IPD   N  Y  S+L+
Sbjct  545  PDLLYLDLSGNKFSGQIPSELGHLRLNSLNLSSNELSGKIPDVFDNLVYENSFLN  599


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  + L+   + G  P    +  L +L  +    N L G IP  + + S LE +DL++N
Sbjct  236  SLQELDLAINKLEGKIPDGLFL--LKDLRILFLFHNRLTGEIPVTVGAMS-LEQIDLAMN  292

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  +F  +  L  LNL  N L G IP  + +  +L+   V  N LNG++P ++G 
Sbjct  293  NLTGSIPPDFGKLSNLTVLNLYTNKLNGGIPASLGLITTLKGFRVFKNQLNGTLPPEMGL  352

Query  671  FYNLSYLDLSMNSL  712
               L   ++S N L
Sbjct  353  HSKLEGFEVSENQL  366



>ref|XP_002969733.1| hypothetical protein SELMODRAFT_60277, partial [Selaginella moellendorffii]
 gb|EFJ28857.1| hypothetical protein SELMODRAFT_60277, partial [Selaginella moellendorffii]
Length=1214

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 89/162 (55%), Gaps = 11/162 (7%)
 Frame = +2

Query  257  WNSTSSPC---DWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSL  427
            W   SSPC    W GISC S G++  ISLS + + G   A+  +  L  L  ++ SSN+L
Sbjct  38   WIIGSSPCGAKKWTGISCASTGAIVAISLSGLELQGPISAATALLGLPALEELDLSSNAL  97

Query  428  WGTIPANLSSCSKLETLDLSINDLTGK--------IAGEFFSMKTLRSLNLRGNMLFGEI  583
             G IP  L    K++ LDLS N L G         I    FS+  LR L+L  N+LFG I
Sbjct  98   SGEIPPQLWQLPKIKRLDLSHNLLQGASFDRLFGYIPPSIFSLAALRQLDLSSNLLFGTI  157

Query  584  PTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            P   ++ SL+ LD+++N L G IP  IG+  NL+ L L +NS
Sbjct  158  PASNLSRSLQILDLANNSLTGEIPPSIGDLSNLTELSLGLNS  199


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 76/154 (49%), Gaps = 24/154 (16%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  + LS  ++ G  P    I  L NL +++ SSN L G IP  L   SKL+ L+L  N 
Sbjct  611  LVELDLSNNLLQGRIPPE--ISLLANLTTLDLSSNMLQGRIPWQLGENSKLQGLNLGFNR  668

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPD-----  658
            LTG+I  E  +++ L  LN+ GN L G IP  +   S L  LD S N L GS+PD     
Sbjct  669  LTGQIPPELGNLERLVKLNISGNALTGSIPDHLGQLSGLSHLDASGNGLTGSLPDSFSGL  728

Query  659  ----------------DIGNFYNLSYLDLSMNSL  712
                            +IG    LSYLDLS+N L
Sbjct  729  VSIVGFKNSLTGEIPSEIGGILQLSYLDLSVNKL  762


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + G  P+   I Q + LV ++ S+N L G IP  +S  + L TLDLS N L G
Sbjct  590  LDLSHNSLTGPIPSG--IGQCSVLVELDLSNNLLQGRIPPEISLLANLTTLDLSSNMLQG  647

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            +I  +      L+ LNL  N L G+IP  +     L  L++S N L GSIPD +G    L
Sbjct  648  RIPWQLGENSKLQGLNLGFNRLTGQIPPELGNLERLVKLNISGNALTGSIPDHLGQLSGL  707

Query  683  SYLDLSMNSL  712
            S+LD S N L
Sbjct  708  SHLDASGNGL  717


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 76/134 (57%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ ++ LS   +    P S  I  L+ + SI+ +S  L G+IP +L  CS LE L+L+ N
Sbjct  236  SLRKLDLSNNPLQSPIPDS--IGDLSRIQSISIASAQLNGSIPGSLGRCSSLELLNLAFN  293

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSL-ESLDVSSNDLNGSIPDDIGN  670
             L+G +  +  +++ + + ++ GN L G IP  +  + L +S+ +S+N  +GSIP ++G 
Sbjct  294  QLSGPLPDDLAALEKIITFSVVGNSLSGPIPRWIGQWQLADSILLSTNSFSGSIPPELGQ  353

Query  671  FYNLSYLDLSMNSL  712
               ++ L L  N L
Sbjct  354  CRAVTDLGLDNNQL  367


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 71/139 (51%), Gaps = 5/139 (4%)
 Frame = +2

Query  299  CNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETL  478
            C++ G +++++L    + GS  A   + +  NL  ++ + N L G IP   S   KL  L
Sbjct  376  CDA-GLLSQLTLDHNTLTGSL-AGGTLRRCGNLTQLDVTGNRLTGEIPRYFSDLPKLVIL  433

Query  479  DLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSI  652
            D+S N   G I  E +    L  +    N+L G + +P+V    +L+ L +  N L+G +
Sbjct  434  DISTNFFMGSIPDELWHATQLMEIYASDNLLEGGL-SPLVGRMENLQHLYLDRNRLSGPL  492

Query  653  PDDIGNFYNLSYLDLSMNS  709
            P ++G   +L+ L L+ N+
Sbjct  493  PSELGLLKSLTVLSLAGNA  511


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 47/104 (45%), Gaps = 2/104 (2%)
 Frame = +2

Query  401  SINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGE  580
            SI  S+NS  G+IP  L  C  +  L L  N LTG I  E      L  L L  N L G 
Sbjct  335  SILLSTNSFSGSIPPELGQCRAVTDLGLDNNQLTGSIPPELCDAGLLSQLTLDHNTLTGS  394

Query  581  IP--TPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +   T     +L  LDV+ N L G IP    +   L  LD+S N
Sbjct  395  LAGGTLRRCGNLTQLDVTGNRLTGEIPRYFSDLPKLVILDISTN  438


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
             L+ I  S N L G +   +     L+ L L  N L+G +  E   +K+L  L+L GN  
Sbjct  453  QLMEIYASDNLLEGGLSPLVGRMENLQHLYLDRNRLSGPLPSELGLLKSLTVLSLAGNAF  512

Query  572  FGEIPTPMVAYS--LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP  +   +  L +LD+  N L G+IP +IG    L  L LS N L
Sbjct  513  DGVIPREIFGGTTGLTTLDLGGNRLGGAIPPEIGKLVGLDCLVLSHNRL  561


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 6/122 (5%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNS-LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
            G  P S  I  L+NL  ++   NS L G+IP ++   SKLE L  +   L G I      
Sbjct  178  GEIPPS--IGDLSNLTELSLGLNSALLGSIPPSIGKLSKLEILYAANCKLAGPIPHSL--  233

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              +LR L+L  N L   IP  +   S ++S+ ++S  LNGSIP  +G   +L  L+L+ N
Sbjct  234  PPSLRKLDLSNNPLQSPIPDSIGDLSRIQSISIASAQLNGSIPGSLGRCSSLELLNLAFN  293

Query  707  SL  712
             L
Sbjct  294  QL  295



>gb|KEH27213.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1015

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 100/183 (55%), Gaps = 5/183 (3%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCD-WPGISCNSNGSVTRISLSE  340
            SQS       E   L+ +KQH+  P +L    +S +S C  WP I+C +NGSVT ++L  
Sbjct  24   SQSQQNLHNQEHETLMKIKQHFQNPPNLNHWTSSNTSYCSSWPEITC-TNGSVTGLTLFN  82

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
              +  + P+   IC L NL  ++F++N + G  P +L +CSKLE LDLS+N+  GKI   
Sbjct  83   YNINQTIPS--FICDLKNLTHVDFNNNYIPGMFPTDLYNCSKLEYLDLSMNNFVGKIPEN  140

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
             F++  L  LNL       +IP+ +     L  L +     NG+ PD+IG+  NL  LDL
Sbjct  141  IFTLSNLNYLNLSYTNFTDDIPSSIGKLKKLRFLALQVCLFNGTFPDEIGDLVNLETLDL  200

Query  698  SMN  706
            S N
Sbjct  201  SNN  203


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L+G +P ++     LE LD+S N LTGKI    F +K LR L L  N L GE+P  + A 
Sbjct  230  LFGEMPESMGEMVSLEDLDISQNGLTGKIPSGLFMLKNLRRLLLATNDLSGELPDVVEAL  289

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L +++++ N+L G IPDD G    L+ L LS+N+ 
Sbjct  290  NLTNIELTQNNLTGKIPDDFGKLQKLTELSLSLNNF  325


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 58/109 (53%), Gaps = 6/109 (6%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            N+V    S N+L G+IP  ++S  KL+TL L  N L G +  +  S  +L +LNL  N L
Sbjct  480  NVVEFIASKNNLNGSIPQEITSLHKLQTLSLDQNQLKGPLPFDVISWNSLLTLNLSQNQL  539

Query  572  FGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GEIP   + Y   L  LD+S N  +G IP        ++ LDLS N L
Sbjct  540  SGEIPAS-IGYLPDLSVLDLSDNQFSGEIPSIAP---RITVLDLSSNRL  584


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 61/134 (46%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +T +SLS     G  P S  I QL +L+      N+L GT+P +    SKL +  ++ N
Sbjct  314  KLTELSLSLNNFSGEIPQS--IGQLPSLIDFKVFMNNLSGTLPPDFGLHSKLRSFHVTTN  371

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
               G++         L++L    N L GE+P  +    SL  + +  ND  G+IP  +  
Sbjct  372  RFEGRLPENLCYHGELQNLTAYENHLSGELPESLGNCSSLLEMKIYKNDFYGNIPSGLWR  431

Query  671  FYNLSYLDLSMNSL  712
              NL Y  +S N  
Sbjct  432  SENLGYFMISHNKF  445



>ref|XP_004955463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230-like [Setaria italica]
Length=1105

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 83/147 (56%), Gaps = 5/147 (3%)
 Frame = +2

Query  278  CDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSS  457
            C+W GI+C++ G VT ++L  + + G    SA +C L  L  +N S N+L G IP  L++
Sbjct  60   CEWAGIACSAGGEVTGVTLHGLNLHGEL--SAAVCALPRLAVLNVSKNALGGAIPPGLAA  117

Query  458  CSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSS  631
            C+ LE LDLS N L G +  E  +++ LR L L  N L GEIP P V    +LE L++ S
Sbjct  118  CAALEVLDLSTNALRGGVPPELCALRGLRRLFLSENFLSGEIP-PAVGGLAALEELEIYS  176

Query  632  NDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N+L G IP  I     L  +   +N +
Sbjct  177  NNLTGRIPASIRALRRLRVIRAGLNDI  203


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 75/160 (47%), Gaps = 30/160 (19%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ LS     G  PA+  I  L  LV+ N S N L G IP  L+ C KL+ LDLS N
Sbjct  504  SIERLILSNNHFVGQLPAA--IGNLTELVAFNISLNQLSGPIPRELAQCKKLQRLDLSRN  561

Query  494  DLTGKIAGE------------------------FFSMKTLRSLNLRGNMLFGEIPT---P  592
             LTG I  E                        F  +  L +L + GN L G++P     
Sbjct  562  SLTGAIPQEIGGLVNLELLKLSDNSLNGSIPSSFGGLSRLIALEMGGNRLSGQVPVELGE  621

Query  593  MVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + A  + +L+VS N L+G IP  +GN + L YL L  N L
Sbjct  622  LTALQI-ALNVSHNMLSGEIPMQLGNLHMLQYLYLDNNEL  660


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 68/132 (52%), Gaps = 3/132 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            SV  I LSE  + G  P    + ++  L  +    N L G+IP  L   S +  +DLSIN
Sbjct  312  SVLEIDLSENKLTGIIPGE--LGRIPTLRLLYLFENRLQGSIPPELGQLSSIRKIDLSIN  369

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
            +LTG I   F ++ +L  L L  N L G+IP  + A S L  LD+S N L GSIP  +  
Sbjct  370  NLTGVIPTAFQNLSSLEYLELFDNQLHGDIPPLLGANSNLSVLDLSDNQLTGSIPPHLCK  429

Query  671  FYNLSYLDLSMN  706
            +  L +L L  N
Sbjct  430  YQKLMFLSLGSN  441


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 66/130 (51%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ++L++    G  P    +  L +L+ +    N L GTIP  L +   +  +DLS N LTG
Sbjct  268  LALNDNAFTGGVPRE--LAALPSLLKLYIYRNQLDGTIPPELGNLQSVLEIDLSENKLTG  325

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNL  682
             I GE   + TLR L L  N L G IP  +    S+  +D+S N+L G IP    N  +L
Sbjct  326  IIPGELGRIPTLRLLYLFENRLQGSIPPELGQLSSIRKIDLSINNLTGVIPTAFQNLSSL  385

Query  683  SYLDLSMNSL  712
             YL+L  N L
Sbjct  386  EYLELFDNQL  395


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 57/110 (52%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L +++ I+ S N L G IP  L     L  L L  N L G I  E   + ++R ++L  N
Sbjct  310  LQSVLEIDLSENKLTGIIPGELGRIPTLRLLYLFENRLQGSIPPELGQLSSIRKIDLSIN  369

Query  566  MLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L G IPT     S LE L++  N L+G IP  +G   NLS LDLS N L
Sbjct  370  NLTGVIPTAFQNLSSLEYLELFDNQLHGDIPPLLGANSNLSVLDLSDNQL  419


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 67/132 (51%), Gaps = 3/132 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LSE  + G  P +  +  L  L  +   SN+L G IPA++ +  +L  +   +ND
Sbjct  145  LRRLFLSENFLSGEIPPA--VGGLAALEELEIYSNNLTGRIPASIRALRRLRVIRAGLND  202

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
            ++G I  E     +L  L L  N L GE+P  +     L +L +  N  +G +P ++GN 
Sbjct  203  ISGPIPVELTECASLEVLGLAQNNLAGELPRELSRLKNLTTLILWQNAFSGEVPPELGNC  262

Query  674  YNLSYLDLSMNS  709
             NL  L L+ N+
Sbjct  263  TNLQMLALNDNA  274


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P    I +  ++  +  S+N   G +PA + + ++L   ++S+N L+G I  E    K
Sbjct  492  SGPIPPEIGKFRSIERLILSNNHFVGQLPAAIGNLTELVAFNISLNQLSGPIPRELAQCK  551

Query  536  TLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+ L+L  N L G IP  +    +LE L +S N LNGSIP   G    L  L++  N L
Sbjct  552  KLQRLDLSRNSLTGAIPQEIGGLVNLELLKLSDNSLNGSIPSSFGGLSRLIALEMGGNRL  611


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 80/179 (45%), Gaps = 32/179 (18%)
 Frame = +2

Query  245  LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNS  424
            LFE     S P +   +S     S+ +I LS   + G  P +     L++L  +    N 
Sbjct  342  LFENRLQGSIPPELGQLS-----SIRKIDLSINNLTGVIPTA--FQNLSSLEYLELFDNQ  394

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGE--------FFSM----------------  532
            L G IP  L + S L  LDLS N LTG I           F S+                
Sbjct  395  LHGDIPPLLGANSNLSVLDLSDNQLTGSIPPHLCKYQKLMFLSLGSNRFIGNIPPGLKAC  454

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +TL  L L GNML G +P  + +  +L SL+++ N  +G IP +IG F ++  L LS N
Sbjct  455  RTLTQLRLGGNMLTGSLPVELSLLQNLTSLEMNQNRFSGPIPPEIGKFRSIERLILSNN  513



>ref|XP_010317427.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=1148

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 99/189 (52%), Gaps = 5/189 (3%)
 Frame = +2

Query  155  PNYSQSLTTYGEDERAILLILKQHWGYPFSLF-EQWNSTSSPCDWPGISCNS-NGSVTRI  328
            P+Y  + T    D+ A+L +  Q    PF    E W+   S C W G+ C S +  V  +
Sbjct  16   PHYVMTQTNITTDQLALLSLKSQISSDPFRFLNESWSPAISVCRWVGVICGSRHQRVKSL  75

Query  329  SLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGK  508
             LS + + G  P       L  LVS++  SN  +G +P  ++   +L+ LDLS+N   G+
Sbjct  76   KLSNLALTGRIPRD--FGNLTFLVSLDLGSNHFYGNLPQEMAHLRRLKFLDLSLNSFRGE  133

Query  509  IAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
            I   F  +  L+ +NLR N   G IP  +  A  LE+L +S+N L G+IP++IGN +NL+
Sbjct  134  IPSWFGFLHQLQVVNLRSNSFTGSIPPSLSNASRLETLQISANLLQGNIPEEIGNLHNLN  193

Query  686  YLDLSMNSL  712
             L +  N L
Sbjct  194  VLSMEHNQL  202


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 60/129 (47%), Gaps = 25/129 (19%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  ++ S N L G +P +LS+CS+L+ L L+ ND  G+I  E   +  L+ L LR N   
Sbjct  241  LKRLHLSMNELRGHLPTSLSNCSQLQVLSLAFNDFDGRIHSEIGRLSNLQGLYLRNNHFT  300

Query  575  GEIPT----------------------PMVAYSLESLDVSS---NDLNGSIPDDIGNFYN  679
            G IP                       P+   ++ SL+  S   N+  GS+P +IGN   
Sbjct  301  GIIPQEIGNLVNLVELYMEANQISGSIPISLINISSLETVSLWRNNFKGSLPREIGNLTK  360

Query  680  LSYLDLSMN  706
            L  L LS N
Sbjct  361  LQVLYLSEN  369


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L +L+ ++ SSN++ G++P  +        ++LS+N  T  I  E   ++ L  L LR N
Sbjct  653  LKDLLVLDLSSNNMVGSLPPEIGYLKAAIYMNLSMNQFTNGIPTEIGGLQNLEHLYLRHN  712

Query  566  MLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L G IP  M    SLE LD+S N+++G+IP  +     L Y ++S N L
Sbjct  713  KLQGSIPDSMNNMVSLEYLDISHNNISGTIPMSLEKLQYLEYFNVSDNKL  762


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (52%), Gaps = 4/131 (3%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVS---INFSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            LSE+ +G +  + ++   L N+ S   I  +SN L   +P +L +   L  LDLS N++ 
Sbjct  608  LSEIYLGQNQLSGSLPNCLGNVTSLRWIYLASNKLSSNLPTSLGNLKDLLVLDLSSNNMV  667

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYN  679
            G +  E   +K    +NL  N     IPT +     LE L +  N L GSIPD + N  +
Sbjct  668  GSLPPEIGYLKAAIYMNLSMNQFTNGIPTEIGGLQNLEHLYLRHNKLQGSIPDSMNNMVS  727

Query  680  LSYLDLSMNSL  712
            L YLD+S N++
Sbjct  728  LEYLDISHNNI  738


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I  L NLV +   +N + G+IP +L + S LET+ L  N+  G +  E  ++  L+ L L
Sbjct  307  IGNLVNLVELYMEANQISGSIPISLINISSLETVSLWRNNFKGSLPREIGNLTKLQVLYL  366

Query  557  RGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N   GEIP  M     L+ L +  N  +G +P +I N   L  + LS N+L
Sbjct  367  SENRFTGEIPKEMSNLVELQVLALGLNSFSGLLPMEIFNISRLRIIQLSGNTL  419



>ref|XP_010929233.1| PREDICTED: receptor-like protein kinase [Elaeis guineensis]
Length=1110

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 95/171 (56%), Gaps = 4/171 (2%)
 Frame = +2

Query  206  LLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIIC  382
            LL L +    P S+   W S+  +PC W GISC+    V  + L+E  + G       I 
Sbjct  29   LLALTKSLILPHSINSTWKSSDPTPCKWVGISCDRRRHVVSLDLAERGISGRLRPE--IG  86

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
             L NL  I+   N+L G IP +L +C+ +E LDLSIN L+G+I     ++K L  L+L G
Sbjct  87   LLRNLRRIDLGINALSGLIPPDLGNCTLVEHLDLSINFLSGEIPETLQNLKKLSYLSLYG  146

Query  563  NMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G+IP P+   Y LE++ +S N+L GSIP  +GN   +  L LS N L
Sbjct  147  NFLTGKIPDPLFRIYHLETVYLSQNNLTGSIPRTVGNMSRVKDLWLSDNLL  197


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 80/160 (50%), Gaps = 28/160 (18%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
            G VT I+ S   + G  P    I +L NL  +N S N+L+G +P  +S CS+L  LDLS 
Sbjct  519  GDVTVINWSGNKLVGPIPQE--IGRLANLQVLNLSHNNLYGMLPLEISHCSRLYLLDLSF  576

Query  491  NDLTGKI---------------AGEFFS---------MKTLRSLNLRGNMLFGEIPTPMV  598
            N L G I                G  FS            L  L L GN L G IP+P+ 
Sbjct  577  NSLNGSIPPSLTNLTVLSRLILQGNQFSGGIPSFLSQFDRLLELQLGGNKLGGNIPSPLG  636

Query  599  A-YSLE-SLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            A  +LE +L++S N L G IP ++GN   L  LDLS+N+L
Sbjct  637  ALRNLEIALNLSENRLAGQIPSELGNLKRLQSLDLSLNNL  676


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 61/123 (50%), Gaps = 4/123 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            +GG     +  C+L  L   N S N L G IPA L +CS L       N L+G+I     
Sbjct  245  LGGRISFGSRSCKLEEL---NLSFNRLEGEIPAGLGNCSSLTVFSAVSNRLSGQIPSSVG  301

Query  527  SMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            S+  L  L L  N L G IPT +    SL +L++  N L G+IP ++G   NL+ L L  
Sbjct  302  SLTKLTKLYLSENSLSGSIPTEIGKCQSLTALELYENQLEGAIPRELGELNNLTKLFLFD  361

Query  704  NSL  712
            N L
Sbjct  362  NHL  364


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 0/106 (0%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            LV I F++NS  G IP N+    +L  L+L  N L G +     +  TL  LNL  N L 
Sbjct  426  LVQIEFTNNSFVGGIPPNICIGKELRVLNLGFNMLNGSMPVGLGNCSTLWRLNLHNNNLT  485

Query  575  GEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            G IP  + + SL  +D+S N+LNG +P  +GN  +++ ++ S N L
Sbjct  486  GSIPEFVESSSLSYMDLSFNNLNGHVPPSLGNCGDVTVINWSGNKL  531


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 61/129 (47%), Gaps = 3/129 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T  S     + G  P+S  +  L  L  +  S NSL G+IP  +  C  L  L+L  N
Sbjct  281  SLTVFSAVSNRLSGQIPSS--VGSLTKLTKLYLSENSLSGSIPTEIGKCQSLTALELYEN  338

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             L G I  E   +  L  L L  N L GE+P  +    SLE + +  N+L+G +P ++  
Sbjct  339  QLEGAIPRELGELNNLTKLFLFDNHLTGEVPIEIWRIQSLEHVLIYDNNLSGELPLEVTE  398

Query  671  FYNLSYLDL  697
              NL  + L
Sbjct  399  LRNLRNISL  407


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 67/130 (52%), Gaps = 4/130 (3%)
 Frame = +2

Query  323  RISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            R++L    + GS P      + ++L  ++ S N+L G +P +L +C  +  ++ S N L 
Sbjct  476  RLNLHNNNLTGSIPE---FVESSSLSYMDLSFNNLNGHVPPSLGNCGDVTVINWSGNKLV  532

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYN  679
            G I  E   +  L+ LNL  N L+G +P  +   S L  LD+S N LNGSIP  + N   
Sbjct  533  GPIPQEIGRLANLQVLNLSHNNLYGMLPLEISHCSRLYLLDLSFNSLNGSIPPSLTNLTV  592

Query  680  LSYLDLSMNS  709
            LS L L  N 
Sbjct  593  LSRLILQGNQ  602


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS+  + GS P +  +  ++ +  +  S N L G +P ++ +C+KLE L L  N LTG
Sbjct  166  VYLSQNNLTGSIPRT--VGNMSRVKDLWLSDNLLSGVLPDSIGNCTKLEQLYLFDNRLTG  223

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
             +     S++ L+ L++  N L G I     +  LE L++S N L G IP  +GN  +L+
Sbjct  224  PLPETLNSIRGLKFLDVHTNNLGGRISFGSRSCKLEELNLSFNRLEGEIPAGLGNCSSLT  283

Query  686  YLDLSMNSL  712
                  N L
Sbjct  284  VFSAVSNRL  292


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 65/123 (53%), Gaps = 4/123 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P    + +L NL +I+  +N   G IP  L   S L  ++ + N   G I     
Sbjct  388  LSGELPLE--VTELRNLRNISLFNNQFTGVIPQGLGINSSLVQIEFTNNSFVGGIPPNIC  445

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
              K LR LNL  NML G +P  +   S L  L++ +N+L GSIP+ + +  +LSY+DLS 
Sbjct  446  IGKELRVLNLGFNMLNGSMPVGLGNCSTLWRLNLHNNNLTGSIPEFVES-SSLSYMDLSF  504

Query  704  NSL  712
            N+L
Sbjct  505  NNL  507


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 69/139 (50%), Gaps = 3/139 (2%)
 Frame = +2

Query  296  SCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLET  475
            S  S   +T++ LSE  + GS P     CQ  +L ++    N L G IP  L   + L  
Sbjct  299  SVGSLTKLTKLYLSENSLSGSIPTEIGKCQ--SLTALELYENQLEGAIPRELGELNNLTK  356

Query  476  LDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSI  652
            L L  N LTG++  E + +++L  + +  N L GE+P  +    +L ++ + +N   G I
Sbjct  357  LFLFDNHLTGEVPIEIWRIQSLEHVLIYDNNLSGELPLEVTELRNLRNISLFNNQFTGVI  416

Query  653  PDDIGNFYNLSYLDLSMNS  709
            P  +G   +L  ++ + NS
Sbjct  417  PQGLGINSSLVQIEFTNNS  435



>ref|XP_002992868.1| hypothetical protein SELMODRAFT_136102 [Selaginella moellendorffii]
 gb|EFJ06059.1| hypothetical protein SELMODRAFT_136102 [Selaginella moellendorffii]
Length=1095

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 80/135 (59%), Gaps = 3/135 (2%)
 Frame = +2

Query  284  WPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCS  463
            W G+SC+SNG V  +SL  + + G  P   +   L+ L  +N SS +L G+IP  L SCS
Sbjct  56   WLGVSCSSNGHVVELSLGGLPLYGRIPT--VFGFLSELKVLNLSSTNLTGSIPEELGSCS  113

Query  464  KLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDL  640
            KL+ LDLS+N LTG++      +K LRSLNL+ N L G IP  +    SLE L +  N L
Sbjct  114  KLQLLDLSVNSLTGRVPSSIGRLKELRSLNLQDNQLQGSIPKEIGNCTSLEELQLFDNQL  173

Query  641  NGSIPDDIGNFYNLS  685
            NGSIP +IG    L 
Sbjct  174  NGSIPPEIGQLGKLQ  188


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 75/132 (57%), Gaps = 3/132 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T + L   ++ G  P    + QL+NL  ++   N L G IPA+L  CS LE LDLS+N
Sbjct  355  SLTFLELDTNMLTGPIPPE--LGQLSNLKLLHLWQNKLTGNIPASLGRCSLLEMLDLSMN  412

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
             LTG I  E F++  L+ + L  N L G +P       SL  L +++N L+GS+P  +G 
Sbjct  413  QLTGTIPAEIFNLSKLQRMLLLFNNLSGTLPNNAGNCISLLRLRLNNNMLSGSLPISLGQ  472

Query  671  FYNLSYLDLSMN  706
              NL++LDL  N
Sbjct  473  LRNLNFLDLHDN  484


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 71/133 (53%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T + L+   + GS P S    +L NL S+      + G IP  L  C+KL+++ L  N 
Sbjct  212  LTVLGLAVTALSGSIPGS--YGELKNLESLILYGAGISGRIPPELGGCTKLQSIYLYENR  269

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
            LTG I  E   +K LRSL +  N + G +P  +     LE +D SSNDL+G IP +IG  
Sbjct  270  LTGPIPPELGRLKQLRSLLVWQNAITGSVPRELSQCPLLEVIDFSSNDLSGDIPPEIGML  329

Query  674  YNLSYLDLSMNSL  712
             NL    LS N++
Sbjct  330  RNLQQFYLSQNNI  342


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 73/134 (54%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ L+  ++ GS P S  + QL NL  ++   N   G +P  +S+ S L+ LD+  N
Sbjct  451  SLLRLRLNNNMLSGSLPIS--LGQLRNLNFLDLHDNMFSGPLPTGISNLSSLQMLDVHDN  508

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLES-LDVSSNDLNGSIPDDIGN  670
             L+G    EF S+  L  L+   N L G IP  +   +L S L++S N L+G+IP ++G 
Sbjct  509  QLSGPFPAEFGSLSNLEILDASFNNLSGPIPAEIGKMNLLSQLNLSMNQLSGNIPPEMGR  568

Query  671  FYNLSYLDLSMNSL  712
               L  LDLS N L
Sbjct  569  CKELLLLDLSSNQL  582


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 66/129 (51%), Gaps = 4/129 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + L + +  G  P    I  L++L  ++   N L G  PA   S S LE LD S N+L+G
Sbjct  479  LDLHDNMFSGPLPTG--ISNLSSLQMLDVHDNQLSGPFPAEFGSLSNLEILDASFNNLSG  536

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNL  682
             I  E   M  L  LNL  N L G IP  M     L  LD+SSN L+G++P D+G   +L
Sbjct  537  PIPAEIGKMNLLSQLNLSMNQLSGNIPPEMGRCKELLLLDLSSNQLSGNLPPDLGMITSL  596

Query  683  SY-LDLSMN  706
            +  LDL  N
Sbjct  597  TITLDLHKN  605


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P    I  L NL     S N++ G IP  L +CS L  L+L  N LTG I  E  
Sbjct  318  LSGDIPPE--IGMLRNLQQFYLSQNNITGIIPPELGNCSSLTFLELDTNMLTGPIPPELG  375

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +  L+ L+L  N L G IP  +   S LE LD+S N L G+IP +I N   L  + L  
Sbjct  376  QLSNLKLLHLWQNKLTGNIPASLGRCSLLEMLDLSMNQLTGTIPAEIFNLSKLQRMLLLF  435

Query  704  NSL  712
            N+L
Sbjct  436  NNL  438


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 68/119 (57%), Gaps = 3/119 (3%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P  A I ++N L  +N S N L G IP  +  C +L  LDLS N L+G +  +   + 
Sbjct  535  SGPIPAEIGKMNLLSQLNLSMNQLSGNIPPEMGRCKELLLLDLSSNQLSGNLPPDLGMIT  594

Query  536  TLR-SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L  +L+L  N   G IP+     S LE LD+SSN+L G++ D +G   +L+++++S N
Sbjct  595  SLTITLDLHKNRFIGLIPSAFARLSQLERLDISSNELTGNL-DVLGKLNSLNFVNVSFN  652


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 65/130 (50%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            I L E  + G  P    + +L  L S+    N++ G++P  LS C  LE +D S NDL+G
Sbjct  263  IYLYENRLTGPIPPE--LGRLKQLRSLLVWQNAITGSVPRELSQCPLLEVIDFSSNDLSG  320

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNL  682
             I  E   ++ L+   L  N + G IP  +    SL  L++ +N L G IP ++G   NL
Sbjct  321  DIPPEIGMLRNLQQFYLSQNNITGIIPPELGNCSSLTFLELDTNMLTGPIPPELGQLSNL  380

Query  683  SYLDLSMNSL  712
              L L  N L
Sbjct  381  KLLHLWQNKL  390



>emb|CDP06118.1| unnamed protein product [Coffea canephora]
Length=1106

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 93/176 (53%), Gaps = 4/176 (2%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNS-TSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            +E +ILL  K     P    + W+   S+PC+W GI C     VT I+LS + + G+   
Sbjct  31   EEGSILLDFKSFLSDPSGNLQSWDGLDSNPCNWTGIGCTDEYKVTSINLSRLNLSGAL--  88

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S+IIC+L  L   N S+N + G IPA+ + C  LE LDL  N L  KI  + +++ +LR 
Sbjct  89   SSIICKLPYLTEFNVSTNFISGPIPADFAICRSLEILDLCTNRLHSKIPAQLYNITSLRE  148

Query  548  LNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N +FGE+   +    S+E L V SN+L G IP  IG    L  +    N L
Sbjct  149  LYLCENYIFGEVQEEIGNMASIEELVVYSNNLTGIIPSSIGRLKRLRIIRAGRNYL  204


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 81/165 (49%), Gaps = 29/165 (18%)
 Frame = +2

Query  287  PGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSK  466
            P +  NS   V  +S++ ++  GS PA   +C+ + ++ ++  SN+L G IP  L +C  
Sbjct  402  PSLGLNSRLQVVDMSMNNLV--GSIPAQ--LCRYHTMMFLSLGSNNLSGNIPHGLKTCKS  457

Query  467  LETLDLSINDLTGKIAGEFFSMKTLRSLN------------------------LRGNMLF  574
            LETL L  N LTG ++ E   ++ L +L                         L GN  F
Sbjct  458  LETLMLGDNLLTGSLSIELSKLQNLSALELFHNRFSGFIPPEVGNLTNLERLLLSGNYFF  517

Query  575  GEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            G IP+ +     L + +VSSN L+G +P ++GN   L  LDLS N
Sbjct  518  GNIPSEIGKLVKLVAFNVSSNRLSGGVPHELGNCVKLQRLDLSGN  562


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 74/134 (55%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S + I LSE  + G  P    + Q+ NL  ++   N L G IP  L    +L  LDLSIN
Sbjct  313  SASEIDLSENDLTGFIPKE--LGQIPNLWLLHLFENLLQGDIPRELGQLKQLSKLDLSIN  370

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  E  ++++L +L L  N L G IP  + +   L+ +D+S N+L GSIP  +  
Sbjct  371  NLTGTIPVELQNLQSLENLQLFDNHLEGIIPPSLGLNSRLQVVDMSMNNLVGSIPAQLCR  430

Query  671  FYNLSYLDLSMNSL  712
            ++ + +L L  N+L
Sbjct  431  YHTMMFLSLGSNNL  444


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ++L E    GS P    + +L++L  +   +N + GTIP  L +CS    +DLS NDLTG
Sbjct  269  LALHENAFIGSLPKE--LGKLSHLKRLYVYTNQINGTIPRELGNCSSASEIDLSENDLTG  326

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
             I  E   +  L  L+L  N+L G+IP  +     L  LD+S N+L G+IP ++ N  +L
Sbjct  327  FIPKELGQIPNLWLLHLFENLLQGDIPRELGQLKQLSKLDLSINNLTGTIPVELQNLQSL  386

Query  683  SYLDLSMNSL  712
              L L  N L
Sbjct  387  ENLQLFDNHL  396


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LS     G+ P+   I +L  LV+ N SSN L G +P  L +C KL+ LDLS N 
Sbjct  506  LERLLLSGNYFFGNIPSE--IGKLVKLVAFNVSSNRLSGGVPHELGNCVKLQRLDLSGNL  563

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
             TG +  +   +  L  L L  N L G IP+ +     L  L++  N  +G+IP ++G  
Sbjct  564  FTGYLPEKLGMLTNLERLKLSDNKLNGLIPSSLGGLIRLTELEIGGNFFSGNIPVELGKL  623

Query  674  YNLSY-LDLSMNSL  712
              L   L+LS N L
Sbjct  624  TALQISLNLSHNML  637


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 66/147 (45%), Gaps = 27/147 (18%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+S  I +L  L  I    N L G IPA +S C  LE L L+ N L G    E  
Sbjct  180  LTGIIPSS--IGRLKRLRIIRAGRNYLSGPIPAEISECESLEVLGLAENQLEGSFPVELQ  237

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-------------------------SLESLDVSS  631
             +  L SL L  N+ +GEIP  +  +                          L+ L V +
Sbjct  238  KLVNLTSLILWKNLFYGEIPPEVGNFCRLELLALHENAFIGSLPKELGKLSHLKRLYVYT  297

Query  632  NDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N +NG+IP ++GN  + S +DLS N L
Sbjct  298  NQINGTIPRELGNCSSASEIDLSENDL  324


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 5/94 (5%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNL----VSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            I L+E+ +GG+F +  I  +L  L    +S+N S N L GTIP NL S   LE+L L+ N
Sbjct  600  IRLTELEIGGNFFSGNIPVELGKLTALQISLNLSHNMLNGTIPVNLGSLQMLESLYLNDN  659

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIP-TP  592
             L+G+I      + +L   NL  N L G IP TP
Sbjct  660  QLSGEIPSAIGGLMSLTVCNLSNNNLVGIIPNTP  693



>ref|XP_008354538.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1016

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 104/188 (55%), Gaps = 15/188 (8%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW----NSTSSPCDWPGISCNSNGSVTRIS  331
            SQSL    + E+A+LL LK +   P      W    ++TSS C WP ISC +N SVT +S
Sbjct  28   SQSLQ---DQEQAVLLKLKSYLQSP-PFLSHWIPSNSNTSSHCSWPEISC-TNNSVTGLS  82

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L ++ +  + P    IC L NL  ++ + N L G  P +L  CSKLE LDLS N   G I
Sbjct  83   LVBLNI--TLPVPPFICDLTNLTXVDLNYNYLXGEFPKSLYKCSKLEYLDLSQNYFVGPI  140

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLS  685
              +  S+  L+ L L GN  F +IP P +     LE+L +  N  NGS+P +IGN  NL 
Sbjct  141  PDDIDSLPRLKQLILXGNN-FSDIP-PXIGRLQELENLQLWMNQFNGSVPPEIGNLSNLK  198

Query  686  YLDLSMNS  709
             L++S N+
Sbjct  199  DLNMSWNT  206


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 0/108 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  L ++    ++  G +P  L     LE +DL+IN L+G+I    F++K L  + L  
Sbjct  219  KLKKLKNLWIRQSNXIGELPETLGEMEALEVIDLAINXLSGRIPNGLFTLKNLSIVYLFK  278

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            N L GE+P  + +++L  LD+S N L G IP++ GN   L+ L L +N
Sbjct  279  NXLSGEVPQVIESWNLSILDISENXLXGXIPEEYGNLTKLTELALFLN  326


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ + +  + G+ P    +     L   +  +N L G +P  L++ S L TL L  N 
Sbjct  460  LSRLEMRDNRLSGNIPTG--VSSWTGLKVFDAGNNHLSGAVPRELTALSSLMTLSLDQNQ  517

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG +  +  S ++L SLN   N L G IP    +   L  LD+S+N L+G IPD +G  
Sbjct  518  LTGSLPSDIVSWESLASLNFSRNQLSGTIPEKLGLLPGLTGLDLSANQLSGEIPDQLGRL  577

Query  674  YNLSYLDLSMNSL  712
              L+  +LS N L
Sbjct  578  -KLNQFNLSSNXL  589


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 62/121 (51%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P S  I +L NL      +N+  GT+       SKLE  ++ IN LTGK+  +    
Sbjct  330  GEIPKS--IGRLPNLRKFRMFNNNFSGTLAPEFGKYSKLEAFEVXINRLTGKLPDDLCYW  387

Query  533  KTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L  +   GN L GE+P+ +    SL+++ V  N L+G+IP  +    NL+ + +S NS
Sbjct  388  GKLEEVIAYGNXLSGELPSSLGNCSSLKNVKVQDNMLSGNIPSXMWTAPNLTTVLVSNNS  447

Query  710  L  712
            L
Sbjct  448  L  448


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 63/117 (54%), Gaps = 3/117 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P    +  L++L++++   N L G++P+++ S   L +L+ S N L+G I  +  
Sbjct  494  LSGAVPRE--LTALSSLMTLSLDQNQLTGSLPSDIVSWESLASLNFSRNQLSGTIPEKLG  551

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
             +  L  L+L  N L GEIP  +    L   ++SSN L G IP +  N  Y  S+LD
Sbjct  552  LLPGLTGLDLSANQLSGEIPDQLGRLKLNQFNLSSNXLXGXIPXEFENXAYEGSFLD  608


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 65/123 (53%), Gaps = 5/123 (4%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+S   C  ++L ++    N L G IP+ + +   L T+ +S N LTGK+  +  
Sbjct  400  LSGELPSSLGNC--SSLKNVKVQDNMLSGNIPSXMWTAPNLTTVLVSNNSLTGKLPEKXS  457

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            S   L  L +R N L G IPT + +++ L+  D  +N L+G++P ++    +L  L L  
Sbjct  458  S--DLSRLEMRDNRLSGNIPTGVSSWTGLKVFDAGNNHLSGAVPRELTALSSLMTLSLDQ  515

Query  704  NSL  712
            N L
Sbjct  516  NQL  518



>ref|XP_010460642.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=996

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 101/174 (58%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSN-GSVTRISLSEMIMGGSFPA  367
            E  IL  +K     P S    WNST  SPC W G+SC+ +  SVT + LS   + G FP+
Sbjct  20   EAFILQQVKHSLDDPDSSLSSWNSTDDSPCRWFGVSCSGDFTSVTSVDLSGANLAGPFPS  79

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              +IC+L+ L  ++  +NS+  T+P ++++C++L+ LDLS N LTG+I      + TL  
Sbjct  80   --VICRLSKLAELSLYNNSINSTLPLDVAACNRLQLLDLSQNLLTGEIPHTLADIPTLVH  137

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN   G+IP     +  LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  138  LDLTGNNFSGDIPASFGKFQNLEVLSLVYNLLDGTIPPYLGNISSLKMLNLSYN  191


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 68/127 (54%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + QL  LV ++ + N L G IP +L   S +  ++L  N LTG+I
Sbjct  213  LTECHLVGQIPDS--LGQLTRLVDLDLALNDLVGPIPRSLGGLSSVVQIELYNNSLTGEI  270

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G+IP  +    LESL++  N+L G +P  I    NL  L
Sbjct  271  PPELGNLKSLRLLDASMNQLTGKIPDELCRVPLESLNLYENNLEGEVPASIALSPNLYEL  330

Query  692  DLSMNSL  712
             +  N L
Sbjct  331  RIFGNRL  337


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 2/113 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S     GS P S  + QL  L +++  SN   G +   + S  KL  L+L+ N+
Sbjct  471  LNQLSASGNKFSGSLPVS--LMQLGELGTLDLHSNQFSGELTPGIKSWKKLNELNLADNE  528

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
             +G+I  E  S+  L  L+L GN   G+IP  + +  L  L++S N L+G +P
Sbjct  529  FSGRIPDEIGSLSVLNYLDLSGNQFSGKIPVSLQSLKLNQLNLSYNRLSGDLP  581


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 79/164 (48%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I   SN S+  + LS     GS P    +  LNNL  
Sbjct  418  WGLPHVYLLELINNSFSGEIAKSIGGASNLSL--LILSNNQFTGSLPEEVGV--LNNLNQ  473

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N   G++P +L    +L TLDL  N  +G++     S K L  LNL  N   G I
Sbjct  474  LSASGNKFSGSLPVSLMQLGELGTLDLHSNQFSGELTPGIKSWKKLNELNLADNEFSGRI  533

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  + +   L+ L+LS N L
Sbjct  534  PDEIGSLSVLNYLDLSGNQFSGKIPVSLQSL-KLNQLNLSYNRL  576



>ref|XP_002890776.1| hypothetical protein ARALYDRAFT_473063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67035.1| hypothetical protein ARALYDRAFT_473063 [Arabidopsis lyrata subsp. 
lyrata]
Length=996

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 98/171 (57%), Gaps = 5/171 (3%)
 Frame = +2

Query  203  ILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSN-GSVTRISLSEMIMGGSFPASAI  376
            IL  +K     P S    WNS   SPC W G+SC  +  SVT + LS   + G FP+  +
Sbjct  22   ILQQVKLSLDDPDSYLSSWNSNDDSPCRWSGVSCAGDFSSVTSVDLSGANLAGPFPS--V  79

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            IC+L+NL  ++  +NS+  T+P N+++C  L+TLDLS N LTG+I      + +L  L+L
Sbjct  80   ICRLSNLAHLSLYNNSINSTLPLNIAACKSLQTLDLSQNLLTGEIPQTLADIPSLVHLDL  139

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             GN   G+IP     +  LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  140  TGNNFSGDIPASFGKFENLEVLSLVYNLLDGTIPPFLGNISSLKMLNLSYN  190


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 74/137 (54%), Gaps = 5/137 (4%)
 Frame = +2

Query  311  GSVTRIS---LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G++T I    L+E  + G  P S  + QL+ LV ++ + N L G IP +L   + +  ++
Sbjct  202  GNLTNIEVMWLTECHLVGQIPDS--LGQLSKLVDLDLALNDLVGHIPPSLGGLTNVVQIE  259

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDD  661
            L  N LTG+I  E  ++K+LR L+   N L G+IP  +    LESL++  N+L G +P  
Sbjct  260  LYNNSLTGEIPPELGNLKSLRLLDASMNQLTGKIPDELCRVPLESLNLYENNLEGELPAS  319

Query  662  IGNFYNLSYLDLSMNSL  712
            I    NL  L +  N L
Sbjct  320  IALSPNLYELRIFGNRL  336


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 61/113 (54%), Gaps = 2/113 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S     GS P S  + +L  L +++   N   G + + + S  KL  L+L+ N+
Sbjct  470  LNQLSASGNKFSGSLPDS--LMKLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNE  527

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
             +G+I  E  S+  L  L+L GNM  G+IP  + +  L  L++S N L+G +P
Sbjct  528  FSGRIPDEIGSLSVLNYLDLSGNMFSGKIPVSLQSLKLNQLNLSYNRLSGDLP  580


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 81/164 (49%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPF-SLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P  +L E  N++ S      I   SN S+  +S +E    GS P    I  L+NL  
Sbjct  417  WGLPHVNLLELVNNSFSGEISKSIGGASNLSLLILSNNEFT--GSLPEE--IGSLDNLNQ  472

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N   G++P +L    +L TLDL  N  +G++     S K L  LNL  N   G I
Sbjct  473  LSASGNKFSGSLPDSLMKLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNEFSGRI  532

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  + +   L+ L+LS N L
Sbjct  533  PDEIGSLSVLNYLDLSGNMFSGKIPVSLQSL-KLNQLNLSYNRL  575



>ref|XP_002517850.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF44368.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=983

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = +2

Query  236  PFSLFEQWNST-SSPCDWPGISCN-SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSIN  409
            P  L   WN   S+PC+W GI C+ S   V  + LSE  + G FP+   +C+L  L SI+
Sbjct  36   PTHLLSSWNDRDSTPCNWYGIHCDPSTQRVISVDLSESQLSGPFPS--FLCRLPYLTSIS  93

Query  410  FSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT  589
              +N++  ++P  +S+C KLE+LDL  N L G I      ++ LR LNL GN L GEIP 
Sbjct  94   LYNNTINSSLPTQISNCQKLESLDLGQNLLVGIIPESLSQLQNLRYLNLAGNSLTGEIPI  153

Query  590  PMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
                +  LE+L ++ N LNG+IP  + N   L +L L+ N
Sbjct  154  EFGEFKNLETLVLAGNYLNGTIPSQLSNISTLQHLLLAYN  193


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 0/117 (0%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P  A + +L  L +++ S N L G+IP++ +    +  ++L  N L+G +   F ++ TL
Sbjct  223  PIPAALSRLTQLENLDLSQNRLTGSIPSSFAEFKSIVQIELYNNSLSGSLPAGFSNLTTL  282

Query  542  RSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            R  +   N L G IP  +    LESL++  N L G +P+ I    NL  L L  N L
Sbjct  283  RRFDASMNELSGMIPVELCKLELESLNLFENRLEGKLPESIAKSPNLYELKLFNNKL  339


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 67/131 (51%), Gaps = 4/131 (3%)
 Frame = +2

Query  323  RISLSEMIMGGSFPA--SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            R+ L E++ G S     S II   +NL  +  S+N   G IP  +     L     S N 
Sbjct  424  RVYLVELV-GNSLSGYVSKIISSAHNLSVLLISNNRFSGNIPKEIGFLGNLIEFSASNNM  482

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
             TG + G F ++  L  L L  N L G  P  +  + SL  L++++N L+G IPD+IG+ 
Sbjct  483  FTGSVPGTFVNLSMLNRLVLNNNKLSGGFPQSIRGWKSLNELNLANNKLSGVIPDEIGDL  542

Query  674  YNLSYLDLSMN  706
              L+YLDLS N
Sbjct  543  PVLNYLDLSGN  553


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 63/134 (47%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++ R   S   + G  P    +C+L  L S+N   N L G +P +++    L  L L  N
Sbjct  281  TLRRFDASMNELSGMIPVE--LCKLE-LESLNLFENRLEGKLPESIAKSPNLYELKLFNN  337

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
             L G++  +      L+SL++  N   GEIP  + A   LE L +  N  +G IP+ +G 
Sbjct  338  KLIGQLPSQLGLNAPLKSLDVSYNGFSGEIPENLCAKGELEDLILIYNSFSGKIPESLGR  397

Query  671  FYNLSYLDLSMNSL  712
             Y+L    L  N L
Sbjct  398  CYSLGRARLRNNQL  411


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ++L E  + G  P S  I +  NL  +   +N L G +P+ L   + L++LD+S N  +G
Sbjct  308  LNLFENRLEGKLPES--IAKSPNLYELKLFNNKLIGQLPSQLGLNAPLKSLDVSYNGFSG  365

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNL  682
            +I     +   L  L L  N   G+IP  +   YSL    + +N L+GS+P++      +
Sbjct  366  EIPENLCAKGELEDLILIYNSFSGKIPESLGRCYSLGRARLRNNQLSGSVPEEFWGLPRV  425

Query  683  SYLDLSMNSL  712
              ++L  NSL
Sbjct  426  YLVELVGNSL  435



>ref|XP_004513049.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1012

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = +2

Query  167  QSLTTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEM  343
            +S   +  +E  ILL +K H   P S    WN S +S C WP I+C S GSVT ++L   
Sbjct  26   KSQYHFHVEEHLILLKIKFHLQNP-SFLTHWNTSNTSYCSWPEITCTS-GSVTGLTLVNS  83

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             +  + P    +C L NL  ++F  N + G  P NL +CSKL+ LDLS+N+L G+I  + 
Sbjct  84   NITQTIPF--FLCDLKNLTHVDFHKNFIPGEFPKNLYTCSKLKYLDLSMNNLVGEIPYDI  141

Query  524  FSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
             S+  L+ LNL      G+IP+ +     L  + +     NG+ P +IGN  NL  LDLS
Sbjct  142  HSLVNLQYLNLGATNFSGDIPSSIGRMKELRFIALQYCLFNGTFPYEIGNLLNLETLDLS  201

Query  701  MNSL  712
             N++
Sbjct  202  SNNM  205


 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 63/112 (56%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            + +L  L   +   ++L G IP ++     LE LD+S N+LTG I    F +K L  + L
Sbjct  215  LTKLKKLKVFHMFGSNLVGEIPEDIGEMVALENLDISENNLTGNIPSGLFMLKNLSIVYL  274

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N   GEIP+ + A +L  +D++ N+L G IP+D      L++LDL MN+L
Sbjct  275  DRNSFHGEIPSFVEAMNLIEIDLAENNLTGKIPNDFSKLKKLTWLDLFMNNL  326


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            N+V    S N L G++P  L++  KLE+L L  N L G +  +  S ++L +LNL  N L
Sbjct  481  NVVEFIASKNFLNGSVPQELTNLFKLESLLLDQNQLKGSLPFDVISWQSLVTLNLSQNQL  540

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIP  655
            FGEIP  +    SL  LD+S N  +G IP
Sbjct  541  FGEIPNSIGHLPSLSVLDLSQNQFSGQIP  569


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL+ I+ + N+L G IP + S   KL  LDL +N+L+G+I     ++ +L   ++  N L
Sbjct  291  NLIEIDLAENNLTGKIPNDFSKLKKLTWLDLFMNNLSGEIPQSIGNLPSLIGFSVFKNKL  350

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G +P     YS LE   +++N  NG +PD++     L  L++  N L
Sbjct  351  SGTLPNDFGLYSKLEYFHIATNSFNGRLPDNLCYHGKLHSLNVYENHL  398



>gb|AES77382.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=808

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 86/152 (57%), Gaps = 1/152 (1%)
 Frame = +2

Query  260  NSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTI  439
            N   + C WPGI+CN+ GS+T ISL   I  G            NLV +N +S+ + G I
Sbjct  46   NHAPTRCQWPGITCNNEGSITNISLPPEIQLGDKFGKFHFSSFTNLVHLNLASHGIIGNI  105

Query  440  PANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LES  616
            P  L++ SKL  LD+S ND+ G I    +S+K L +LNL  N L G IP+ +   + L  
Sbjct  106  PFELATLSKLIFLDVSSNDIEGHIPSNIWSLKNLITLNLSRNKLNGSIPSSIGQLTKLTF  165

Query  617  LDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L + +N  +GSIP +IG   NL +LDLS NS 
Sbjct  166  LHLDANMFSGSIPLEIGRLQNLIHLDLSHNSF  197


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +  + +S+    G  P+   I +L+ L+ ++FS N  +G IP +LS+CS L+ L+LS N
Sbjct  282  QLEHMKISDNKFFGVIPSE--IRKLSKLLVLDFSRNMFYGDIPTSLSNCSNLKVLNLSHN  339

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIG  667
            ++TG I      +  L  ++L  N+L GEIP  +  V Y+   LD+S N L G+IP  + 
Sbjct  340  NITGSIPSHIGELVNLDLIDLSHNLLSGEIPYQLGNVKYT-RVLDLSHNHLIGTIPSSLV  398

Query  668  NFYNLSYLDLSMNSL  712
               N   +DLS NSL
Sbjct  399  LLRN---IDLSYNSL  410


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 68/156 (44%), Gaps = 27/156 (17%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +T + L   +  GS P    I +L NL+ ++ S NS +G IP  + S   L+ L LSIN
Sbjct  162  KLTFLHLDANMFSGSIPLE--IGRLQNLIHLDLSHNSFFGLIPIEIGSLKSLKYLSLSIN  219

Query  494  DLTGKIAGE------------------------FFSMKTLRSLNLRGNMLFGEIPTPMVA  601
            +L+G I  E                         +++  L  LNL  N +   +   +V 
Sbjct  220  NLSGSIPLEIGNLNNLLYLDLSDNNLGGESLSFLYNLINLIELNLSRNNISSIMSHELVK  279

Query  602  YS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            ++ LE + +S N   G IP +I     L  LD S N
Sbjct  280  WTQLEHMKISDNKFFGVIPSEIRKLSKLLVLDFSRN  315



>ref|XP_003621164.1| Receptor kinase [Medicago truncatula]
Length=799

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 86/152 (57%), Gaps = 1/152 (1%)
 Frame = +2

Query  260  NSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTI  439
            N   + C WPGI+CN+ GS+T ISL   I  G            NLV +N +S+ + G I
Sbjct  46   NHAPTRCQWPGITCNNEGSITNISLPPEIQLGDKFGKFHFSSFTNLVHLNLASHGIIGNI  105

Query  440  PANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LES  616
            P  L++ SKL  LD+S ND+ G I    +S+K L +LNL  N L G IP+ +   + L  
Sbjct  106  PFELATLSKLIFLDVSSNDIEGHIPSNIWSLKNLITLNLSRNKLNGSIPSSIGQLTKLTF  165

Query  617  LDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L + +N  +GSIP +IG   NL +LDLS NS 
Sbjct  166  LHLDANMFSGSIPLEIGRLQNLIHLDLSHNSF  197


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +  + +S+    G  P+   I +L+ L+ ++FS N  +G IP +LS+CS L+ L+LS N
Sbjct  282  QLEHMKISDNKFFGVIPSE--IRKLSKLLVLDFSRNMFYGDIPTSLSNCSNLKVLNLSHN  339

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIG  667
            ++TG I      +  L  ++L  N+L GEIP  +  V Y+   LD+S N L G+IP  + 
Sbjct  340  NITGSIPSHIGELVNLDLIDLSHNLLSGEIPYQLGNVKYT-RVLDLSHNHLIGTIPSSLV  398

Query  668  NFYNLSYLDLSMNSL  712
               N   +DLS NSL
Sbjct  399  LLRN---IDLSYNSL  410


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 68/156 (44%), Gaps = 27/156 (17%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +T + L   +  GS P    I +L NL+ ++ S NS +G IP  + S   L+ L LSIN
Sbjct  162  KLTFLHLDANMFSGSIPLE--IGRLQNLIHLDLSHNSFFGLIPIEIGSLKSLKYLSLSIN  219

Query  494  DLTGKIAGE------------------------FFSMKTLRSLNLRGNMLFGEIPTPMVA  601
            +L+G I  E                         +++  L  LNL  N +   +   +V 
Sbjct  220  NLSGSIPLEIGNLNNLLYLDLSDNNLGGESLSFLYNLINLIELNLSRNNISSIMSHELVK  279

Query  602  YS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            ++ LE + +S N   G IP +I     L  LD S N
Sbjct  280  WTQLEHMKISDNKFFGVIPSEIRKLSKLLVLDFSRN  315



>ref|XP_008778617.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera]
Length=291

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 103/186 (55%), Gaps = 10/186 (5%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSP--CDWPGISCNSNGSVTRISLS  337
            SQ  TT GE  R ILL +K+ W  P S  E WN ++S   C W GI C+ NGSVT I+L 
Sbjct  24   SQPATTDGE--RQILLQIKKGWRNP-SALESWNDSTSTNHCTWAGIGCSGNGSVTNITLV  80

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
               +    PA+  IC+L +L  ++ S N +  + P +L +CSKL+ LDLS N   G I  
Sbjct  81   NQNISQPIPAT--ICELRSLSFLDLSYNYITTSFPKSLYNCSKLQYLDLSQNYFVGVIPS  138

Query  518  EFFSMK-TLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
            + + +   L +L L  N L G+IP  +  +   +E L +++N  N S P ++GN  NL  
Sbjct  139  DIYRLSPRLTTLILSANNLTGDIPRSIGRLPAMIEYLALNNNLFNVSFPAELGNLSNLQT  198

Query  689  LDLSMN  706
            L L+ N
Sbjct  199  LWLAYN  204



>ref|XP_011078429.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1216

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 98/186 (53%), Gaps = 5/186 (3%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQ-WNSTSSPCDWPGISCNS-NGSVTRISLS  337
            + +LT    DE A+L +  +    P  +  + W+ ++S C W G+ C + +  VT + +S
Sbjct  22   AMALTNITTDETALLALKSRLAIDPSHILSRNWSDSTSVCSWIGVMCGARHQRVTALDIS  81

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
             M + G+ P    +  L  LVS+N SSNS  G++P  L+   +LE +D   ND  G +  
Sbjct  82   TMGLAGNLPPD--MGNLTFLVSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPS  139

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
             F  +  L+ LNLR N   G  PT +   S LE LD+S N L G IPD+IGN +NL  L 
Sbjct  140  WFGFLGELQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYNPLQGKIPDEIGNLHNLKRLS  199

Query  695  LSMNSL  712
            L  N  
Sbjct  200  LQFNKF  205


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = +2

Query  281  DWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSC  460
            D  G  C S   +  + LS   + G  P++  I Q + L  ++ S N   G++P+ + + 
Sbjct  232  DLQGDLCRSLPRLNELYLSSNELDGQIPSN--ISQCSQLRLLSLSHNKFSGSVPSGIGNL  289

Query  461  SKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSND  637
            + LE L L  NDLTG+I  E   ++ L+ L +  N L G IP+ +    SL+ +++++ +
Sbjct  290  TALEILYLGSNDLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISSLQYINIANCN  349

Query  638  LNGSIPDDI  664
            L G++P D+
Sbjct  350  LTGALPADM  358


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +LN+L+ +N +SN L G++P ++ +      LDLS+N  +G I      +  L +L+L  
Sbjct  704  RLNDLLQLNLTSNVLVGSLPPDIGNLKTATVLDLSMNQFSGTIPPSLGDIHDLINLSLAH  763

Query  563  NMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N   G IP  +    ++  LD+S N+L+G+IP  +     L+Y ++S N L
Sbjct  764  NKFEGSIPESIGQLVNIAELDLSHNNLSGNIPRSLERILYLTYFNVSFNDL  814


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 69/135 (51%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQ-LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
            S+  I+++   + G+ PA   +C   + L  + F  N L G +P  +  CS L+   LS 
Sbjct  339  SLQYINIANCNLTGALPAD--MCSGSSRLQEVFFHVNELVGELPERIGECSALQMWSLSY  396

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIG  667
            N++TG I     ++  L++  +  N L G IP  +    SLE L +  N+L G+IP +I 
Sbjct  397  NNITGVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIF  456

Query  668  NFYNLSYLDLSMNSL  712
            N   L  + +SMN L
Sbjct  457  NISTLQSISVSMNQL  471


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANL-SSCSKLETLDLSIN  493
            + R+SL      G  P +  I  +++L S+  + NSL G +  +L  S  +L  L LS N
Sbjct  195  LKRLSLQFNKFDGLIPTT--IFNISSLESLALTGNSLSGDLQGDLCRSLPRLNELYLSSN  252

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +L G+I         LR L+L  N   G +P+ +    +LE L + SNDL G IP+++G+
Sbjct  253  ELDGQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDLTGQIPEELGD  312

Query  671  FYNLSYLDLSMNSL  712
              NL  L +  N L
Sbjct  313  LRNLKELGMGDNFL  326


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I  L  L ++   +N+L   IP +L   + L  L+L+ N L G +  +  ++KT   L+L
Sbjct  678  IGNLTALRTLYIGNNNLSSGIPPSLWRLNDLLQLNLTSNVLVGSLPPDIGNLKTATVLDL  737

Query  557  RGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N   G IP  +   + L +L ++ N   GSIP+ IG   N++ LDLS N+L
Sbjct  738  SMNQFSGTIPPSLGDIHDLINLSLAHNKFEGSIPESIGQLVNIAELDLSHNNL  790



>ref|XP_010478219.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=1003

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 100/174 (57%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSN-GSVTRISLSEMIMGGSFPA  367
            E  IL  +K     P S    WNST  SPC W G+SC  +  SVT + LS   + G FP+
Sbjct  20   EAFILQQVKHSLDDPDSSLSSWNSTDDSPCRWFGVSCGGDFTSVTSVDLSSANLAGPFPS  79

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              +IC+L+ L  ++  +NS+  T+P ++++C++L+ LDLS N LTG+I      + TL  
Sbjct  80   --VICRLSKLSELSLYNNSINSTLPLDVAACNRLQLLDLSQNLLTGEIPHTLADIPTLVH  137

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN   G+IP     +  LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  138  LDLTGNNFSGDIPASFGKFQNLEVLSLVYNLLDGTIPPYLGNISSLKMLNLSYN  191


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + QL+ LV ++ + N L G IP +L   S +  ++L  N LTG+I
Sbjct  213  LTECHLVGQIPDS--LGQLSRLVDLDLALNDLVGPIPRSLGGLSSVVQIELYNNSLTGEI  270

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G+IP  +    LESL++  N+L G +P  I    NL  L
Sbjct  271  PPELGNLKSLRLLDASMNQLTGKIPDELCRVPLESLNLYENNLEGEVPASIALSPNLYEL  330

Query  692  DLSMNSL  712
             +  N L
Sbjct  331  RIFGNRL  337


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 80/164 (49%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I   SN S+  +S +E    GS P    I  LNNL  
Sbjct  418  WGLPHVYLLELINNSFSGEIAKSIGGASNLSLLILSNNEFT--GSLPEE--IGVLNNLNQ  473

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N   G++P +L    +L TLDL  N  +G++     S K L  LNL  N   G I
Sbjct  474  LSASGNKFSGSLPVSLMQLGELGTLDLHGNQFSGELTPGIKSWKKLNELNLADNEFSGRI  533

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  + +   L+ L+LS N L
Sbjct  534  PDEIGSLSVLNYLDLSGNQFSGKIPVSLQSL-KLNQLNLSYNRL  576


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 59/113 (52%), Gaps = 2/113 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S     GS P S  + QL  L +++   N   G +   + S  KL  L+L+ N+
Sbjct  471  LNQLSASGNKFSGSLPVS--LMQLGELGTLDLHGNQFSGELTPGIKSWKKLNELNLADNE  528

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
             +G+I  E  S+  L  L+L GN   G+IP  + +  L  L++S N L+G +P
Sbjct  529  FSGRIPDEIGSLSVLNYLDLSGNQFSGKIPVSLQSLKLNQLNLSYNRLSGDLP  581



>ref|XP_011007104.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=982

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 94/173 (54%), Gaps = 6/173 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            ++A+LL LK HW  P SL EQW  S SS C WPG+ CN N  VT++ L    + G+ P  
Sbjct  28   DQAVLLRLKHHWQNPLSL-EQWTPSNSSHCTWPGVVCNDN-YVTQLILDNKNISGTIPP-  84

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
             ++  L NL  +NFS+N++ G  P  + + SKLE LDLS N + G I  +   +  L  L
Sbjct  85   -LLSDLKNLTFLNFSNNNIIGKFPVAVHNLSKLEILDLSQNYIVGTIPDDIDRLSRLSYL  143

Query  551  NLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            NL  N   G IP  +     L +L +  N  +G+ P +IGN   L  L ++ N
Sbjct  144  NLCANNFTGNIPAAIGRIPELRTLYLHDNLFDGTFPPEIGNLSKLEELFMAHN  196


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 68/132 (52%), Gaps = 4/132 (3%)
 Frame = +2

Query  329  SLSEMIMGGS-FPASAI---ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
             L E+ M  + F +S +     QL  L  +  S  +L G IP  +     LE LDLS N 
Sbjct  187  KLEELFMAHNGFSSSRLHSSFTQLKKLKMLWISGANLIGEIPQMIGEMVALEHLDLSSNK  246

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFY  676
            LTG I G  F +  LR L L  N L GEIP  + A +L  +D+S N+L G+IP D G   
Sbjct  247  LTGNIPGSLFMLMNLRVLWLYRNKLSGEIPQVVEALNLTFVDLSENNLTGTIPVDFGKLD  306

Query  677  NLSYLDLSMNSL  712
             LS L+L  N L
Sbjct  307  KLSGLNLFSNHL  318


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 70/134 (52%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++  + LS   + G+ P S  +  L NL  +    N L G IP  + + + L  +DLS N
Sbjct  236  ALEHLDLSSNKLTGNIPGSLFM--LMNLRVLWLYRNKLSGEIPQVVEALN-LTFVDLSEN  292

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  +F  +  L  LNL  N L GEIP  +    +L+   + +N+L+GSIP D+G 
Sbjct  293  NLTGTIPVDFGKLDKLSGLNLFSNHLSGEIPEGIGRLPALKDFKLFTNNLSGSIPPDLGR  352

Query  671  FYNLSYLDLSMNSL  712
            +  L   ++  N L
Sbjct  353  YSALERFEVCSNRL  366


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +    N L GT+P N+ S   L  L+LS N L+G+I  +F  +
Sbjct  486  GTIPLE--LTALPNLTVLLLDKNQLTGTLPPNIMSWKSLNILNLSQNQLSGQIPEKFGFL  543

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
              L  L+L  N   G+IP  + +  L  L++SSN+L G IP +  N  Y  S+L+
Sbjct  544  PDLVKLDLSDNQFSGDIPPQLGSLRLVFLNLSSNNLMGQIPTEYENVAYATSFLN  598



>ref|XP_006372068.1| hypothetical protein POPTR_0018s09520g, partial [Populus trichocarpa]
 gb|ERP49865.1| hypothetical protein POPTR_0018s09520g, partial [Populus trichocarpa]
Length=955

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 96/179 (54%), Gaps = 6/179 (3%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMG  352
            + + + E+A+LL LKQHW  P SL EQW  S SS C WPG+ C  N  +T++ L    + 
Sbjct  24   SQFHDQEQAVLLRLKQHWQNPLSL-EQWTPSNSSHCTWPGVVCTDN-YITQLILDNKNIS  81

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +NFS+N++ G  P  + + SKLE LDLS N + G I  +   +
Sbjct  82   GTIPP--FLSDLKNLTFLNFSNNNIIGKFPVAVHNLSKLEILDLSQNYIVGTIPDDIDCL  139

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              L  LNL  N   G IP  +     L +L +  N  +G+ P +IGN   L  L ++ N
Sbjct  140  ARLLYLNLCVNNFTGSIPAAIGRIPELRTLYLHDNLFDGTFPPEIGNLSKLEELYMAHN  198


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  +  S  +L G IP  +     LE LDLS N LTG I G  F +  LR L L  
Sbjct  211  QLKKLKMLWISGANLIGEIPQMIGEMVALEHLDLSSNKLTGNIPGSLFMLMNLRVLWLYK  270

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  + A +L S+D+S N+L G+IP D G    LS L L  N L
Sbjct  271  NKLSGEIPRVVEALNLTSVDLSENNLIGTIPVDFGKLDKLSGLSLFSNQL  320


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 58/108 (54%), Gaps = 2/108 (2%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL   N S+N   GTIP  L++   +  L L  N LTG +  +  S+K+L +LNL  N L
Sbjct  475  NLEVFNASNNQFTGTIPLELTALPNMTVLLLDKNQLTGALPSDIISLKSLTTLNLSQNQL  534

Query  572  FGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP        L  LD+S N  +G IP  +G+   L +L+LS N+L
Sbjct  535  SGHIPEKFGFLPDLVKLDLSDNQFSGKIPPQLGSL-KLVFLNLSSNNL  581


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L N+  +    N L G +P+++ S   L TL+LS N L+G I  +F  +
Sbjct  488  GTIPLE--LTALPNMTVLLLDKNQLTGALPSDIISLKSLTTLNLSQNQLSGHIPEKFGFL  545

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
              L  L+L  N   G+IP  + +  L  L++SSN+L G IP +  N  Y  S+L+
Sbjct  546  PDLVKLDLSDNQFSGKIPPQLGSLKLVFLNLSSNNLMGQIPTEFENVAYATSFLN  600


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 70/134 (52%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++  + LS   + G+ P S  +  L NL  +    N L G IP  + + + L ++DLS N
Sbjct  238  ALEHLDLSSNKLTGNIPGSLFM--LMNLRVLWLYKNKLSGEIPRVVEALN-LTSVDLSEN  294

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +L G I  +F  +  L  L+L  N L GEIP  +    +L+   + SN+L+GSIP D+G 
Sbjct  295  NLIGTIPVDFGKLDKLSGLSLFSNQLSGEIPEGIGRLPALKDFKLFSNNLSGSIPPDLGR  354

Query  671  FYNLSYLDLSMNSL  712
            +  L   ++  N L
Sbjct  355  YSALERFEVCSNRL  368



>ref|XP_008337667.1| PREDICTED: receptor-like protein kinase HSL1, partial [Malus 
domestica]
Length=1013

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 98/187 (52%), Gaps = 14/187 (7%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW----NSTSSPCDWPGISCNSNGSVTRIS  331
            SQSL    + E+A+L  LK +   P      W    ++TSS C WP ISC +N SVT++ 
Sbjct  23   SQSLQ---DQEQAVLXKLKSYLNSP-PFLSHWILSKSNTSSHCSWPEISC-TNNSVTKLF  77

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L    +  + P  + IC L NL  I+ S N L G  P  +  CSKLE LDLS N   G I
Sbjct  78   LDNKNI--TLPVPSFICDLKNLTVIDLSYNYLPGAFPKAVYKCSKLEYLDLSQNXFVGPI  135

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLS  685
              +  S+  L+ L L  N   G+IP P +     LE+L +  N  NGS+P +IGN  NL 
Sbjct  136  PDDIDSLPRLQQLILAANNFSGDIP-PAIGRLQELENLQLYMNHFNGSVPPEIGNLSNLK  194

Query  686  YLDLSMN  706
             L +S N
Sbjct  195  DLXMSFN  201


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 62/108 (57%), Gaps = 0/108 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  L ++    ++L G +   L     LE LDL+ N+L+G+I    FS+K L  + L  
Sbjct  215  KLKKLKTLWIRQSNLIGELHGTLGEMEALEQLDLAXNNLSGEIPSGLFSLKNLSXIYLFM  274

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            N L GE+P  + + +L  LD+S+N+L G+IP++ GN   L+ L L  N
Sbjct  275  NXLSGEVPRVIESLNLSILDLSNNNLTGTIPEEYGNLTKLTELALFFN  322


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P S  I +L NLV     +N+L G +P      SKLE  ++  N LTGK+       
Sbjct  326  GEVPKS--IARLPNLVHFKIFNNNLSGILPPEFGRHSKLEAFEVCXNRLTGKLPDNLCYW  383

Query  533  KTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L +L    N L GE+P+ +    SL+++ V  N L+G+IP  +    NL+   +S NS
Sbjct  384  GKLETLIAYXNHLSGELPSSLGNCSSLKTVKVHDNLLSGNIPSGMWTAPNLTSXLISNNS  443

Query  710  L  712
            L
Sbjct  444  L  444



>ref|XP_002324456.2| hypothetical protein POPTR_0018s09550g [Populus trichocarpa]
 gb|EEF03021.2| hypothetical protein POPTR_0018s09550g [Populus trichocarpa]
Length=1010

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 96/179 (54%), Gaps = 6/179 (3%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMG  352
            + + + E+A+LL LKQHW  P SL EQW  S SS C WPG+ C  N  +T++ L    + 
Sbjct  24   SQFHDQEQAVLLRLKQHWQNPLSL-EQWTPSNSSHCTWPGVVCTDN-YITQLILDNKNIS  81

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +NFS+N++ G  P  + + SKLE LDLS N + G I  +   +
Sbjct  82   GTIPP--FLSDLKNLTFLNFSNNNIIGKFPVAVHNLSKLEILDLSQNYIVGTIPDDIDCL  139

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              L  LNL  N   G IP  +     L +L +  N  +G+ P +IGN   L  L ++ N
Sbjct  140  ARLLYLNLCVNNFTGSIPAAIGRIPELRTLYLHDNLFDGTFPPEIGNLSKLEELYMAHN  198


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  +  S  +L G IP  +     LE LDLS N LTG I G  F +  LR L L  
Sbjct  211  QLKKLKMLWISGANLIGEIPQMIGEMVALEHLDLSSNKLTGNIPGSLFMLMNLRVLWLYK  270

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  + A +   +D+S N+LNG+IP D G    LS L LS N L
Sbjct  271  NKLSGEIPQVVEALNSIVIDLSWNNLNGTIPVDFGKLDKLSGLSLSFNQL  320


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P    +  L NL  +    N L G +P+++ S   L TL+LS N L+G+I  E   +
Sbjct  488  GTIPLE--LTALPNLTVLLLDKNQLTGALPSDIISWKSLTTLNLSQNQLSGQIPEEIAIL  545

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
              L  L+L  N   G+IP  +    L  L++SSN L G IP +  N  Y+ S+L+
Sbjct  546  PHLLELDLSDNQFSGQIPPQLGLLRLTYLNLSSNHLVGKIPAEYENAAYSSSFLN  600


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++  + LS   + G+ P S  +  L NL  +    N L G IP  + + + +  +DLS N
Sbjct  238  ALEHLDLSSNKLTGNIPGSLFM--LMNLRVLWLYKNKLSGEIPQVVEALNSI-VIDLSWN  294

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +L G I  +F  +  L  L+L  N L GEIP  +    +L+   + SN+L+G IP D+G 
Sbjct  295  NLNGTIPVDFGKLDKLSGLSLSFNQLSGEIPESIGRLPALKDFALFSNNLSGPIPPDLGR  354

Query  671  FYNLSYLDLSMNSL  712
            +  L    ++ N L
Sbjct  355  YSALDGFQVASNRL  368



>gb|KJB57488.1| hypothetical protein B456_009G166500 [Gossypium raimondii]
Length=994

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 100/176 (57%), Gaps = 5/176 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNS-NGSVTRISLSEMIMGGSFPA  367
            E   LL +K     P S+   WN    +PC+W G+SC+S  GSVT + LS   + G FP+
Sbjct  23   EGLYLLQVKASLSDPDSVLSSWNPRDPTPCNWRGVSCDSATGSVTSLDLSYANVAGPFPS  82

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              ++C+L NL  +NF  N++  TIP+++S+C  L  LDL+ N LTG++      +  L+ 
Sbjct  83   --LLCRLQNLSFVNFFYNNINSTIPSDISTCQNLVHLDLAQNLLTGELPHTLADLPNLKY  140

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+L GN + G+ P     +  LE L +  N L+G+IP  +GN   L  L+LS N L
Sbjct  141  LDLTGNNISGDFPESFGRFQKLEVLSLVYNLLDGTIPAFLGNISTLKMLNLSYNPL  196


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 6/145 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I+  +N S+  IS +E    GS P    I  ++NLV 
Sbjct  421  WGLPHVYLLELVNNSFSGQIGKSIAKAANLSLLIISRNEF--NGSLPEE--IGLVDNLVQ  476

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N   G++P ++     L  LDL  N+L G++     S+K L  LNL  N   G+I
Sbjct  477  LSASGNKFGGSLPKSIVKLDGLGILDLHGNELEGELPSGIESLKKLNELNLADNKFSGKI  536

Query  584  PTPMVAYS-LESLDVSSNDLNGSIP  655
            P  + + S L  LD+S+N L G +P
Sbjct  537  PDGIGSLSVLNYLDLSNNQLTGRVP  561


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L  L  ++ + N L G IP++L+  + +  ++L  N LTG++
Sbjct  216  LTECNLVGEIPDS--LGRLKKLTDLDLALNHLVGNIPSSLTELASVVQIELYNNSLTGEL  273

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
               F  +  LR L+   N L G IP  +    LESL++  N+  G++P  I +   L  L
Sbjct  274  PRGFSKLTNLRLLDASMNQLTGTIPDELTQLPLESLNLYQNNFEGTLPSSIADSPALYEL  333

Query  692  DLSMNSL  712
             L  N L
Sbjct  334  RLFQNRL  340


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P S  +C+  +L  +    NS  G IP++L+ C  L  + L  N L+G I   F+ +
Sbjct  366  GPIPPS--LCEKRSLEELLMIHNSFSGQIPSSLAECRSLNRIRLGYNKLSGDIPAGFWGL  423

Query  533  KTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              +  L L  N   G+I   +  A +L  L +S N+ NGS+P++IG   NL  L  S N 
Sbjct  424  PHVYLLELVNNSFSGQIGKSIAKAANLSLLIISRNEFNGSLPEEIGLVDNLVQLSASGNK  483

Query  710  L  712
             
Sbjct  484  F  484



>ref|XP_006662949.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Oryza 
brachyantha]
Length=253

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 97/175 (55%), Gaps = 4/175 (2%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            E  IL   +Q W  P ++ + W+ T ++PC W  ++CN+N SV R+ L   + G S P  
Sbjct  31   EGDILYAQRQAWKDPNNVLQSWDPTLANPCTWFHVTCNNNNSVVRLDLG--LAGLSGPLI  88

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
              + +L+ L       N L G+IPA+L + S L +LDL  N LTG I     ++ TLR+L
Sbjct  89   PQLGELSYLEYFELFGNELNGSIPASLGNLSSLVSLDLQGNLLTGAIPDSLGAISTLRNL  148

Query  551  NLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GN L G IP  +   + L  L++  N L+G+IP  +GN   L +L L+ NSL
Sbjct  149  RLYGNNLTGSIPQSLGDLTNLVKLELQKNSLSGTIPASLGNIKTLEFLRLNENSL  203



>gb|KEH27211.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=868

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 100/195 (51%), Gaps = 15/195 (8%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQW--NSTSSPCDWPGISCNSNGSVTRISL  334
            Y  S +     E  ILL +K+H+  P S    W  ++TSS C WP I C  N SVT +S+
Sbjct  12   YGNSESQLYNQEHEILLNIKKHFQNP-SFLSHWIKSNTSSHCSWPEILCTKN-SVTSLSM  69

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
                +  + P    +C+L NL  I+F  N +    P +L +CSKLE LDLS N   G I 
Sbjct  70   INTNITQTIPP--FLCELKNLTYIDFQFNCIPNEFPKSLYNCSKLEHLDLSQNFFVGTIP  127

Query  515  GEFFSMKTLRSLNLRGNMLFGEIPTPM---------VAYSLESLDVSSNDLNGSIPDDIG  667
             +   +  L+ L+L  N   G+IP  +         VA +L  +D+S N+L G IP+D G
Sbjct  128  NDIDRLAHLQFLSLGANNFSGDIPMSIEIVSLERYQVALNLIEIDLSENNLVGKIPNDFG  187

Query  668  NFYNLSYLDLSMNSL  712
                L+YL   MN+L
Sbjct  188  ELQRLTYLSFFMNNL  202


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 68/126 (54%), Gaps = 6/126 (5%)
 Frame = +2

Query  353  GSFPASAIICQLN------NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
            G  P S  I  L       NL+ I+ S N+L G IP +     +L  L   +N+LTGKI 
Sbjct  148  GDIPMSIEIVSLERYQVALNLIEIDLSENNLVGKIPNDFGELQRLTYLSFFMNNLTGKIP  207

Query  515  GEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
               F +K L ++ L  N LFGEIP  + A +L  +D+S N+L G IP+D G    L+ L+
Sbjct  208  SSLFMLKNLSTVYLAMNSLFGEIPNVVEALNLTKIDLSMNNLVGKIPNDFGKLQQLTVLN  267

Query  695  LSMNSL  712
            L  N+L
Sbjct  268  LYKNNL  273


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 72/141 (51%), Gaps = 7/141 (5%)
 Frame = +2

Query  302  NSNGSVTRISLSEMIMG---GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLE  472
            N  G + R++     M    G  P+S  +  L NL ++  + NSL+G IP N+     L 
Sbjct  184  NDFGELQRLTYLSFFMNNLTGKIPSSLFM--LKNLSTVYLAMNSLFGEIP-NVVEALNLT  240

Query  473  TLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGS  649
             +DLS+N+L GKI  +F  ++ L  LNL  N L GEIP  +    SL+   V  N  +G+
Sbjct  241  KIDLSMNNLVGKIPNDFGKLQQLTVLNLYKNNLSGEIPQSIGNLKSLKGFHVFKNKFSGT  300

Query  650  IPDDIGNFYNLSYLDLSMNSL  712
            +P D G    L Y  + +N+ 
Sbjct  301  LPSDFGLHSKLEYFRIEINNF  321


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 57/108 (53%), Gaps = 2/108 (2%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NLV    S N L G+IP  L++   LE L L  N L G +  +  S K+L +LNL  N L
Sbjct  427  NLVKFIASKNYLNGSIPQELTTLPNLERLLLDQNQLKGSLPFDVISWKSLVTLNLSQNQL  486

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              +IP  +    SL  LD+S N  +G IP  +    NL+ L+LS N L
Sbjct  487  NVQIPVSIGHLPSLSVLDLSENQFSGEIPLILTRLRNLN-LNLSTNHL  533



>ref|XP_003533283.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1008

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 101/185 (55%), Gaps = 9/185 (5%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEM  343
            SQSL    + E A+LL +KQ+   P      WNSTSS C W  I+C +N SVT ++LS+ 
Sbjct  29   SQSLY---DQEHAVLLNIKQYLQDP-PFLSHWNSTSSHCSWSEITCTTN-SVTSLTLSQS  83

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             +  + P    IC L NL  ++FS N + G  P +L +CSKLE LDLS N+  GK+  + 
Sbjct  84   NINRTIPT--FICGLTNLTHLDFSFNFIPGEFPTSLYNCSKLEYLDLSRNNFDGKVPHDI  141

Query  524  FSM-KTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
              +   L+ LNL      G++P+ +     L  L +    LNG++  +I    NL YLDL
Sbjct  142  DKLGANLQYLNLGSTNFHGDVPSSIAKLKQLRQLKLQYCLLNGTVAAEIDGLSNLEYLDL  201

Query  698  SMNSL  712
            S N L
Sbjct  202  SSNFL  206


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            + + N L        +L G IP N+     LE LD+S N L G I    F +K L SL L
Sbjct  216  LTKFNKLKVFYLYGTNLVGEIPKNIGDMVTLEMLDMSNNSLAGGIPNGLFLLKNLTSLLL  275

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N L GEIP+ + A +L  LD++ N+L G IPD  G    LS+L LS+N L
Sbjct  276  YANSLSGEIPSVVEALNLVYLDLARNNLTGKIPDAFGKLQQLSWLSLSLNGL  327


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 6/133 (5%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R  +S     G  P+   +    NLV  + S N+  G+IP  L++  KL TL L  N 
Sbjct  459  ISRFEISYNQFSGGIPSG--VSSWTNLVVFDASKNNFNGSIPWKLTALPKLTTLLLDQNQ  516

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
            L+G +  +  S K+L +LNL  N L G+IP  +    +L  LD+S N+ +G +P      
Sbjct  517  LSGALPSDIISWKSLVTLNLSQNQLSGQIPNAIGQLPALSQLDLSENEFSGLVPSLPPRL  576

Query  674  YNLSYLDLSMNSL  712
             N   L+LS N L
Sbjct  577  TN---LNLSFNHL  586



>ref|XP_010110151.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC25389.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=938

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 92/176 (52%), Gaps = 24/176 (14%)
 Frame = +2

Query  257  WNSTSSPCDWPGISCNSNGS-VTRISLSEMIMGGSFP-------------------ASAI  376
            W  T SPC+W G+ C+ +G  V  + LS + + G+                     A AI
Sbjct  16   WAKTESPCNWTGVLCDKHGQRVVGLDLSGLGLSGTISPHIGNLSSLHSLNLQNNHFAGAI  75

Query  377  ---ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
               I +L  L  +N SSN + G +P N+S C +LETLDL  N +TGKI  EF  +  L  
Sbjct  76   PHEITKLFKLRVVNMSSNQIEGVLPPNISHCKELETLDLMKNRITGKIPEEFSKLTRLEV  135

Query  548  LNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N  +GEIP+ +    SL +L   +N L+G IPD++G    L  LD+++N++
Sbjct  136  LKLGKNRFYGEIPSSLANVSSLTTLYFGTNTLSGVIPDELGRLRKLEELDITINNI  191


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSI-NFSSNSLWGTIPANLSSCSKLETLDLSI  490
            S+  + LS   + GS P   +   L +L ++ N S+N L G +P  + S   + T+D+S 
Sbjct  428  SLLSMDLSNNKLNGSIPKECL--NLPSLSTVLNLSNNFLSGPLPEEIGSIENVATIDISN  485

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIG  667
            N L+G+I       ++L  L L  N  FG IP  +     LE LD+SSN L+GSIP+D+ 
Sbjct  486  NLLSGQIPNSIKDCRSLEKLLLGNNRFFGPIPKGLAEIKGLERLDLSSNQLSGSIPEDLQ  545

Query  668  NFYNLSYLDLSMNSL  712
                L YL+LS N+L
Sbjct  546  ELKGLEYLNLSFNNL  560


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 72/124 (58%), Gaps = 4/124 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P    I +L  L  +   +N L G +P +L + SKL ++DLS N L G +   F 
Sbjct  367  ISGEIPTQ--IGELKELQMLGLPNNKLSGAVPKSLGNLSKLNSIDLSGNSLLGHVPSSFG  424

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLES-LDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            + ++L S++L  N L G IP   +   SL + L++S+N L+G +P++IG+  N++ +D+S
Sbjct  425  NFQSLLSMDLSNNKLNGSIPKECLNLPSLSTVLNLSNNFLSGPLPEEIGSIENVATIDIS  484

Query  701  MNSL  712
             N L
Sbjct  485  NNLL  488


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P+S  +  +++L ++ F +N+L G IP  L    KLE LD++IN++TG I    +++
Sbjct  145  GEIPSS--LANVSSLTTLYFGTNTLSGVIPDELGRLRKLEELDITINNITGTIPTSIYNI  202

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSS---NDLNGSIPDDIGNFYNLSYLDLSM  703
             +L +L +  N L GEIP   V   L +L V +   N   G IP  + N   +  + ++ 
Sbjct  203  TSLVNLAVASNDLRGEIPYD-VGDKLPNLLVFNFCFNKFTGRIPGSLHNLTRIRVIRVAH  261

Query  704  NSL  712
            N L
Sbjct  262  NLL  264


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 52/107 (49%), Gaps = 2/107 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            V  I +S  ++ G  P S   C+  +L  +   +N  +G IP  L+    LE LDLS N 
Sbjct  478  VATIDISNNLLSGQIPNSIKDCR--SLEKLLLGNNRFFGPIPKGLAEIKGLERLDLSSNQ  535

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSND  637
            L+G I  +   +K L  LNL  N L G +P   V  +L S+ +  N 
Sbjct  536  LSGSIPEDLQELKGLEYLNLSFNNLEGVVPRDGVFRNLSSVHLEGNK  582



>ref|XP_006853707.1| PREDICTED: receptor-like protein kinase HSL1 [Amborella trichopoda]
 gb|ERN15174.1| hypothetical protein AMTR_s00056p00148740 [Amborella trichopoda]
Length=1015

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 90/161 (56%), Gaps = 6/161 (4%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
             E  +LL +KQ WG P  L   WNSTS   C+W GI+C+SN S+T ISLS + +    P 
Sbjct  37   QEDQVLLKIKQQWGNPPPLL-SWNSTSGHHCNWFGITCDSN-SITGISLSNLNITEKIPD  94

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S  IC L NL  ++ S N +    P  L +C +LE LDLS N   G I  E F +  L+ 
Sbjct  95   S--ICDLKNLTHLDVSYNCITSEFPEVLFNCFRLEFLDLSQNYFVGPIPSEIFRISKLKQ  152

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIG  667
            LNL  N   G+IP  +   S LE+L + +N  NGSI  +IG
Sbjct  153  LNLSANNFSGDIPDGISRISGLENLYLHANQFNGSISPEIG  193


 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +2

Query  359  FPASAIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
            FP + I+ ++  L  + +     N+L G +P    + ++L  LDL  N L+GKI     S
Sbjct  208  FPPAKILPEIGRLKKLTYLWMKENNLVGEMPDFYGNLTELRQLDLCNNRLSGKIPRSLMS  267

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            +K L  L L  N L G IP P+ A  L ++D+S N L+G+IP+DIGN  NL+   L  N 
Sbjct  268  LKKLEFLYLSYNNLTGIIPRPIQALGLINMDLSINQLSGTIPEDIGNLKNLTNFALYRNK  327

Query  710  L  712
            L
Sbjct  328  L  328


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 1/125 (1%)
 Frame = +2

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
            M+   SF           L  +   +N   G IP+ +SS   L     S N  +G++  E
Sbjct  442  MLGNNSFSGQIPAILAKRLTRLEVQNNRFTGKIPSGISSSVNLTVFKGSNNQFSGQLPAE  501

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
              +++ L +L L  N L GE+P  + ++ SL  LD+S N+L G+IP  +G+  +L+ LDL
Sbjct  502  ITALRKLETLLLDRNKLSGELPAKIESWESLARLDMSYNELEGTIPKSLGSLPSLNSLDL  561

Query  698  SMNSL  712
            + N  
Sbjct  562  TNNKF  566


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 68/135 (50%), Gaps = 5/135 (4%)
 Frame = +2

Query  290  GISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKL  469
            GIS + N +V + S ++    G  PA   I  L  L ++    N L G +PA + S   L
Sbjct  477  GISSSVNLTVFKGSNNQF--SGQLPAE--ITALRKLETLLLDRNKLSGELPAKIESWESL  532

Query  470  ETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGS  649
              LD+S N+L G I     S+ +L SL+L  N   GEI   +    L  L++S N+L G 
Sbjct  533  ARLDMSYNELEGTIPKSLGSLPSLNSLDLTNNKFSGEISPEIGELRLSFLNLSGNNLAGK  592

Query  650  IPDDIGN-FYNLSYL  691
            IP    +  ++LS+L
Sbjct  593  IPHSFDSPAFDLSFL  607


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 62/123 (50%), Gaps = 4/123 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P S  +  L  L  +  S N+L G IP  + +   L  +DLSIN L+G I  +  
Sbjct  257  LSGKIPRS--LMSLKKLEFLYLSYNNLTGIIPRPIQALG-LINMDLSINQLSGTIPEDIG  313

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            ++K L +  L  N L GEIP  +    SL  + +  N L G +P D+G    L  L++S 
Sbjct  314  NLKNLTNFALYRNKLTGEIPLGLAQIPSLYDVKLFKNKLTGVLPPDLGKDSPLYNLEVSE  373

Query  704  NSL  712
            NSL
Sbjct  374  NSL  376



>ref|XP_007203859.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
 gb|EMJ05058.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
Length=1016

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 101/186 (54%), Gaps = 12/186 (6%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW---NSTSSPCDW-PGISCNSNGSVTRIS  331
            SQSL    + E+A+LL LK +   P      W    S +S C W P I+C +N SVT +S
Sbjct  30   SQSLQ---DQEQAVLLKLKSYLQSP-PFLSHWIPSTSNTSHCSWGPEINC-TNNSVTGLS  84

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L +  +  S P    IC L NL  I+ S N   G  P  L +CSKLE LDLS N   GKI
Sbjct  85   LVDTNITLSVPP--FICDLKNLTLIDLSYNYFPGEFPKALYNCSKLEYLDLSQNYFVGKI  142

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
              +  S+  LR L+L GN   G+IP  +   + L +L +  N+ NGS+P +IGN  NL  
Sbjct  143  PDDIDSLPRLRYLSLAGNNFSGDIPAAIGRLHELRNLQLFMNEFNGSVPPEIGNLSNLKD  202

Query  689  LDLSMN  706
            L+LS N
Sbjct  203  LNLSSN  208


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL NL ++    ++L G +P  L   + LE LDL+ N L G I    F +K L  + L  
Sbjct  222  QLKNLKTLWIRESNLIGQLPGTLGEMAALEELDLAKNRLNGTIPSGLFLLKNLSIIYLFK  281

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            N L G+IP  + A +L+ +D+S N L G IP+D G    L+ L L  N
Sbjct  282  NRLSGDIPQVVEALNLKVIDLSDNRLTGPIPEDYGKLTKLTGLALFYN  329


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 67/133 (50%), Gaps = 7/133 (5%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ + +    G  P    +    NL   +  +N   GTIP  L++   L TL L  N 
Sbjct  463  LSRLEIRDNRFSGKIPTG--VSSWTNLKVFDAGNNLFNGTIPQELTALPSLTTLSLDQNQ  520

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIG--  667
            LTG +  E  S K+L +LN   N L G IP  + +   L  LD+S N L+G IPD +G  
Sbjct  521  LTGFLPSEIISWKSLNTLNFSRNQLSGPIPEKLGLLPVLTELDLSENQLSGQIPDLLGRL  580

Query  668  --NFYNLSYLDLS  700
              N +NLS  DLS
Sbjct  581  KLNHFNLSSNDLS  593


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +    N   G IP  +SS + L+  D   N   G I  E  ++ +L +L+L  N L
Sbjct  462  NLSRLEIRDNRFSGKIPTGVSSWTNLKVFDAGNNLFNGTIPQELTALPSLTTLSLDQNQL  521

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G +P+ ++++ SL +L+ S N L+G IP+ +G    L+ LDLS N L
Sbjct  522  TGFLPSEIISWKSLNTLNFSRNQLSGPIPEKLGLLPVLTELDLSENQL  569


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            +  G+ P    +  L +L +++   N L G +P+ + S   L TL+ S N L+G I  + 
Sbjct  496  LFNGTIPQE--LTALPSLTTLSLDQNQLTGFLPSEIISWKSLNTLNFSRNQLSGPIPEKL  553

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
              +  L  L+L  N L G+IP  +    L   ++SSNDL+G IP +  N  Y+ S+LD
Sbjct  554  GLLPVLTELDLSENQLSGQIPDLLGRLKLNHFNLSSNDLSGKIPFEFENPAYDRSFLD  611


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 4/135 (3%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
             ++  + L++  + G+ P+   +  L NL  I    N L G IP  + + + L+ +DLS 
Sbjct  248  AALEELDLAKNRLNGTIPSGLFL--LKNLSIIYLFKNRLSGDIPQVVEALN-LKVIDLSD  304

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG  667
            N LTG I  ++  +  L  L L  N  F EIP  +    +L    V  N+L G++P D G
Sbjct  305  NRLTGPIPEDYGKLTKLTGLALFYNGFFSEIPASIGRLPNLIDFKVYDNNLTGTLPPDFG  364

Query  668  NFYNLSYLDLSMNSL  712
             +  L   ++S N L
Sbjct  365  RYSELGGFEVSGNRL  379


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 69/138 (50%), Gaps = 6/138 (4%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSF---PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G +T+++   +   G F   PAS  I +L NL+      N+L GT+P +    S+L   +
Sbjct  316  GKLTKLTGLALFYNGFFSEIPAS--IGRLPNLIDFKVYDNNLTGTLPPDFGRYSELGGFE  373

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPD  658
            +S N LTGK+      +  L  L    N L GE+P+ +    SL  + V  N L+G+IP 
Sbjct  374  VSGNRLTGKLPDHLCYLGKLVGLVAHENNLTGELPSSLGNCTSLVIVKVYDNGLSGNIPS  433

Query  659  DIGNFYNLSYLDLSMNSL  712
             +    NLS + ++ NS 
Sbjct  434  GMWTATNLSQVLMNKNSF  451



>ref|XP_011078427.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Sesamum indicum]
Length=1021

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 99/184 (54%), Gaps = 5/184 (3%)
 Frame = +2

Query  170  SLTTYGEDERAILLILKQHWGYPFSLFEQ-WNSTSSPCDWPGISCNS-NGSVTRISLSEM  343
            +LT    DE A+L +  +    P  +  + W+ ++S C W G++C S +  VT + +S M
Sbjct  2    ALTNITTDESALLALKSRLAIDPSHILSRNWSDSTSVCSWIGVTCGSRHQRVTALDISTM  61

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             + G+ P    +  L+ ++S+N SSNS  G++P  L+   +LE +D   ND  G +   F
Sbjct  62   GLAGNLPPD--MGNLSCVMSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWF  119

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
              +  L+ LNLR N   G  PT +   S LE LD+S N L G IPD+IGN +NL  L L 
Sbjct  120  GFLGELQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYNSLQGKIPDEIGNLHNLKRLSLQ  179

Query  701  MNSL  712
             N  
Sbjct  180  FNKF  183


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = +2

Query  281  DWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSC  460
            D  G  C S   +  + LS   + G  P++  I Q + L  ++ S N   G++P+ + + 
Sbjct  210  DLQGDLCRSLPRLNELYLSSNELDGQIPSN--ISQCSQLRLLSLSHNKFSGSVPSGIGNL  267

Query  461  SKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSND  637
            + LE L L  NDLTG+I  E   ++ L+ L +  N L G IP+ +    SL+ +++++ +
Sbjct  268  TALEILYLGSNDLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISSLQYINIANCN  327

Query  638  LNGSIPDDI  664
            L G++P D+
Sbjct  328  LTGALPADM  336


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 61/111 (55%), Gaps = 1/111 (1%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +LN+L+ +N +SN L G++  ++ +      LDLS+N  +G I      M  L +L+L  
Sbjct  682  RLNDLLQLNLTSNVLVGSLSPDIGNLKTATVLDLSMNQFSGTIPPSVGDMFDLINLSLAH  741

Query  563  NMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N   G IP  +    +L  LD+S N+L+G+IP  +     L+Y ++S N L
Sbjct  742  NKFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSLERILYLTYFNVSFNDL  792


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 62/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I  L  L S+   +N+L   IP +L   + L  L+L+ N L G ++ +  ++KT   L+L
Sbjct  656  IGNLTALRSLYIGNNNLSSGIPPSLWRLNDLLQLNLTSNVLVGSLSPDIGNLKTATVLDL  715

Query  557  RGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N   G IP P V   + L +L ++ N   GSIP+ IG   NL+ LDLS N+L
Sbjct  716  SMNQFSGTIP-PSVGDMFDLINLSLAHNKFEGSIPESIGQLVNLAELDLSHNNL  768


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (51%), Gaps = 2/134 (1%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  I+++   + G+ PA  +    + L  + F  N L G +P  +  CS L+   LS N
Sbjct  317  SLQYINIANCNLTGALPAD-MCSGSSRLQEVFFHVNELVGELPERIGECSALQMWSLSYN  375

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
            ++TG I     ++  L++  +  N L G IP  +    SLE L +  N+L G+IP +I N
Sbjct  376  NITGVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIFN  435

Query  671  FYNLSYLDLSMNSL  712
               L  + +SMN L
Sbjct  436  ISTLQSISVSMNQL  449


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANL-SSCSKLETLDLSIN  493
            + R+SL      G  P +  I  +++L S+  + NSL G +  +L  S  +L  L LS N
Sbjct  173  LKRLSLQFNKFDGLIPTT--IFNISSLESLALTGNSLSGDLQGDLCRSLPRLNELYLSSN  230

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +L G+I         LR L+L  N   G +P+ +    +LE L + SNDL G IP+++G+
Sbjct  231  ELDGQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDLTGQIPEELGD  290

Query  671  FYNLSYLDLSMNSL  712
              NL  L +  N L
Sbjct  291  LRNLKELGMGDNFL  304



>ref|XP_010499374.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Camelina 
sativa]
 ref|XP_010499375.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Camelina 
sativa]
Length=996

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 100/174 (57%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSN-GSVTRISLSEMIMGGSFPA  367
            E  IL  +K     P S    WNST  SPC W G+SC  +  SVT + LS   + G FP+
Sbjct  20   EAFILQQVKHSLDDPDSSLSSWNSTDDSPCRWFGVSCGGDFTSVTSVDLSGANLAGPFPS  79

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              +IC+L+ L  ++  +NS+  T+P ++++C++L+ LDLS N LTG+I      + TL  
Sbjct  80   --VICRLSKLAELSLYNNSINSTLPLDVAACNRLQLLDLSQNLLTGEIPHTLADIPTLVH  137

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN   G+IP     +  LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  138  LDLTGNNFSGDIPANFGKFQNLEVLSLVYNLLDGTIPPFLGNISSLKMLNLSYN  191


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L+ LV ++ + N L G IP +L   S +  ++L  N LTG+I
Sbjct  213  LTECHLIGQIPDS--LGRLSRLVDLDLALNDLVGPIPRSLGGLSSVVQIELYNNSLTGEI  270

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G+IP  +    LESL++  N+L G +P  I    NL  L
Sbjct  271  PPELGNLKSLRLLDASMNQLTGKIPEELCRVPLESLNLYENNLEGEVPGSIALSPNLYEL  330

Query  692  DLSMNSL  712
             +  N L
Sbjct  331  RIFGNRL  337


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 58/113 (51%), Gaps = 2/113 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S     GS P S  + QL  L  ++   N   G +   + S  KL  L+L+ N+
Sbjct  471  LNQLSASGNKFSGSLPVS--LMQLGELGILDLHGNQFSGELTPGIKSWKKLNELNLADNE  528

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
             TG+I  E  S+  L  L+L GN   G+IP  + +  L  L++S N L+G +P
Sbjct  529  FTGRIPDEIGSLSVLNYLDLSGNQFSGKIPVSLQSLKLNQLNLSYNRLSGDLP  581


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 78/164 (48%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I   SN S+  + LS     GS P    I  LNNL  
Sbjct  418  WGLPHVYLLELINNSFSGEIAKSIGGASNLSL--LILSNNQFTGSLPEE--IGVLNNLNQ  473

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N   G++P +L    +L  LDL  N  +G++     S K L  LNL  N   G I
Sbjct  474  LSASGNKFSGSLPVSLMQLGELGILDLHGNQFSGELTPGIKSWKKLNELNLADNEFTGRI  533

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  + +   L+ L+LS N L
Sbjct  534  PDEIGSLSVLNYLDLSGNQFSGKIPVSLQSL-KLNQLNLSYNRL  576



>ref|XP_011464597.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X1 [Fragaria vesca subsp. vesca]
Length=945

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 96/176 (55%), Gaps = 2/176 (1%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            E E   LL  K  +    +  + W + +SPC+W GI CN+ GSVT ISL+   + G+   
Sbjct  26   ETEAEALLKWKASFLSQTNQLKDWRANTSPCNWTGILCNAAGSVTNISLANTTIQGTLHE  85

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
             + I   +NL  +N + N L+G IP  +SS SKL  LDLS N  TG+I  E   +  LR 
Sbjct  86   LSFI-SFSNLTYLNLTLNKLFGAIPPQISSLSKLIYLDLSENQFTGRIPPEIGLLTNLRV  144

Query  548  LNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N L G IP  +    SL  L+   N+L GSIP  +G+  NL++L L  N+L
Sbjct  145  LYLYLNRLSGIIPREIGNLKSLLRLESGENNLIGSIPTTLGDLKNLTFLLLFRNNL  200


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NLV++  + N+L G+IP+ + + ++L  LD S N L G I  E   + +L  L L  N L
Sbjct  357  NLVTLRMAGNNLTGSIPSEIGNATQLHELDFSSNGLVGTIPKELGRLTSLLKLKLDDNQL  416

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G +P  + + + LE+LD+S N  N SIP  +G+F  L+YL+LS N  
Sbjct  417  SGRVPIELGSLTDLENLDLSKNKFNDSIPSFVGDFLKLNYLNLSNNEF  464


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 63/117 (54%), Gaps = 9/117 (8%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            ICQ   L + + ++N L GTIP +L +C+ L  L L+ N  TG I+  F     L+ +++
Sbjct  280  ICQGGLLTNFSVNTNYLIGTIPKSLKTCTSLFRLHLNGNRFTGNISDLFGVYPDLKFIDV  339

Query  557  RGNMLFGEI-----PTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N   GE+      +P    +L +L ++ N+L GSIP +IGN   L  LD S N L
Sbjct  340  SHNAFSGEVSKNWGQSP----NLVTLRMAGNNLTGSIPSEIGNATQLHELDFSSNGL  392


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 57/113 (50%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I  L +L+ +    N+L G+IP  L     L  L L  N+L+G I  E  ++K+L  + L
Sbjct  160  IGNLKSLLRLESGENNLIGSIPTTLGDLKNLTFLLLFRNNLSGTIPKEIGNLKSLVKVEL  219

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N L G IPT     S LE L +  N L+GSIP +IGN   L  L L  N  
Sbjct  220  GENQLNGSIPTSFGNLSNLEYLILRDNQLSGSIPQEIGNLMKLVKLGLDTNQF  272


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 65/145 (45%), Gaps = 27/145 (19%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI---AGEF  523
            G+ P    + +L +L+ +    N L G +P  L S + LE LDLS N     I    G+F
Sbjct  394  GTIPKE--LGRLTSLLKLKLDDNQLSGRVPIELGSLTDLENLDLSKNKFNDSIPSFVGDF  451

Query  524  FSMK---------------------TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSND  637
              +                       L  L+L  N L   IP+ +    SLE+L++S N+
Sbjct  452  LKLNYLNLSNNEFSQAIPFQLGKLTQLSQLDLSHNTLEDMIPSELSGMESLENLNISHNN  511

Query  638  LNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+G IP    +   L+Y+D+S N L
Sbjct  512  LSGIIPISFKDMLGLTYVDVSYNDL  536


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = +2

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            +N S+N     IP  L   ++L  LDLS N L   I  E   M++L +LN+  N L G I
Sbjct  457  LNLSNNEFSQAIPFQLGKLTQLSQLDLSHNTLEDMIPSELSGMESLENLNISHNNLSGII  516

Query  584  PTPMV-AYSLESLDVSSNDLNGSIPDD  661
            P        L  +DVS NDL G++P++
Sbjct  517  PISFKDMLGLTYVDVSYNDLEGALPNN  543



>gb|EAY81075.1| hypothetical protein OsI_36255 [Oryza sativa Indica Group]
Length=250

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 95/175 (54%), Gaps = 4/175 (2%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            E  IL   +  W  PF++ + W+ T  +PC W  ++CN+N SV R+ L   + G S P  
Sbjct  28   EGDILYAQRLAWKDPFNVLQSWDPTLVNPCTWFHVTCNNNNSVVRVDLG--LAGLSGPLI  85

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
              +  L+ L  +    N L G+IPA L + S L +LDL  N LTG I     ++ TLR+L
Sbjct  86   PQLGGLSYLQYLELYGNELNGSIPAALGNLSSLVSLDLQGNLLTGAIPDSLGAISTLRNL  145

Query  551  NLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GN L G IP  + +  SL  L++  N L+G+IP  +GN   L  L L+ NSL
Sbjct  146  RLYGNNLAGTIPQSLGSLTSLVKLELQKNSLSGTIPASLGNIKTLELLRLNKNSL  200



>ref|XP_002461464.1| hypothetical protein SORBIDRAFT_02g003080 [Sorghum bicolor]
 gb|EER97985.1| hypothetical protein SORBIDRAFT_02g003080 [Sorghum bicolor]
Length=1231

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 83/149 (56%), Gaps = 3/149 (2%)
 Frame = +2

Query  269  SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPAN  448
            + PC W GI+C++ G VT ++L  + + G    SA +C L  L  +N S N+L G IP  
Sbjct  184  AGPCGWAGIACSTAGEVTGVTLHGLNLQGGL--SAAVCALPRLAVLNVSKNALKGPIPQG  241

Query  449  LSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDV  625
            L++C+ LE LDLS N L G +  +  ++  LR L L  N+L G+IP  +    +LE L++
Sbjct  242  LAACAALEVLDLSTNALHGAVPPDLCALPALRRLFLSENLLVGDIPLAIGNLTALEELEI  301

Query  626  SSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             SN+L G IP  +     L  +   +N L
Sbjct  302  YSNNLTGRIPASVSALQRLRVIRAGLNQL  330


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 77/159 (48%), Gaps = 28/159 (18%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ LS     G  PA+  I  L  LV+ N SSN L G IP+ L+ C KL+ LDLS N
Sbjct  631  SIERLILSNNFFVGQMPAA--IGNLTELVAFNISSNQLTGPIPSELARCKKLQRLDLSRN  688

Query  494  DLTGKIAGE------------------------FFSMKTLRSLNLRGNMLFGEIPTPMVA  601
             LTG I  E                        F  +  L  L + GN L G++P  +  
Sbjct  689  SLTGVIPTEIGGLGNLEQLKLSDNSLNGTIPSSFGGLSRLIELEMGGNRLSGQVPVELGE  748

Query  602  Y-SLE-SLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              SL+ +L+VS N L+G IP  +GN + L YL L  N L
Sbjct  749  LSSLQIALNVSHNMLSGEIPTQLGNLHMLQYLYLDNNEL  787


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            SV  I LSE  + G  PA   + +++ L  +    N L GTIP  L   S +  +DLSIN
Sbjct  439  SVLEIDLSENKLTGVIPAE--LGRISTLRLLYLFENRLQGTIPPELGQLSSIRKIDLSIN  496

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
            +LTG I   F ++  L  L L  N L G IP  + A S L  LD+S N L GSIP  +  
Sbjct  497  NLTGTIPMVFQNLSGLEYLELFDNQLQGAIPPLLGANSNLSVLDLSDNQLTGSIPPHLCK  556

Query  671  FYNLSYLDLSMNSL  712
            +  L +L L  N L
Sbjct  557  YQKLMFLSLGSNHL  570


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 58/106 (55%), Gaps = 1/106 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  ++ S N L G+IP +L    KL  L L  N L G I     + KTL  L L GNML
Sbjct  535  NLSVLDLSDNQLTGSIPPHLCKYQKLMFLSLGSNHLIGNIPQGVKTCKTLTQLRLGGNML  594

Query  572  FGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             G +P  + +  +L SL+++ N  +G IP +IG F ++  L LS N
Sbjct  595  TGSLPVELSLLQNLTSLEMNQNRFSGPIPPEIGKFRSIERLILSNN  640


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            +  L +L+ +    N L GTIP  L +   +  +DLS N LTG I  E   + TLR L L
Sbjct  410  LAALPSLLKLYIYRNQLDGTIPPELGNLQSVLEIDLSENKLTGVIPAELGRISTLRLLYL  469

Query  557  RGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N L G IP  +    S+  +D+S N+L G+IP    N   L YL+L  N L
Sbjct  470  FENRLQGTIPPELGQLSSIRKIDLSINNLTGTIPMVFQNLSGLEYLELFDNQL  522


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P    I +  ++  +  S+N   G +PA + + ++L   ++S N LTG I  E    K
Sbjct  619  SGPIPPEIGKFRSIERLILSNNFFVGQMPAAIGNLTELVAFNISSNQLTGPIPSELARCK  678

Query  536  TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+ L+L  N L G IPT +    +LE L +S N LNG+IP   G    L  L++  N L
Sbjct  679  KLQRLDLSRNSLTGVIPTEIGGLGNLEQLKLSDNSLNGTIPSSFGGLSRLIELEMGGNRL  738



>ref|XP_010041484.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1269

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 101/180 (56%), Gaps = 3/180 (2%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T  GE+ RA+L        Y  +L   W     PC W GI C+ +GSV+ ++L++  + G
Sbjct  157  TAKGEEARALLEWKSGLDNYSQALLSSWQG-DDPCIWRGIGCDGSGSVSGLNLTDTGLQG  215

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S  +      L+NLVS++ S+NSL+G IP+++ + SKL TL +  N L+G I  E   + 
Sbjct  216  SL-SKLTFTALSNLVSLDLSANSLYGHIPSSIGNLSKLSTLSIFNNSLSGTIPLEIGKLS  274

Query  536  TLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L  L L GN L G IP  + + +SL +L +  N L G IP  +GN  NL++L L  N+L
Sbjct  275  RLSILYLDGNRLHGTIPEEIGMLHSLLNLTLYDNHLAGQIPTSMGNLSNLTFLALGQNNL  334


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 75/140 (54%), Gaps = 7/140 (5%)
 Frame = +2

Query  299  CNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETL  478
            C+ N +  RIS    I GG  P   +I  +  L  ++ SSN + G +P  L   + L  L
Sbjct  584  CSHNLTSLRIS-GNKISGGLHP---MIGNMAQLRVLDLSSNYITGRLPRELRRLTSLLEL  639

Query  479  DLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSI  652
            DL  N ++G I  E   + TL  LNL  N   G IP P +A   SL +L++S+N++  SI
Sbjct  640  DLHDNKISGNIPPEIGHLSTLEKLNLGSNKFGGSIP-PQLAQCRSLWNLNLSNNEIRASI  698

Query  653  PDDIGNFYNLSYLDLSMNSL  712
            P +IGN   L YLDLS N L
Sbjct  699  PSEIGNLQFLRYLDLSHNFL  718


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 3/131 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + RIS+ E  + G  P +  IC    L +    +N   G +P++L +CS L  + L  N 
Sbjct  492  LRRISMGENKLAGRLPDN--ICLGGLLENFTAPNNHFNGHLPSSLKNCSSLSRIRLEGNR  549

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG +     +   L+ ++L  N   GE+ T    +++L SL +S N ++G +   IGN 
Sbjct  550  LTGNLTEALGAYPNLKYIDLSYNQFHGELSTKWGCSHNLTSLRISGNKISGGLHPMIGNM  609

Query  674  YNLSYLDLSMN  706
              L  LDLS N
Sbjct  610  AQLRVLDLSSN  620


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 62/118 (53%), Gaps = 1/118 (1%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P    I +L +L  +  SSN+  G IP ++ + + L  LDL+ N L+  I  EF +++ L
Sbjct  385  PVPQEIGRLKSLAKLTLSSNTFSGPIPVSIGNLTALTLLDLTSNSLSSSIPEEFGTLRHL  444

Query  542  RSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L L  N L G IP  +    SL  L +  N L+G IPD++ N  NL  + +  N L
Sbjct  445  KELRLSENCLDGLIPRSIGKLVSLSVLSLHYNHLSGFIPDEMNNLRNLRRISMGENKL  502


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 4/132 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++ +++L     GGS P    + Q  +L ++N S+N +  +IP+ + +   L  LDLS N
Sbjct  659  TLEKLNLGSNKFGGSIPPQ--LAQCRSLWNLNLSNNEIRASIPSEIGNLQFLRYLDLSHN  716

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
             L GKI      +  L  LNL  N L G IP        L S+++S N L G IP +I  
Sbjct  717  FLAGKIPRGIGKLTILEKLNLSQNRLSGFIPKSFDNMLGLLSVNISHNYLEGPIP-NIKA  775

Query  671  FYNLSYLDLSMN  706
            F +  Y  ++ N
Sbjct  776  FRDAPYSAVASN  787



>ref|XP_011464598.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X2 [Fragaria vesca subsp. vesca]
Length=927

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 96/176 (55%), Gaps = 2/176 (1%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            E E   LL  K  +    +  + W + +SPC+W GI CN+ GSVT ISL+   + G+   
Sbjct  8    ETEAEALLKWKASFLSQTNQLKDWRANTSPCNWTGILCNAAGSVTNISLANTTIQGTLHE  67

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
             + I   +NL  +N + N L+G IP  +SS SKL  LDLS N  TG+I  E   +  LR 
Sbjct  68   LSFI-SFSNLTYLNLTLNKLFGAIPPQISSLSKLIYLDLSENQFTGRIPPEIGLLTNLRV  126

Query  548  LNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N L G IP  +    SL  L+   N+L GSIP  +G+  NL++L L  N+L
Sbjct  127  LYLYLNRLSGIIPREIGNLKSLLRLESGENNLIGSIPTTLGDLKNLTFLLLFRNNL  182


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NLV++  + N+L G+IP+ + + ++L  LD S N L G I  E   + +L  L L  N L
Sbjct  339  NLVTLRMAGNNLTGSIPSEIGNATQLHELDFSSNGLVGTIPKELGRLTSLLKLKLDDNQL  398

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G +P  + + + LE+LD+S N  N SIP  +G+F  L+YL+LS N  
Sbjct  399  SGRVPIELGSLTDLENLDLSKNKFNDSIPSFVGDFLKLNYLNLSNNEF  446


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            ICQ   L + + ++N L GTIP +L +C+ L  L L+ N  TG I+  F     L+ +++
Sbjct  262  ICQGGLLTNFSVNTNYLIGTIPKSLKTCTSLFRLHLNGNRFTGNISDLFGVYPDLKFIDV  321

Query  557  RGNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N   GE+      + +L +L ++ N+L GSIP +IGN   L  LD S N L
Sbjct  322  SHNAFSGEVSKNWGQSPNLVTLRMAGNNLTGSIPSEIGNATQLHELDFSSNGL  374


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 57/113 (50%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I  L +L+ +    N+L G+IP  L     L  L L  N+L+G I  E  ++K+L  + L
Sbjct  142  IGNLKSLLRLESGENNLIGSIPTTLGDLKNLTFLLLFRNNLSGTIPKEIGNLKSLVKVEL  201

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N L G IPT     S LE L +  N L+GSIP +IGN   L  L L  N  
Sbjct  202  GENQLNGSIPTSFGNLSNLEYLILRDNQLSGSIPQEIGNLMKLVKLGLDTNQF  254


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 65/145 (45%), Gaps = 27/145 (19%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI---AGEF  523
            G+ P    + +L +L+ +    N L G +P  L S + LE LDLS N     I    G+F
Sbjct  376  GTIPKE--LGRLTSLLKLKLDDNQLSGRVPIELGSLTDLENLDLSKNKFNDSIPSFVGDF  433

Query  524  FSMK---------------------TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSND  637
              +                       L  L+L  N L   IP+ +    SLE+L++S N+
Sbjct  434  LKLNYLNLSNNEFSQAIPFQLGKLTQLSQLDLSHNTLEDMIPSELSGMESLENLNISHNN  493

Query  638  LNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+G IP    +   L+Y+D+S N L
Sbjct  494  LSGIIPISFKDMLGLTYVDVSYNDL  518


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = +2

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            +N S+N     IP  L   ++L  LDLS N L   I  E   M++L +LN+  N L G I
Sbjct  439  LNLSNNEFSQAIPFQLGKLTQLSQLDLSHNTLEDMIPSELSGMESLENLNISHNNLSGII  498

Query  584  PTPMV-AYSLESLDVSSNDLNGSIPDD  661
            P        L  +DVS NDL G++P++
Sbjct  499  PISFKDMLGLTYVDVSYNDLEGALPNN  525



>ref|XP_004234101.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Solanum 
lycopersicum]
Length=995

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 97/176 (55%), Gaps = 6/176 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWN--STSSPCDWPGISCNS-NGSVTRISLSEMIMGGSFP  364
            E   L  +K  +  P  +F  WN    SSPC+W G+ C+S   SVT I LS   + G FP
Sbjct  21   ESLYLHTIKLGFDDPNGVFSNWNLHDNSSPCNWYGVKCDSLTRSVTSIDLSNTNIAGPFP  80

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPAN-LSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            AS ++C+L  +  I+F +NS+  T+P   LS+C  L  LDL+ N L G +      +  L
Sbjct  81   AS-LLCRLKYIKYISFYNNSINSTLPVEELSACKSLVHLDLAQNLLVGSLPSSLAELHEL  139

Query  542  RSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            + L+L GN   GEIP    A+  LE L +  N L G+IP +IGN  +L  L+LS N
Sbjct  140  KYLDLTGNNFTGEIPASFGAFRRLEVLGLVENLLTGTIPPEIGNISSLKQLNLSYN  195


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P S  I  L  L  ++F +N L G  P+ + S  KL  L+L+ NDL+G+I  E  S+
Sbjct  488  GSLPVS--IVNLEQLGRMDFHNNELSGKFPSGVHSLKKLNELNLANNDLSGEIPREIGSL  545

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
              L  L+L GN   GEIP  +    L  L++S+N L+G IP
Sbjct  546  SVLNYLDLSGNKFSGEIPVALQNLKLNQLNLSNNGLSGGIP  586


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 7/166 (4%)
 Frame = +2

Query  221  QHWGYP-FSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNL  397
            + WG P  SL E  N++ S      I+  SN S   +S +E    G+ P    I  L +L
Sbjct  421  EFWGLPRLSLLELTNNSFSGGIAKTIAGASNLSALILSKNEF--SGNIPEE--IGFLESL  476

Query  398  VSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFG  577
            V    + N   G++P ++ +  +L  +D   N+L+GK      S+K L  LNL  N L G
Sbjct  477  VDFVGNDNKFSGSLPVSIVNLEQLGRMDFHNNELSGKFPSGVHSLKKLNELNLANNDLSG  536

Query  578  EIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            EIP  + + S L  LD+S N  +G IP  + N   L+ L+LS N L
Sbjct  537  EIPREIGSLSVLNYLDLSGNKFSGEIPVALQNL-KLNQLNLSNNGL  581


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 63/110 (57%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS-MKTLRSLNLRG  562
            LN LV+++ + N+L+G IP+ L+  + +E ++L  N  +G+     +S M +LR +++  
Sbjct  233  LNKLVNLDLALNNLYGPIPSWLTELTSVEQIELYNNSFSGEFPVNGWSNMTSLRRVDVSM  292

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N + G IP  +    LESL++  N L G +P  I N  NL  L L  NSL
Sbjct  293  NRVTGSIPNGLCELPLESLNLYENQLYGELPVAIANSPNLYELKLFGNSL  342



>gb|KJB64291.1| hypothetical protein B456_010G040900 [Gossypium raimondii]
Length=763

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 94/172 (55%), Gaps = 21/172 (12%)
 Frame = +2

Query  242  SLFEQWNST------SSPCDWPGISCNSNGSVTRISLSEMIMGGS---FPASAIICQLNN  394
            S+   WN++      +SPC W GI CN   SVT+I+L+   + G+   FP       L N
Sbjct  47   SVLLSWNTSNDPYTKTSPCAWFGIHCNHADSVTKINLTGYGVKGTLHLFP----FLSLPN  102

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  ++ S+N L+G IP  +S  SKL  LDLS N  +GKI  E   +  L++L+L GN L 
Sbjct  103  LAELDLSTNELYGIIPPKISQLSKLTYLDLSFNQFSGKIPPEISHLVHLQTLHLAGNQLN  162

Query  575  GEIPTPM--------VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            G IP  +        +AY L SL + +N L+G IP ++GN  NL  +DL  N
Sbjct  163  GSIPREIGQLKFLTGLAYRLVSLLLYNNSLSGPIPPELGNLRNLVEVDLDTN  214


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-  595
            N+L G IPA + +  +++ LDLS N L G+I  E   + +L  L L GN L G +P  + 
Sbjct  442  NNLSGKIPAEIGNSRQIQRLDLSSNHLVGEIPKEIAKLTSLLDLRLNGNQLSGSVPLELG  501

Query  596  VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            +   L  LD+S+N L+ SIP+ IGN +   YL+LS+N 
Sbjct  502  LMSKLLYLDLSANQLSKSIPETIGNLFMSFYLNLSINQ  539


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 72/158 (46%), Gaps = 27/158 (17%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             + R+ LS   + G  P    I +L +L+ +  + N L G++P  L   SKL  LDLS N
Sbjct  457  QIQRLDLSSNHLVGEIPKE--IAKLTSLLDLRLNGNQLSGSVPLELGLMSKLLYLDLSAN  514

Query  494  DLTGKIA---GEFF---------------------SMKTLRSLNLRGNMLFGEIPTPMVA  601
             L+  I    G  F                      +  L  L+L  NML GEIP    +
Sbjct  515  QLSKSIPETIGNLFMSFYLNLSINQFSQRIPIQVGKLTRLVQLDLSHNMLSGEIPGEFQS  574

Query  602  -YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              SLE+L++S N+L+G IP  +     L  +D+S N L
Sbjct  575  LQSLETLNLSHNNLSGEIPASLEKLRGLYTVDISYNEL  612


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P    +  L NLV ++  +N   G IP+   +  KL  L +  N L+G I  E  +M+
Sbjct  193  SGPIPPELGNLRNLVEVDLDTNRQTGPIPSTFGNLKKLTVLHMFSNSLSGPIPSELGNME  252

Query  536  TLRSLNLRGNMLFGEIPTPMVAYSLESL-DVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L  ++L  N L G IPT        +L  +  N L+G IP +IGN  +L  L+LS N L
Sbjct  253  SLSEISLYHNNLSGLIPTSFGDLRHLTLARLYGNQLSGPIPVEIGNLNSLVDLELSENQL  312


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 6/138 (4%)
 Frame = +2

Query  311  GSVTRISLSEMI---MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G++ ++++  M    + G  P+   +  + +L  I+   N+L G IP +      L    
Sbjct  225  GNLKKLTVLHMFSNSLSGPIPSE--LGNMESLSEISLYHNNLSGLIPTSFGDLRHLTLAR  282

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPD  658
            L  N L+G I  E  ++ +L  L L  N L G IP  +   S LE L +  N L+GSIP+
Sbjct  283  LYGNQLSGPIPVEIGNLNSLVDLELSENQLNGSIPASLGNLSNLEILFLRDNLLSGSIPN  342

Query  659  DIGNFYNLSYLDLSMNSL  712
            +IGN   LS L+L  N+L
Sbjct  343  EIGNLMKLSMLELDHNNL  360


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 67/132 (51%), Gaps = 3/132 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  + LSE  + GS PAS  +  L+NL  +    N L G+IP  + +  KL  L+L  N
Sbjct  301  SLVDLELSENQLNGSIPAS--LGNLSNLEILFLRDNLLSGSIPNEIGNLMKLSMLELDHN  358

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
            +LTG +    +   +L       N L G IP  +     L+ + +  N L G++ +D+G 
Sbjct  359  NLTGNLPQGIYRGGSLEYFTANDNQLTGPIPQGLKNCTRLKRVYLERNRLKGNLSEDLGV  418

Query  671  FYNLSYLDLSMN  706
            + NL + +LS N
Sbjct  419  YPNLKFSELSDN  430


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 80/177 (45%), Gaps = 42/177 (24%)
 Frame = +2

Query  302  NSNGSVTRISLSEMI---MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLE  472
            N  G++ ++S+ E+    + G+ P    I +  +L     + N L G IP  L +C++L+
Sbjct  342  NEIGNLMKLSMLELDHNNLTGNLPQG--IYRGGSLEYFTANDNQLTGPIPQGLKNCTRLK  399

Query  473  TL-------------DLSI-----------------------NDLTGKIAGEFFSMKTLR  544
             +             DL +                       N+L+GKI  E  + + ++
Sbjct  400  RVYLERNRLKGNLSEDLGVYPNLKFSELSDNEFYGEVSSNWGNNLSGKIPAEIGNSRQIQ  459

Query  545  SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+L  N L GEIP  +    SL  L ++ N L+GS+P ++G    L YLDLS N L
Sbjct  460  RLDLSSNHLVGEIPKEIAKLTSLLDLRLNGNQLSGSVPLELGLMSKLLYLDLSANQL  516


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 55/107 (51%), Gaps = 1/107 (1%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            LVS+   +NSL G IP  L +   L  +DL  N  TG I   F ++K L  L++  N L 
Sbjct  182  LVSLLLYNNSLSGPIPPELGNLRNLVEVDLDTNRQTGPIPSTFGNLKKLTVLHMFSNSLS  241

Query  575  GEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            G IP+ +    SL  + +  N+L+G IP   G+  +L+   L  N L
Sbjct  242  GPIPSELGNMESLSEISLYHNNLSGLIPTSFGDLRHLTLARLYGNQL  288



>ref|XP_010317434.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Solanum 
lycopersicum]
Length=947

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 97/176 (55%), Gaps = 6/176 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWN--STSSPCDWPGISCNS-NGSVTRISLSEMIMGGSFP  364
            E   L  +K  +  P  +F  WN    SSPC+W G+ C+S   SVT I LS   + G FP
Sbjct  21   ESLYLHTIKLGFDDPNGVFSNWNLHDNSSPCNWYGVKCDSLTRSVTSIDLSNTNIAGPFP  80

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPAN-LSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            AS ++C+L  +  I+F +NS+  T+P   LS+C  L  LDL+ N L G +      +  L
Sbjct  81   AS-LLCRLKYIKYISFYNNSINSTLPVEELSACKSLVHLDLAQNLLVGSLPSSLAELHEL  139

Query  542  RSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            + L+L GN   GEIP    A+  LE L +  N L G+IP +IGN  +L  L+LS N
Sbjct  140  KYLDLTGNNFTGEIPASFGAFRRLEVLGLVENLLTGTIPPEIGNISSLKQLNLSYN  195


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P S  I  L  L  ++F +N L G  P+ + S  KL  L+L+ NDL+G+I  E  S+
Sbjct  440  GSLPVS--IVNLEQLGRMDFHNNELSGKFPSGVHSLKKLNELNLANNDLSGEIPREIGSL  497

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
              L  L+L GN   GEIP  +    L  L++S+N L+G IP
Sbjct  498  SVLNYLDLSGNKFSGEIPVALQNLKLNQLNLSNNGLSGGIP  538


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 7/166 (4%)
 Frame = +2

Query  221  QHWGYP-FSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNL  397
            + WG P  SL E  N++ S      I+  SN S   +S +E    G+ P    I  L +L
Sbjct  373  EFWGLPRLSLLELTNNSFSGGIAKTIAGASNLSALILSKNEF--SGNIPEE--IGFLESL  428

Query  398  VSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFG  577
            V    + N   G++P ++ +  +L  +D   N+L+GK      S+K L  LNL  N L G
Sbjct  429  VDFVGNDNKFSGSLPVSIVNLEQLGRMDFHNNELSGKFPSGVHSLKKLNELNLANNDLSG  488

Query  578  EIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            EIP  + + S L  LD+S N  +G IP  + N   L+ L+LS N L
Sbjct  489  EIPREIGSLSVLNYLDLSGNKFSGEIPVALQNL-KLNQLNLSNNGL  533



>gb|KJB64290.1| hypothetical protein B456_010G040900 [Gossypium raimondii]
Length=982

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 94/172 (55%), Gaps = 21/172 (12%)
 Frame = +2

Query  242  SLFEQWNST------SSPCDWPGISCNSNGSVTRISLSEMIMGGS---FPASAIICQLNN  394
            S+   WN++      +SPC W GI CN   SVT+I+L+   + G+   FP       L N
Sbjct  47   SVLLSWNTSNDPYTKTSPCAWFGIHCNHADSVTKINLTGYGVKGTLHLFP----FLSLPN  102

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  ++ S+N L+G IP  +S  SKL  LDLS N  +GKI  E   +  L++L+L GN L 
Sbjct  103  LAELDLSTNELYGIIPPKISQLSKLTYLDLSFNQFSGKIPPEISHLVHLQTLHLAGNQLN  162

Query  575  GEIPTPM--------VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            G IP  +        +AY L SL + +N L+G IP ++GN  NL  +DL  N
Sbjct  163  GSIPREIGQLKFLTGLAYRLVSLLLYNNSLSGPIPPELGNLRNLVEVDLDTN  214


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 59/99 (60%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-  595
            N+L G IPA + +  +++ LDLS N L G+I  E   + +L  L L GN L G +P  + 
Sbjct  442  NNLSGKIPAEIGNSRQIQRLDLSSNHLVGEIPKEIAKLTSLLDLRLNGNQLSGSVPLELG  501

Query  596  VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +   L  LD+S+N L+ SIP+ IGN +   YL+LS+N  
Sbjct  502  LMSKLLYLDLSANQLSKSIPETIGNLFMSFYLNLSINQF  540


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 72/158 (46%), Gaps = 27/158 (17%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             + R+ LS   + G  P    I +L +L+ +  + N L G++P  L   SKL  LDLS N
Sbjct  457  QIQRLDLSSNHLVGEIPKE--IAKLTSLLDLRLNGNQLSGSVPLELGLMSKLLYLDLSAN  514

Query  494  DLTGKIA---GEFF---------------------SMKTLRSLNLRGNMLFGEIPTPMVA  601
             L+  I    G  F                      +  L  L+L  NML GEIP    +
Sbjct  515  QLSKSIPETIGNLFMSFYLNLSINQFSQRIPIQVGKLTRLVQLDLSHNMLSGEIPGEFQS  574

Query  602  -YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              SLE+L++S N+L+G IP  +     L  +D+S N L
Sbjct  575  LQSLETLNLSHNNLSGEIPASLEKLRGLYTVDISYNEL  612


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P    +  L NLV ++  +N   G IP+   +  KL  L +  N L+G I  E  +M+
Sbjct  193  SGPIPPELGNLRNLVEVDLDTNRQTGPIPSTFGNLKKLTVLHMFSNSLSGPIPSELGNME  252

Query  536  TLRSLNLRGNMLFGEIPTPMVAYSLESL-DVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L  ++L  N L G IPT        +L  +  N L+G IP +IGN  +L  L+LS N L
Sbjct  253  SLSEISLYHNNLSGLIPTSFGDLRHLTLARLYGNQLSGPIPVEIGNLNSLVDLELSENQL  312


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 6/138 (4%)
 Frame = +2

Query  311  GSVTRISLSEMI---MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G++ ++++  M    + G  P+   +  + +L  I+   N+L G IP +      L    
Sbjct  225  GNLKKLTVLHMFSNSLSGPIPSE--LGNMESLSEISLYHNNLSGLIPTSFGDLRHLTLAR  282

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPD  658
            L  N L+G I  E  ++ +L  L L  N L G IP  +   S LE L +  N L+GSIP+
Sbjct  283  LYGNQLSGPIPVEIGNLNSLVDLELSENQLNGSIPASLGNLSNLEILFLRDNLLSGSIPN  342

Query  659  DIGNFYNLSYLDLSMNSL  712
            +IGN   LS L+L  N+L
Sbjct  343  EIGNLMKLSMLELDHNNL  360


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 67/132 (51%), Gaps = 3/132 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  + LSE  + GS PAS  +  L+NL  +    N L G+IP  + +  KL  L+L  N
Sbjct  301  SLVDLELSENQLNGSIPAS--LGNLSNLEILFLRDNLLSGSIPNEIGNLMKLSMLELDHN  358

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
            +LTG +    +   +L       N L G IP  +     L+ + +  N L G++ +D+G 
Sbjct  359  NLTGNLPQGIYRGGSLEYFTANDNQLTGPIPQGLKNCTRLKRVYLERNRLKGNLSEDLGV  418

Query  671  FYNLSYLDLSMN  706
            + NL + +LS N
Sbjct  419  YPNLKFSELSDN  430


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 80/177 (45%), Gaps = 42/177 (24%)
 Frame = +2

Query  302  NSNGSVTRISLSEMI---MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLE  472
            N  G++ ++S+ E+    + G+ P    I +  +L     + N L G IP  L +C++L+
Sbjct  342  NEIGNLMKLSMLELDHNNLTGNLPQG--IYRGGSLEYFTANDNQLTGPIPQGLKNCTRLK  399

Query  473  TL-------------DLSI-----------------------NDLTGKIAGEFFSMKTLR  544
             +             DL +                       N+L+GKI  E  + + ++
Sbjct  400  RVYLERNRLKGNLSEDLGVYPNLKFSELSDNEFYGEVSSNWGNNLSGKIPAEIGNSRQIQ  459

Query  545  SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+L  N L GEIP  +    SL  L ++ N L+GS+P ++G    L YLDLS N L
Sbjct  460  RLDLSSNHLVGEIPKEIAKLTSLLDLRLNGNQLSGSVPLELGLMSKLLYLDLSANQL  516


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 55/107 (51%), Gaps = 1/107 (1%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            LVS+   +NSL G IP  L +   L  +DL  N  TG I   F ++K L  L++  N L 
Sbjct  182  LVSLLLYNNSLSGPIPPELGNLRNLVEVDLDTNRQTGPIPSTFGNLKKLTVLHMFSNSLS  241

Query  575  GEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            G IP+ +    SL  + +  N+L+G IP   G+  +L+   L  N L
Sbjct  242  GPIPSELGNMESLSEISLYHNNLSGLIPTSFGDLRHLTLARLYGNQL  288



>ref|XP_010924441.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=1057

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 7/185 (4%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTS--SPCDWPGISCNSNGSVTRISLS  337
            + S T   + ER ILL +++ WG P S+   WN ++    C W GI C+++GSVT I+LS
Sbjct  42   AASQTKTEDGERQILLRIRKDWGNP-SVLGSWNDSTPTGHCKWIGIQCSADGSVTTITLS  100

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
               +    PA+  IC+L NL  ++ S   + GT P +L +CS L  LDLS N L G I  
Sbjct  101  NQNIAQPIPAA--ICKLKNLSILDLSHTGIPGTFPTSLYNCSNLLYLDLSSNHLVGVIPS  158

Query  518  EFFSMK-TLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYL  691
            + + +   L  L L  N   GEIP  +   S +E L +  N  N S P ++GN  NL  L
Sbjct  159  DIYRLSPRLTDLILSDNNFTGEIPPSIGRLSAIEHLSLYDNFFNASFPAELGNLSNLQTL  218

Query  692  DLSMN  706
             L  N
Sbjct  219  RLGGN  223


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  I +S   + GS P      +L +L  +   +N   G IP ++   +++  LD+S+N 
Sbjct  313  LEEIDVSMNQLNGSIPEE--FGKLQSLSLLYMYNNRFSGEIPESIRESTEMTLLDVSVNS  370

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEI--PTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
            L+G I    +++  LR L L  N L G I    P+ A  LE +DVS N LNGSIP++ G 
Sbjct  371  LSGSIPAGIWNLTKLRILYLFANNLTGAINIDRPIGALGLEKIDVSMNQLNGSIPEEFGK  430

Query  671  FYNLSYLDLSMNSL  712
              NLS L +  N  
Sbjct  431  LQNLSLLFMYYNQF  444


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 74/140 (53%), Gaps = 7/140 (5%)
 Frame = +2

Query  296  SCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLET  475
            S N+  ++  I +      G+ P++A      +L  +  ++N L G IPA L+  S+L  
Sbjct  523  SLNNCSTLAYIDIQNNRFSGNIPSAA-----KSLRVLEATNNLLSGKIPAVLTGISELSE  577

Query  476  LDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSI  652
            L L  N ++G+I      +K L SLNL  N L G+IP  + +   L SLD+S N L+ SI
Sbjct  578  LHLGGNQISGQIPPGISELKYLYSLNLSSNHLVGKIPAAIGSLQQLISLDLSINQLSDSI  637

Query  653  PDDIGNFYNLSYLDLSMNSL  712
            P +IG    L  L+LS N L
Sbjct  638  PPEIGGL-KLKTLNLSSNRL  656


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +2

Query  332  LSEMIMGGSFPASAI---ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            LSE+ +GG+  +  I   I +L  L S+N SSN L G IPA + S  +L +LDLSIN L+
Sbjct  575  LSELHLGGNQISGQIPPGISELKYLYSLNLSSNHLVGKIPAAIGSLQQLISLDLSINQLS  634

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIP  586
              I  E   +K L++LNL  N L GEIP
Sbjct  635  DSIPPEIGGLK-LKTLNLSSNRLSGEIP  661


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 76/157 (48%), Gaps = 16/157 (10%)
 Frame = +2

Query  239  FSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGS-FPASAIICQLNNLVSINF-  412
             SL++ + + S P +   +S          +L  + +GG+ F  + I     NL  ++F 
Sbjct  194  LSLYDNFFNASFPAELGNLS----------NLQTLRLGGNPFAPATIPPTFRNLTQLSFL  243

Query  413  --SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI-  583
                 +L G IP  +   + +  L L  N L+G I    +++K LR L L  N L G I 
Sbjct  244  GMGQANLKGEIPEFIGELTGMRLLYLPSNSLSGSIPAGIWNLKKLRYLYLYKNNLTGAII  303

Query  584  -PTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
               P+ A  LE +DVS N LNGSIP++ G   +LS L
Sbjct  304  IDKPIGALGLEEIDVSMNQLNGSIPEEFGKLQSLSLL  340


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 61/124 (49%), Gaps = 4/124 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLS-SCSKLETLDLSINDLTGKIAGEF  523
            + GS PA   I  L  L  +    N+L G I  +       LE +D+S+N L G I  EF
Sbjct  274  LSGSIPAG--IWNLKKLRYLYLYKNNLTGAIIIDKPIGALGLEEIDVSMNQLNGSIPEEF  331

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
              +++L  L +  N   GEIP  +  +  +  LDVS N L+GSIP  I N   L  L L 
Sbjct  332  GKLQSLSLLYMYNNRFSGEIPESIRESTEMTLLDVSVNSLSGSIPAGIWNLTKLRILYLF  391

Query  701  MNSL  712
             N+L
Sbjct  392  ANNL  395



>gb|ABA93885.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ18505.1| hypothetical protein OsJ_34033 [Oryza sativa Japonica Group]
 dbj|BAH01665.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 95/175 (54%), Gaps = 4/175 (2%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            E  IL   +  W  PF++ + W+ T  +PC W  ++CN+N SV R+ L   + G S P  
Sbjct  28   EGDILYAQRLAWKDPFNVLQSWDPTLVNPCTWFHVTCNNNNSVVRVDLG--LAGLSGPLI  85

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
              +  L+ L  +    N L G+IPA L + S L +LDL  N LTG I     ++ TLR+L
Sbjct  86   PQLGGLSYLQYLELYGNELNGSIPAALGNLSSLVSLDLQGNLLTGAIPDSLGAISTLRNL  145

Query  551  NLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GN L G IP  + +  SL  L++  N L+G+IP  +GN   L  L L+ NSL
Sbjct  146  RLYGNNLTGTIPQSLGSLTSLVKLELQKNSLSGTIPASLGNIKTLELLRLNKNSL  200



>ref|XP_002323316.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF05077.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=888

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 97/184 (53%), Gaps = 11/184 (6%)
 Frame = +2

Query  170  SLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSP-CDWPGISCNSNGS-VTRISLSEM  343
             L T   DE+AILL +K   G P      W + ++  C+W GI+C  N S V  + LS +
Sbjct  19   QLVTAQLDEQAILLAIKGELGVP-----GWGANNTNYCNWAGINCGLNHSMVEGLDLSRL  73

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             + G+     ++ +L  L  ++ SSNS  G IP+   + S+LE LDLS+N   G I  E 
Sbjct  74   GLRGNV---TLVSELKALKQLDLSSNSFHGEIPSAFGNLSQLEFLDLSLNKFGGVIPMEL  130

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
             S++ L+SLNL  NML G IP        LE   +SSN LNGSIP  +GN  NL      
Sbjct  131  GSLRNLKSLNLSNNMLGGWIPDEFQGLEKLEDFQISSNKLNGSIPSWVGNLTNLRVFTAY  190

Query  701  MNSL  712
             N L
Sbjct  191  ENEL  194


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P +  I  +++L     ++N + G I +  + CS L  L+L+ N  TG I  E   +
Sbjct  268  GVIPKA--IGNVSSLTYFEVANNHISGEIVSEFARCSNLTLLNLASNGFTGVIPPELGQL  325

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L+ L L GN L+G+IP  ++ + SL  LD+S+N  NG++P+DI N   L +L L  NS
Sbjct  326  VNLQELILSGNSLYGDIPKSILGWKSLNKLDLSNNRFNGTVPNDICNMSRLQFLLLGQNS  385

Query  710  L  712
            +
Sbjct  386  I  386


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL NL  +  S NSL+G IP ++     L  LDLS N   G +  +  +M  L+ L L  
Sbjct  324  QLVNLQELILSGNSLYGDIPKSILGWKSLNKLDLSNNRFNGTVPNDICNMSRLQFLLLGQ  383

Query  563  NMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSY-LDLSMNSL  712
            N + GEIP  +     L  L + SN L GSIP +IG+  NL   L+LS N L
Sbjct  384  NSIKGEIPHEIGNCMKLLELQMGSNYLTGSIPPEIGHIRNLQIALNLSFNHL  435


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ ++ LS     G+ P    IC ++ L  +    NS+ G IP  + +C KL  L +  N
Sbjct  351  SLNKLDLSNNRFNGTVPND--ICNMSRLQFLLLGQNSIKGEIPHEIGNCMKLLELQMGSN  408

Query  494  DLTGKIAGEFFSMKTLR-SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG  667
             LTG I  E   ++ L+ +LNL  N L G +P  +     L SLDVS+N L+G+IP    
Sbjct  409  YLTGSIPPEIGHIRNLQIALNLSFNHLHGALPPELGKLDKLVSLDVSNNQLSGTIPPSFK  468

Query  668  NFYNLSYLDLSMN  706
               +L  ++ S N
Sbjct  469  GMLSLIEVNFSNN  481



>gb|KHN15495.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1010

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 99/175 (57%), Gaps = 5/175 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCN--SNGSVTRISLSEMIMGGSFP  364
            E   L  LK  +  P S    WNS  ++PC+W G++C+  SN +VT + LS+  +GG F 
Sbjct  33   EGLYLYQLKLSFDDPDSRLSSWNSRDATPCNWFGVTCDAVSNTTVTELDLSDTNIGGPFL  92

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
            A+ I+C+L NLVS+N  +NS+  T+P  +S C  L  LDLS N LTG +      +  L+
Sbjct  93   AN-ILCRLPNLVSVNLFNNSINETLPLEISLCKNLIHLDLSQNLLTGPLPNTLPQLVNLK  151

Query  545  SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             L+L GN   G IP     +  LE L + SN L G+IP  +GN   L  L+LS N
Sbjct  152  YLDLTGNNFSGSIPDSFGTFQNLEVLSLVSNLLEGTIPASLGNVSTLKMLNLSYN  206


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 68/127 (54%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L++  + G  PAS  + +L  L  ++ + N L+G+IP++L+  + L  ++L  N L+G++
Sbjct  228  LTQCNLVGVIPAS--LGRLGRLQDLDLALNDLYGSIPSSLTELTSLRQIELYNNSLSGEL  285

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
                 ++  LR ++   N L G IP  + +  LESL++  N   G +P  I N  NL  L
Sbjct  286  PKGMGNLSNLRLIDASMNHLTGSIPEELCSLPLESLNLYENRFEGELPASIANSPNLYEL  345

Query  692  DLSMNSL  712
             L  N L
Sbjct  346  RLFGNRL  352


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 55/108 (51%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  S N+  GTIP  +     L     S N  TG +     ++  L  L+   N L
Sbjct  464  NLSLLILSKNNFTGTIPDEVGWLENLVEFSASDNKFTGSLPDSIVNLGQLGILDFHKNKL  523

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GE+P  + ++  L  L++++N++ G IPD+IG    L++LDLS N  
Sbjct  524  SGELPKGIRSWKKLNDLNLANNEIGGRIPDEIGGLSVLNFLDLSRNRF  571



>gb|EYU20424.1| hypothetical protein MIMGU_mgv1a021116mg, partial [Erythranthe 
guttata]
Length=606

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 92/156 (59%), Gaps = 5/156 (3%)
 Frame = +2

Query  248  FEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSL  427
            F  WNS+   C W GI+C  +  V++I L    + G  P S  I +L ++ SI+ S+N L
Sbjct  53   FINWNSSLPFCKWNGITCFDSSHVSKIELPGKNLSGKIPNS--IFELPHIQSIDLSNNQL  110

Query  428  WGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS  607
            +G IP NLSSC  L  L+LS N+LTG I      +  L + +L  NMLFGEIP  +  +S
Sbjct  111  FGEIPYNLSSCYSLRYLNLSSNNLTGLIP--IGRLPFLETFDLSNNMLFGEIPEEIGFFS  168

Query  608  -LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L+ +D+  N L+G+IPD I N   L++L L+ N L
Sbjct  169  GLKVVDLGGNILSGNIPDSITNMTKLAFLTLASNQL  204


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 63/122 (52%), Gaps = 2/122 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P S  +C+  +L  +    N L G +   L+S   +  LD S N  +G+I    +
Sbjct  396  LKGEIPKSLSLCK--SLQRVRLQKNELSGELSPKLTSLPAVYFLDFSENKFSGRIDDRTW  453

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             M  L+ LNL  N  FGE+P    + SLE+LD+S N  +G IP+  G F ++  + LS N
Sbjct  454  DMPQLQILNLAKNEFFGELPDSFGSNSLENLDLSGNRFSGGIPEKFGEFSDIMEMRLSGN  513

Query  707  SL  712
             L
Sbjct  514  EL  515


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 72/147 (49%), Gaps = 31/147 (21%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P S  I  L NL  ++   N+L G IP +L + + LE L L  N LTG I   FF +
Sbjct  230  GEIPNS--IGDLINLKHLDLVYNNLTGEIPLSLGNLTNLEHLFLYFNKLTGPIPITFFDV  287

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVS---------------------------S  631
            + L SL+L  N L GEIP   + + L++L++                            S
Sbjct  288  RKLVSLDLSDNFLSGEIPE--LFFQLQNLEILHLFSNNFSGKIPNALSFLPHLQILQLWS  345

Query  632  NDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L+G IP D+G + NL+ LDLS N+L
Sbjct  346  NRLSGEIPKDLGKYNNLTILDLSTNNL  372


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  + LS     G  P      + ++++ +  S N L G IP  LS C KL +LDLS N
Sbjct  480  SLENLDLSGNRFSGGIPEK--FGEFSDIMEMRLSGNELSGKIPDQLSYCKKLVSLDLSHN  537

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIP  655
             L G+I   F SM  L  L+L  N L G+IP+ +    SL  +++S N+ +G +P
Sbjct  538  HLAGEIPTSFASMPVLGQLDLSVNELTGKIPSNLGEVESLVQVNISYNNFHGRLP  592


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 54/104 (52%), Gaps = 2/104 (2%)
 Frame = +2

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            +N + N  +G +P +  S S LE LDLS N  +G I  +F     +  + L GN L G+I
Sbjct  461  LNLAKNEFFGELPDSFGSNS-LENLDLSGNRFSGGIPEKFGEFSDIMEMRLSGNELSGKI  519

Query  584  PTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  +     L SLD+S N L G IP    +   L  LDLS+N L
Sbjct  520  PDQLSYCKKLVSLDLSHNHLAGEIPTSFASMPVLGQLDLSVNEL  563


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 1/118 (1%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P       +  LVS++ S N L G IP        LE L L  N+ +GKI      +  L
Sbjct  279  PIPITFFDVRKLVSLDLSDNFLSGEIPELFFQLQNLEILHLFSNNFSGKIPNALSFLPHL  338

Query  542  RSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L L  N L GEIP  +  Y+ L  LD+S+N+L G IP+++ +   L  L L  NSL
Sbjct  339  QILQLWSNRLSGEIPKDLGKYNNLTILDLSTNNLTGKIPENLCSSSRLFKLILFSNSL  396


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 1/100 (1%)
 Frame = +2

Query  416  SNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM  595
            SN L G IP +L   + L  LDLS N+LTGKI     S   L  L L  N L GEIP  +
Sbjct  345  SNRLSGEIPKDLGKYNNLTILDLSTNNLTGKIPENLCSSSRLFKLILFSNSLKGEIPKSL  404

Query  596  -VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             +  SL+ + +  N+L+G +   + +   + +LD S N  
Sbjct  405  SLCKSLQRVRLQKNELSGELSPKLTSLPAVYFLDFSENKF  444


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  + LS   + G  P     C+   LVS++ S N L G IP + +S   L  LDLS+N+
Sbjct  505  IMEMRLSGNELSGKIPDQLSYCK--KLVSLDLSHNHLAGEIPTSFASMPVLGQLDLSVNE  562

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT  589
            LTGKI      +++L  +N+  N   G +P+
Sbjct  563  LTGKIPSNLGEVESLVQVNISYNNFHGRLPS  593



>ref|XP_003528467.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1007

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 99/175 (57%), Gaps = 5/175 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCN--SNGSVTRISLSEMIMGGSFP  364
            E   L  LK  +  P S    WNS  ++PC+W G++C+  SN +VT + LS+  +GG F 
Sbjct  33   EGLYLYQLKLSFDDPDSRLSSWNSRDATPCNWFGVTCDAVSNTTVTELDLSDTNIGGPFL  92

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
            A+ I+C+L NLVS+N  +NS+  T+P  +S C  L  LDLS N LTG +      +  L+
Sbjct  93   AN-ILCRLPNLVSVNLFNNSINETLPLEISLCKNLIHLDLSQNLLTGPLPNTLPQLVNLK  151

Query  545  SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             L+L GN   G IP     +  LE L + SN L G+IP  +GN   L  L+LS N
Sbjct  152  YLDLTGNNFSGSIPDSFGTFQNLEVLSLVSNLLEGTIPASLGNVSTLKMLNLSYN  206


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 68/127 (54%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L++  + G  PAS  + +L  L  ++ + N L+G+IP++L+  + L  ++L  N L+G++
Sbjct  228  LTQCNLVGVIPAS--LGRLGRLQDLDLALNDLYGSIPSSLTELTSLRQIELYNNSLSGEL  285

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
                 ++  LR ++   N L G IP  + +  LESL++  N   G +P  I N  NL  L
Sbjct  286  PKGMGNLSNLRLIDASMNHLTGSIPEELCSLPLESLNLYENRFEGELPASIANSPNLYEL  345

Query  692  DLSMNSL  712
             L  N L
Sbjct  346  RLFGNRL  352


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 55/108 (51%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  S N+  GTIP  +     L     S N  TG +     ++  L  L+   N L
Sbjct  461  NLSLLILSKNNFTGTIPDEVGWLENLVEFSASDNKFTGSLPDSIVNLGQLGILDFHNNKL  520

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GE+P  + ++  L  L++++N++ G IPD+IG    L++LDLS N  
Sbjct  521  SGELPKGIRSWKKLNDLNLANNEIGGRIPDEIGGLSVLNFLDLSRNRF  568



>gb|AGT15910.1| kinase [Saccharum hybrid cultivar R570]
Length=1023

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 93/177 (53%), Gaps = 4/177 (2%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            +D R++L    +  G   S+   WN T+  C W G+ C+  G V  +SL    + G+   
Sbjct  30   DDARSLLAFKAELAGSSSSVLASWNGTTGVCRWEGVVCSGGGQVVSLSLPYRGLAGAL--  87

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S  I  L  L ++N SSN L G IPA++   ++L+ LDLS N  +G +     S  +L  
Sbjct  88   SPAIGNLTFLRTLNLSSNWLRGEIPASIGRLARLQALDLSYNAFSGTLPANLSSCVSLLW  147

Query  548  LNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N L G IP  + A    L+ L +++N L G+IP  +GN  +L YLDL+ N L
Sbjct  148  LRLSSNRLHGRIPVELGAQLMILQRLSLANNSLTGAIPRSLGNLSSLDYLDLTKNQL  204


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P    +  L NL  +  S N L  +IP ++ +C  LE L L  N   G I     ++K
Sbjct  502  SGPLPVEVGSLANLNQLILSGNQLSSSIPDSIGNCISLERLLLDHNSFEGTIPQSLKNLK  561

Query  536  TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L  LNL  N L G IP  + +  SL+ L ++ N+L+G IP  + N   LS LDLS N L
Sbjct  562  GLALLNLTMNKLSGSIPDALASIGSLQQLYLAHNNLSGLIPAVLQNLTLLSKLDLSFNDL  621


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + G  P   +  QL  L  ++ ++NSL G IP +L + S L+ LDL+ N L G
Sbjct  148  LRLSSNRLHGRIPVE-LGAQLMILQRLSLANNSLTGAIPRSLGNLSSLDYLDLTKNQLDG  206

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFY  676
             +  E  SM  L+ L L  N L G +P  +    SL++  V  N L+G+IP DIG+ +
Sbjct  207  PVPHELGSMAGLQVLLLFLNSLSGVLPQSLYNLSSLKNFGVEYNMLSGTIPADIGDRF  264


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 74/158 (47%), Gaps = 28/158 (18%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+SL+   + G+ P S  +  L++L  ++ + N L G +P  L S + L+ L L +N 
Sbjct  170  LQRLSLANNSLTGAIPRS--LGNLSSLDYLDLTKNQLDGPVPHELGSMAGLQVLLLFLNS  227

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGN  670
            L+G +    +++ +L++  +  NML G IP  +     S+E+L  S N  +G+IP  + N
Sbjct  228  LSGVLPQSLYNLSSLKNFGVEYNMLSGTIPADIGDRFPSIEALSFSGNRFSGAIPPSVSN  287

Query  671  F------------------------YNLSYLDLSMNSL  712
                                       LSYLDL  N L
Sbjct  288  LSALTKLGLARNGFIGHVPPALSKLQGLSYLDLGDNRL  325



>emb|CDY48481.1| BnaC05g13410D [Brassica napus]
Length=1108

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 96/186 (52%), Gaps = 4/186 (2%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLS  337
            +S  L T   +E   LL  K       S    WN S S+PC+W G+ CN  G+VT + LS
Sbjct  14   FSFILVTSLNEEGQALLEFKASLNDSNSYLISWNGSDSNPCNWTGVECNRLGTVTSVDLS  73

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
             M + G+   S +IC+L+ L  +N S+N + G IP   S C  LE LDL  N   G I  
Sbjct  74   GMNLSGTL--SPLICKLHGLSYLNVSTNFISGPIPREFSLCRTLEILDLCTNRFHGVIPI  131

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
            +   + TL+ L+L  N LFG IP  + +  SL+ L++ SN+L G IP  IG    L  + 
Sbjct  132  QLTMINTLQKLSLCENYLFGSIPRFIGSMSSLQELEIYSNNLTGVIPSSIGKLRQLRVIR  191

Query  695  LSMNSL  712
               N L
Sbjct  192  AGRNML  197


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T++ L + ++ G+ P    +  LNNL ++    N L G I A+L     LE L L+ N
Sbjct  450  SLTKLMLGDNMLTGTLPVE--LFNLNNLSALELHQNLLSGNISADLGKLKSLERLRLANN  507

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
            + TG+I  E  ++  +  LN+  N L G IP  +    +++ LD+S N  +G I +++G 
Sbjct  508  NFTGEIPPEIKNLTKIVGLNISSNHLTGHIPRELGSCVTIQRLDLSGNKFSGHIAEELGQ  567

Query  671  FYNLSYLDLSMNSL  712
              NL  L LS N L
Sbjct  568  LVNLEILKLSDNRL  581


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 10/148 (7%)
 Frame = +2

Query  275  PCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLS  454
            PC+   ++         I  SE  + G  P  +   Q+ NL  ++   N+L G+IP  L 
Sbjct  298  PCEIGNLT-----DAVEIDFSENQLTGYIPRES--GQILNLKLLHLFENNLHGSIPRELG  350

Query  455  SCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVS  628
              S L+ LDLSIN LTG I  E   + +L  L L  N L G IP P++ Y  +   LD+S
Sbjct  351  ELSLLQKLDLSINRLTGTIPKELQRLTSLVDLQLFDNNLEGTIP-PLIGYYSNFTVLDMS  409

Query  629  SNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +N+L+GSIP     F  L  L L  N L
Sbjct  410  ANNLSGSIPAHFCRFQKLILLSLGSNKL  437


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 70/132 (53%), Gaps = 3/132 (2%)
 Frame = +2

Query  320  TRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDL  499
            T + +S   + GS PA    C+   L+ ++  SN L G IP +L++C  L  L L  N L
Sbjct  404  TVLDMSANNLSGSIPAH--FCRFQKLILLSLGSNKLSGNIPRDLTTCKSLTKLMLGDNML  461

Query  500  TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFY  676
            TG +  E F++  L +L L  N+L G I   +    SLE L +++N+  G IP +I N  
Sbjct  462  TGTLPVELFNLNNLSALELHQNLLSGNISADLGKLKSLERLRLANNNFTGEIPPEIKNLT  521

Query  677  NLSYLDLSMNSL  712
             +  L++S N L
Sbjct  522  KIVGLNISSNHL  533


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 73/159 (46%), Gaps = 28/159 (18%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ L+     G  P    I  L  +V +N SSN L G IP  L SC  ++ LDLS N
Sbjct  498  SLERLRLANNNFTGEIPPE--IKNLTKIVGLNISSNHLTGHIPRELGSCVTIQRLDLSGN  555

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIP------TPMVAYSLE--------------  613
              +G IA E   +  L  L L  N L GEIP      T ++   L               
Sbjct  556  KFSGHIAEELGQLVNLEILKLSDNRLTGEIPHSFGDLTRLMELQLGGNLLSGSIPLELGK  615

Query  614  ------SLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                  SL++S N+L+G+IPD +GN   L  L L+ N L
Sbjct  616  LTSLQISLNISHNNLSGAIPDSLGNLQMLEILYLNDNKL  654


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++ LS   + G+ P    + +L +LV +    N+L GTIP  +   S    LD+S N+
Sbjct  355  LQKLDLSINRLTGTIPKE--LQRLTSLVDLQLFDNNLEGTIPPLIGYYSNFTVLDMSANN  412

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNF  673
            L+G I   F   + L  L+L  N L G IP  +    SL  L +  N L G++P ++ N 
Sbjct  413  LSGSIPAHFCRFQKLILLSLGSNKLSGNIPRDLTTCKSLTKLMLGDNMLTGTLPVELFNL  472

Query  674  YNLSYLDLSMNSL  712
             NLS L+L  N L
Sbjct  473  NNLSALELHQNLL  485


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 60/123 (49%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+S  I +L  L  I    N L G IP+ +S C  L+ L L+ N L G +  +  
Sbjct  173  LTGVIPSS--IGKLRQLRVIRAGRNMLSGVIPSEISGCVSLKVLGLAENLLEGSLPKQLE  230

Query  527  SMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +  L  L L  N L GEIP+ +    SLE L +  N   G+IP +IG   N+  L L  
Sbjct  231  KLLNLTDLILWQNRLSGEIPSSVGNITSLEVLALHENYFTGTIPKEIGKLVNIKRLYLYT  290

Query  704  NSL  712
            N L
Sbjct  291  NQL  293


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+S  +  + +L  +    N   GTIP  +     ++ L L  N LTG+I  E  
Sbjct  245  LSGEIPSS--VGNITSLEVLALHENYFTGTIPKEIGKLVNIKRLYLYTNQLTGEIPCEIG  302

Query  527  SMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            ++     ++   N L G IP       +L+ L +  N+L+GSIP ++G    L  LDLS+
Sbjct  303  NLTDAVEIDFSENQLTGYIPRESGQILNLKLLHLFENNLHGSIPRELGELSLLQKLDLSI  362

Query  704  NSL  712
            N L
Sbjct  363  NRL  365



>gb|EAZ02799.1| hypothetical protein OsI_24925 [Oryza sativa Indica Group]
Length=1109

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 80/147 (54%), Gaps = 3/147 (2%)
 Frame = +2

Query  275  PCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLS  454
            PC WPGI+C++   VT ++L  + + G    SA +C L  L  +N S N+L G +P  L+
Sbjct  63   PCGWPGIACSAAMEVTAVTLHGLNLHGEL--SAAVCALPRLAVLNVSKNALAGALPPGLA  120

Query  455  SCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSS  631
            +C  LE LDLS N L G I     S+ +LR L L  N L GEIP  +    +LE L++ S
Sbjct  121  ACRALEVLDLSTNSLHGGIPPSLCSLPSLRQLFLSENFLSGEIPAAIGNLTALEELEIYS  180

Query  632  NDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N+L G IP  I     L  +   +N L
Sbjct  181  NNLTGGIPTTIAALQRLRIIRAGLNDL  207


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 70/135 (52%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ LSE    G  P    I  L  LV+ N SSN L G IP  L+ C+KL+ LDLS N
Sbjct  508  SIERLILSENYFVGQIPPG--IGNLTKLVAFNISSNQLTGPIPRELARCTKLQRLDLSKN  565

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I  E  ++  L  L L  N L G IP+     S L  L +  N L+G +P ++G 
Sbjct  566  SLTGVIPQELGTLVNLEQLKLSDNSLNGTIPSSFGGLSRLTELQMGGNRLSGQLPVELGQ  625

Query  671  FYNLSY-LDLSMNSL  712
               L   L++S N L
Sbjct  626  LTALQIALNVSYNML  640


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 68/135 (50%), Gaps = 5/135 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    + ++  L  +    N L G+IP  L   + +  +DLSIN
Sbjct  316  SAVEIDLSENKLTGVIPGE--LGRIPTLRLLYLFENRLQGSIPPELGELNVIRRIDLSIN  373

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIG  667
            +LTG I  EF ++  L  L L  N + G IP PM+    +L  LD+S N L GSIP  + 
Sbjct  374  NLTGTIPMEFQNLTDLEYLQLFDNQIHGVIP-PMLGAGSNLSVLDLSDNRLTGSIPPHLC  432

Query  668  NFYNLSYLDLSMNSL  712
             F  L +L L  N L
Sbjct  433  KFQKLIFLSLGSNRL  447


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 66/134 (49%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  ++L++    G  P    +  L +L  +    N L GTIP  L        +DLS N
Sbjct  268  SLEMLALNDNAFTGGVPRE--LGALPSLAKLYIYRNQLDGTIPRELGDLQSAVEIDLSEN  325

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I GE   + TLR L L  N L G IP  +   + +  +D+S N+L G+IP +  N
Sbjct  326  KLTGVIPGELGRIPTLRLLYLFENRLQGSIPPELGELNVIRRIDLSINNLTGTIPMEFQN  385

Query  671  FYNLSYLDLSMNSL  712
              +L YL L  N +
Sbjct  386  LTDLEYLQLFDNQI  399


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 77/163 (47%), Gaps = 21/163 (13%)
 Frame = +2

Query  224  HWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            H G P SL          C  P        S+ ++ LSE  + G  PA+  I  L  L  
Sbjct  136  HGGIPPSL----------CSLP--------SLRQLFLSENFLSGEIPAA--IGNLTALEE  175

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            +   SN+L G IP  +++  +L  +   +NDL+G I  E  +  +L  L L  N L GE+
Sbjct  176  LEIYSNNLTGGIPTTIAALQRLRIIRAGLNDLSGPIPVEISACASLAVLGLAQNNLAGEL  235

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            P  +     L +L +  N L+G IP ++G+  +L  L L+ N+
Sbjct  236  PGELSRLKNLTTLILWQNALSGEIPPELGDIPSLEMLALNDNA  278


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 63/145 (43%), Gaps = 27/145 (19%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P     C+   L  +    N L G++P  LS    L +LD++ N  +G I  E    
Sbjct  449  GNIPPGVKACR--TLTQLQLGGNMLTGSLPVELSLLRNLSSLDMNRNRFSGPIPPEIGKF  506

Query  533  KTLRSLNLRGNMLFGEIP------TPMVAY-------------------SLESLDVSSND  637
            +++  L L  N   G+IP      T +VA+                    L+ LD+S N 
Sbjct  507  RSIERLILSENYFVGQIPPGIGNLTKLVAFNISSNQLTGPIPRELARCTKLQRLDLSKNS  566

Query  638  LNGSIPDDIGNFYNLSYLDLSMNSL  712
            L G IP ++G   NL  L LS NSL
Sbjct  567  LTGVIPQELGTLVNLEQLKLSDNSL  591


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 69/155 (45%), Gaps = 27/155 (17%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + RI LS   + G+ P       L +L  +    N + G IP  L + S L  LDLS N 
Sbjct  365  IRRIDLSINNLTGTIPME--FQNLTDLEYLQLFDNQIHGVIPPMLGAGSNLSVLDLSDNR  422

Query  497  LTGKIAGE--------FFSM----------------KTLRSLNLRGNMLFGEIPTP-MVA  601
            LTG I           F S+                +TL  L L GNML G +P    + 
Sbjct  423  LTGSIPPHLCKFQKLIFLSLGSNRLIGNIPPGVKACRTLTQLQLGGNMLTGSLPVELSLL  482

Query  602  YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             +L SLD++ N  +G IP +IG F ++  L LS N
Sbjct  483  RNLSSLDMNRNRFSGPIPPEIGKFRSIERLILSEN  517



>dbj|BAC84715.1| putative LRR receptor-like kinase [Oryza sativa Japonica Group]
 dbj|BAH01336.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1109

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 80/147 (54%), Gaps = 3/147 (2%)
 Frame = +2

Query  275  PCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLS  454
            PC WPGI+C++   VT ++L  + + G    SA +C L  L  +N S N+L G +P  L+
Sbjct  63   PCGWPGIACSAAMEVTAVTLHGLNLHGEL--SAAVCALPRLAVLNVSKNALAGALPPGLA  120

Query  455  SCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSS  631
            +C  LE LDLS N L G I     S+ +LR L L  N L GEIP  +    +LE L++ S
Sbjct  121  ACRALEVLDLSTNSLHGGIPPSLCSLPSLRQLFLSENFLSGEIPAAIGNLTALEELEIYS  180

Query  632  NDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N+L G IP  I     L  +   +N L
Sbjct  181  NNLTGGIPTTIAALQRLRIIRAGLNDL  207


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 70/135 (52%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ LSE    G  P    I  L  LV+ N SSN L G IP  L+ C+KL+ LDLS N
Sbjct  508  SIERLILSENYFVGQIPPG--IGNLTKLVAFNISSNQLTGPIPRELARCTKLQRLDLSKN  565

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I  E  ++  L  L L  N L G +P+     S L  L +  N L+G +P ++G 
Sbjct  566  SLTGVIPQELGTLVNLEQLKLSDNSLNGTVPSSFGGLSRLTELQMGGNRLSGQLPVELGQ  625

Query  671  FYNLSY-LDLSMNSL  712
               L   L++S N L
Sbjct  626  LTALQIALNVSYNML  640


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 68/135 (50%), Gaps = 5/135 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    + ++  L  +    N L G+IP  L   + +  +DLSIN
Sbjct  316  SAVEIDLSENKLTGVIPGE--LGRIPTLRLLYLFENRLQGSIPPELGELTVIRRIDLSIN  373

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIG  667
            +LTG I  EF ++  L  L L  N + G IP PM+    +L  LD+S N L GSIP  + 
Sbjct  374  NLTGTIPMEFQNLTDLEYLQLFDNQIHGVIP-PMLGAGSNLSVLDLSDNRLTGSIPPHLC  432

Query  668  NFYNLSYLDLSMNSL  712
             F  L +L L  N L
Sbjct  433  KFQKLIFLSLGSNRL  447


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 66/134 (49%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  ++L++    G  P    +  L +L  +    N L GTIP  L        +DLS N
Sbjct  268  SLEMLALNDNAFTGGVPRE--LGALPSLAKLYIYRNQLDGTIPRELGDLQSAVEIDLSEN  325

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I GE   + TLR L L  N L G IP  +   + +  +D+S N+L G+IP +  N
Sbjct  326  KLTGVIPGELGRIPTLRLLYLFENRLQGSIPPELGELTVIRRIDLSINNLTGTIPMEFQN  385

Query  671  FYNLSYLDLSMNSL  712
              +L YL L  N +
Sbjct  386  LTDLEYLQLFDNQI  399


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 77/163 (47%), Gaps = 21/163 (13%)
 Frame = +2

Query  224  HWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            H G P SL          C  P        S+ ++ LSE  + G  PA+  I  L  L  
Sbjct  136  HGGIPPSL----------CSLP--------SLRQLFLSENFLSGEIPAA--IGNLTALEE  175

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            +   SN+L G IP  +++  +L  +   +NDL+G I  E  +  +L  L L  N L GE+
Sbjct  176  LEIYSNNLTGGIPTTIAALQRLRIIRAGLNDLSGPIPVEISACASLAVLGLAQNNLAGEL  235

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            P  +     L +L +  N L+G IP ++G+  +L  L L+ N+
Sbjct  236  PGELSRLKNLTTLILWQNALSGEIPPELGDIPSLEMLALNDNA  278


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 63/145 (43%), Gaps = 27/145 (19%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P     C+   L  +    N L G++P  LS    L +LD++ N  +G I  E    
Sbjct  449  GNIPPGVKACR--TLTQLQLGGNMLTGSLPVELSLLRNLSSLDMNRNRFSGPIPPEIGKF  506

Query  533  KTLRSLNLRGNMLFGEIP------TPMVAY-------------------SLESLDVSSND  637
            +++  L L  N   G+IP      T +VA+                    L+ LD+S N 
Sbjct  507  RSIERLILSENYFVGQIPPGIGNLTKLVAFNISSNQLTGPIPRELARCTKLQRLDLSKNS  566

Query  638  LNGSIPDDIGNFYNLSYLDLSMNSL  712
            L G IP ++G   NL  L LS NSL
Sbjct  567  LTGVIPQELGTLVNLEQLKLSDNSL  591


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 69/155 (45%), Gaps = 27/155 (17%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + RI LS   + G+ P       L +L  +    N + G IP  L + S L  LDLS N 
Sbjct  365  IRRIDLSINNLTGTIPME--FQNLTDLEYLQLFDNQIHGVIPPMLGAGSNLSVLDLSDNR  422

Query  497  LTGKIAGE--------FFSM----------------KTLRSLNLRGNMLFGEIPTP-MVA  601
            LTG I           F S+                +TL  L L GNML G +P    + 
Sbjct  423  LTGSIPPHLCKFQKLIFLSLGSNRLIGNIPPGVKACRTLTQLQLGGNMLTGSLPVELSLL  482

Query  602  YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             +L SLD++ N  +G IP +IG F ++  L LS N
Sbjct  483  RNLSSLDMNRNRFSGPIPPEIGKFRSIERLILSEN  517



>ref|XP_008390812.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1019

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 103/188 (55%), Gaps = 15/188 (8%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW----NSTSSPCDWPGISCNSNGSVTRIS  331
            SQSL    + E+A+LL LK +   P SL   W    ++TSS C WP ISC +N SVT + 
Sbjct  31   SQSLQ---DQEQAVLLKLKSYLDSPPSL-SHWIPSNSNTSSHCSWPEISC-TNNSVTGLL  85

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L  + +  + P    IC L NL  ++ + N L G  P +L  CSKLE LDLS N   G I
Sbjct  86   LVNLNI--TLPVPPFICDLTNLTLVDLNXNYLXGEFPKSLYKCSKLEYLDLSQNYFVGPI  143

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLS  685
              +  S+  L+ L L GN  F  IP P +     LE+L +  N  NGS+P +IGN  NL 
Sbjct  144  PDDIDSLPRLKQLILAGNN-FSNIP-PAIGRLQELENLQLWMNQFNGSVPPEIGNLSNLK  201

Query  686  YLDLSMNS  709
             L++S N+
Sbjct  202  DLNMSXNT  209


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  L ++    ++L G +P  L     LE +DL+IN L+G+I    F++K L  + L  
Sbjct  222  KLKKLSNLWIRQSNLIGELPETLGEMEALEVIDLAINTLSGRIPNSLFTLKNLSIVYLFK  281

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            N L GE+P  + +++L  LD+S N L+G+IP++ GN   L+ L L +N
Sbjct  282  NTLSGEVPQVIESWNLSILDISENTLSGTIPEEYGNLTKLTQLALFLN  329


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 69/134 (51%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +T+++L      G  P S  I +L NL      +N+  GT+P  L   SKLE   + +N
Sbjct  320  KLTQLALFLNDFSGEIPKS--IGRLPNLRDFKIFNNNFSGTLPPELGKYSKLEAFQVXVN  377

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
             LTGK+  +      L  +   GN L GE+P+ +    SL+++ V  N L+G+IP  +  
Sbjct  378  RLTGKLPDDLCYWGKLDDVIAYGNHLSGELPSSLGNCSSLKTVKVQDNMLSGNIPSGMWT  437

Query  671  FYNLSYLDLSMNSL  712
              NL+ + +S NSL
Sbjct  438  APNLTTVLVSNNSL  451


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  ++ S N+L GTIP    + +KL  L L +ND +G+I      +  LR   +  N  
Sbjct  296  NLSILDISENTLSGTIPEEYGNLTKLTQLALFLNDFSGEIPKSIGRLPNLRDFKIFNNNF  355

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
             G +P  +  YS LE+  V  N L G +PDD+
Sbjct  356  SGTLPPELGKYSKLEAFQVXVNRLTGKLPDDL  387


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ + +    G+ P    +     L   +  +N L G +P  L++ S L TL L  N 
Sbjct  463  LSRLEMRDNXXSGNIPTG--VSSWTGLKVFDAGNNHLSGAVPRELTALSSLMTLSLDQNQ  520

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG +  +  S ++L SLN   N L G IP    +   L  LD+S+N L+G IPD +G  
Sbjct  521  LTGSLPSDIVSWESLASLNFSRNQLSGTIPEKLGLLPGLTGLDLSANQLSGEIPDQLGRL  580

Query  674  YNLSYLDLSMNSL  712
              L+  +LS N L
Sbjct  581  -KLNQFNLSSNQL  592


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 64/117 (55%), Gaps = 3/117 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P    +  L++L++++   N L G++P+++ S   L +L+ S N L+G I  +  
Sbjct  497  LSGAVPRE--LTALSSLMTLSLDQNQLTGSLPSDIVSWESLASLNFSRNQLSGTIPEKLG  554

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
             +  L  L+L  N L GEIP  +    L   ++SSN L+G IP +  N  Y  S+LD
Sbjct  555  LLPGLTGLDLSANQLSGEIPDQLGRLKLNQFNLSSNQLSGDIPIEFENAAYEGSFLD  611



>gb|AGT17281.1| hypothetical protein SHCRBa_021_E20_F_10 [Saccharum hybrid cultivar 
R570]
Length=987

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 93/177 (53%), Gaps = 4/177 (2%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            +D R++L    +  G   S+   WN T+  C W G+ C+  G V  +SL    + G+   
Sbjct  28   DDARSLLAFKAELAGSSSSVLASWNGTTGVCRWEGVVCSGGGQVVSLSLPYRGLAGAL--  85

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S  I  L  L ++N SSN L G IPA++   ++L+ LDLS N  +G +     S  +L  
Sbjct  86   SPAIGNLTFLRTLNLSSNWLRGEIPASIGRLARLQALDLSYNAFSGTLPANLSSCVSLLW  145

Query  548  LNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N L G IP  + A    L+ L +++N L G+IP  +GN  +L YLDL+ N L
Sbjct  146  LRLSSNRLHGRIPVELGAQLMILQRLSLANNSLTGAIPRSLGNLSSLDYLDLTKNQL  202


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P    +  L NL  +  S N L  +IP ++ +C  LE L L  N   G I     ++K
Sbjct  500  SGPLPVEVGSLANLNQLILSGNQLSSSIPDSIGNCISLERLLLDHNSFEGTIPQSLKNLK  559

Query  536  TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L  LNL  N L G IP  + +  SL+ L ++ N+L+G IP  + N   LS LDLS N L
Sbjct  560  GLALLNLTMNKLSGSIPDALASIGSLQQLYLAHNNLSGLIPAVLQNLTLLSKLDLSFNDL  619


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + G  P   +  QL  L  ++ ++NSL G IP +L + S L+ LDL+ N L G
Sbjct  146  LRLSSNRLHGRIPVE-LGAQLMILQRLSLANNSLTGAIPRSLGNLSSLDYLDLTKNQLDG  204

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFY  676
             +  E  SM  L+ L L  N L G +P  +    SL++  V  N L+G+IP DIG+ +
Sbjct  205  PVPHELGSMAGLQVLLLFLNSLSGVLPQSLYNLSSLKNFGVEYNMLSGTIPADIGDRF  262


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 74/158 (47%), Gaps = 28/158 (18%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+SL+   + G+ P S  +  L++L  ++ + N L G +P  L S + L+ L L +N 
Sbjct  168  LQRLSLANNSLTGAIPRS--LGNLSSLDYLDLTKNQLDGPVPHELGSMAGLQVLLLFLNS  225

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGN  670
            L+G +    +++ +L++  +  NML G IP  +     S+E+L  S N  +G+IP  + N
Sbjct  226  LSGVLPQSLYNLSSLKNFGVEYNMLSGTIPADIGDRFPSIEALSFSGNRFSGAIPPSVSN  285

Query  671  F------------------------YNLSYLDLSMNSL  712
                                       LSYLDL  N L
Sbjct  286  LSALTKLGLARNGFIGHVPPALSKLQGLSYLDLGDNRL  323



>ref|XP_006492015.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
[Citrus sinensis]
Length=1109

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 100/197 (51%), Gaps = 30/197 (15%)
 Frame = +2

Query  206  LLILKQHW-GYPFSLFEQWNST-SSPCDWPGISCNSNG-SVTRISLSEMIMGGSFPASAI  376
            LL L +HW   P  +   WNS+ S+PC W GI C+ +  +V   +LS   + G       
Sbjct  33   LLSLMRHWNSVPPLIISSWNSSDSTPCQWVGIECDDDAHNVVSFNLSSYGVSGQLGPE--  90

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I  L+ L +I+ SSN+  G IP  L +CS LE LDLS N  TG I   F +++ L+ LNL
Sbjct  91   IGHLSKLQTIDLSSNNFSGNIPPKLGNCSALEYLDLSTNGFTGDIPDNFENLQNLQYLNL  150

Query  557  RGNMLFGEIPTPMVAY-------------------------SLESLDVSSNDLNGSIPDD  661
             GN+L GEIP P+                             +E+L + SN L+G+IP+ 
Sbjct  151  YGNLLDGEIPEPLFRILGLQYVFLNNNSLSGSIPRNVGDLKEVEALWLFSNRLSGTIPES  210

Query  662  IGNFYNLSYLDLSMNSL  712
            IGN Y L  L L+ N L
Sbjct  211  IGNCYRLQELYLNENKL  227


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 63/124 (51%), Gaps = 4/124 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + GS P+    C+  NL   + S N L G+IP++L S   L  L LS N  TG I     
Sbjct  562  LEGSLPSQLSKCK--NLEVFDVSFNLLNGSIPSSLRSWKSLSILKLSENHFTGGIPTFIS  619

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLES--LDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
              + L  L L GN L GEIP  + A    S  L++S+N L G IP D+     L  LD+S
Sbjct  620  EFEKLLELQLGGNQLGGEIPPSIGALQELSYALNLSNNGLTGRIPSDLEKLSKLERLDIS  679

Query  701  MNSL  712
             N+L
Sbjct  680  SNNL  683


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 69/137 (50%), Gaps = 3/137 (2%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
             N  ++ + +S   + G+ P+S  I    NL SI+FSSN   G +P  L +   L TL+ 
Sbjct  500  KNPVLSHLDVSRNNISGAIPSS--IGNSINLTSIDFSSNKFSGVVPQELGNLVSLVTLNS  557

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDD  661
            S+N+L G +  +    K L   ++  N+L G IP+ + ++ SL  L +S N   G IP  
Sbjct  558  SLNNLEGSLPSQLSKCKNLEVFDVSFNLLNGSIPSSLRSWKSLSILKLSENHFTGGIPTF  617

Query  662  IGNFYNLSYLDLSMNSL  712
            I  F  L  L L  N L
Sbjct  618  ISEFEKLLELQLGGNQL  634


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 64/129 (50%), Gaps = 2/129 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ISL      G  P S  I   ++L+ ++F +NS  G IP NL    +L  L++  N   G
Sbjct  412  ISLYNNQFSGVIPQSLGIN--SSLMQLDFINNSFTGEIPPNLCFGKQLRVLNMGQNQFHG  469

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
             I     S  TL  + L+ N L G +P       L  LDVS N+++G+IP  IGN  NL+
Sbjct  470  PIPSLLGSCTTLWRVILKQNKLTGALPEFSKNPVLSHLDVSRNNISGAIPSSIGNSINLT  529

Query  686  YLDLSMNSL  712
             +D S N  
Sbjct  530  SIDFSSNKF  538


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 66/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ GS P+S  +    +L  +  S N   G IP  +S   KL  L L  N L G+I    
Sbjct  585  LLNGSIPSS--LRSWKSLSILKLSENHFTGGIPTFISEFEKLLELQLGGNQLGGEIPPSI  642

Query  524  FSMKTLR-SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
             +++ L  +LNL  N L G IP+ +   S LE LD+SSN+L G++   + N ++L  +++
Sbjct  643  GALQELSYALNLSNNGLTGRIPSDLEKLSKLERLDISSNNLTGTL-SSLSNIHSLVEVNV  701

Query  698  SMN  706
            S N
Sbjct  702  SYN  704



>ref|XP_006659458.1| PREDICTED: receptor-like protein kinase-like [Oryza brachyantha]
Length=1111

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 96/171 (56%), Gaps = 4/171 (2%)
 Frame = +2

Query  206  LLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIIC  382
            LL L +    P S+   W  S ++PC W G+SC+    V  + LS   + GS      I 
Sbjct  29   LLALSRDLILPPSISSSWTASDATPCKWTGVSCDKKNDVISLDLSSFGVSGSLGLQ--IG  86

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
             + NL  ++ S+NS+ G+IP +LS+CS L  LDLSIN+ +G+I     ++K L SL+L  
Sbjct  87   FMKNLQVLSLSNNSISGSIPHDLSNCSMLNQLDLSINNFSGEIPASLGNIKKLHSLSLYS  146

Query  563  NMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  +   + LE L +  N+L+GSIP  IG   N+ YL L  N L
Sbjct  147  NSLTGEIPEGLFKNHFLEELYLHFNNLSGSIPSAIGEMTNIRYLWLHSNKL  197


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 65/143 (45%), Gaps = 26/143 (18%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P  A I  L NL  +N S NSL G +P  +S+CS+L  LDLS N L G +     ++K L
Sbjct  534  PIPAEIGDLVNLRVLNLSHNSLQGVLPVQISNCSRLYMLDLSFNSLNGSVLTTVSNLKFL  593

Query  542  RSLNLRGNMLFGEIPTPMVAYSLE--------------------------SLDVSSNDLN  643
              L L+ N   G IP  +    +                           +L++SSN L 
Sbjct  594  SQLRLQENKFSGGIPDSLSQLDMLIELQLGGNILGGCIPSSLGRLIKLGIALNISSNGLV  653

Query  644  GSIPDDIGNFYNLSYLDLSMNSL  712
            G +P  +GN   L  LDLS+N L
Sbjct  654  GDVPPLLGNLMELQSLDLSLNDL  676


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 63/124 (51%), Gaps = 4/124 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++ GS P++ + C    L  I   +N+L G I A   +C+ L  +DLS N L+G I    
Sbjct  459  LLNGSIPSNVVDCP--GLQRIILQNNNLSGPI-AQFRNCANLSYIDLSHNSLSGNIPESL  515

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
                 +  +N  GN LFG IP  +    +L  L++S N L G +P  I N   L  LDLS
Sbjct  516  GRCVNITMINWSGNKLFGPIPAEIGDLVNLRVLNLSHNSLQGVLPVQISNCSRLYMLDLS  575

Query  701  MNSL  712
             NSL
Sbjct  576  FNSL  579


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 0/106 (0%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  I+F++NS  G IP+N+ +  +L  LDL  N L G I         L+ + L+ N L 
Sbjct  426  LTQIDFTNNSFTGGIPSNICAGKRLRVLDLGFNLLNGSIPSNVVDCPGLQRIILQNNNLS  485

Query  575  GEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            G I       +L  +D+S N L+G+IP+ +G   N++ ++ S N L
Sbjct  486  GPIAQFRNCANLSYIDLSHNSLSGNIPESLGRCVNITMINWSGNKL  531


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  I L E    G  P   ++  L  L +I   +N   G IP +L   S+L  +D + N
Sbjct  377  SLESILLYENGFTGRLPP--VLADLKFLQNITLFNNFFSGIIPPDLGVNSRLTQIDFTNN  434

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
              TG I     + K LR L+L  N+L G IP+ +V    L+ + + +N+L+G I     N
Sbjct  435  SFTGGIPSNICAGKRLRVLDLGFNLLNGSIPSNVVDCPGLQRIILQNNNLSGPIA-QFRN  493

Query  671  FYNLSYLDLSMNSL  712
              NLSY+DLS NSL
Sbjct  494  CANLSYIDLSHNSL  507



>ref|XP_002973857.1| hypothetical protein SELMODRAFT_414250 [Selaginella moellendorffii]
 gb|EFJ24812.1| hypothetical protein SELMODRAFT_414250 [Selaginella moellendorffii]
Length=1497

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 93/154 (60%), Gaps = 4/154 (3%)
 Frame = +2

Query  257  WN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWG  433
            W+ S++S C+W GI+CN  G V  ++LS + + G   +S  +  L  L  +N S N L G
Sbjct  59   WDVSSTSLCNWTGIACNPQGRVVSLALSNIPLTGQISSS--LGSLEFLELLNLSYNYLSG  116

Query  434  TIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-L  610
             IP+ L +C++L++LDL++N+L GKI      +  L+SL L  N+L GEIP+ +   S L
Sbjct  117  EIPSTLGNCARLQSLDLTLNNLNGKIPESLGQLSMLQSLILDANLLGGEIPSSLARCSRL  176

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L    N L+G +P  +G   NL+ LDLS NSL
Sbjct  177  QKLSCCCNRLSGQLPSFLGQLRNLTLLDLSHNSL  210


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 76/156 (49%), Gaps = 25/156 (16%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            VT++ LS   + G  P S +   L+ L + + + N+L G IP +LS C  +  +D+ +N+
Sbjct  349  VTKLDLSRNRLTGVIP-SELGRNLSTLTNFDVAFNTLHGEIPVSLSLCVNMSRIDMGVNN  407

Query  497  LTGK------------------------IAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
             TG+                        I  E+F+M  L +L+L  N L+G +P      
Sbjct  408  FTGQLLPEISKLEQLSYFLISTNKLVGTIPVEYFNMANLGTLDLARNNLWGSLPRACNLA  467

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             +  LD+S N L GSIP  +GN  +L  LDLS N +
Sbjct  468  GISKLDLSFNSLTGSIPSCLGNSSSLWTLDLSGNQI  503


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (52%), Gaps = 5/131 (4%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ISL    + G  P     C L    +IN S+N+L G IP ++  CS++  LDLS N LTG
Sbjct  305  ISLRNNNLTGGIPEFGDHCVLE---TINLSTNTLTGEIPESVLHCSQVTKLDLSRNRLTG  361

Query  506  KIAGEF-FSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYN  679
             I  E   ++ TL + ++  N L GEIP  + +  ++  +D+  N+  G +  +I     
Sbjct  362  VIPSELGRNLSTLTNFDVAFNTLHGEIPVSLSLCVNMSRIDMGVNNFTGQLLPEISKLEQ  421

Query  680  LSYLDLSMNSL  712
            LSY  +S N L
Sbjct  422  LSYFLISTNKL  432


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 75/162 (46%), Gaps = 32/162 (20%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPA----------------N  448
            +T + LS   + GS P       L++L  +N   N L G IP                 N
Sbjct  200  LTLLDLSHNSLNGSIPRG--FANLSSLEELNLEGNDLEGEIPTFLLVSKTLVGLHLHANN  257

Query  449  LSSCS-------------KLETLDLSINDLTGKIAGEFFS-MKTLRSLNLRGNMLFGEIP  586
            L S S             ++E L+L  N +TG I  +FFS +  L+ ++LR N L G IP
Sbjct  258  LESFSSEFQEISPENNQGRMEVLELGYNQITGSIPSQFFSYLPGLKFISLRNNNLTGGIP  317

Query  587  TPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                   LE++++S+N L G IP+ + +   ++ LDLS N L
Sbjct  318  EFGDHCVLETINLSTNTLTGEIPESVLHCSQVTKLDLSRNRL  359


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 55/101 (54%), Gaps = 3/101 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            ++GG  P+S   C  + L  ++   N L G +P+ L     L  LDLS N L G I   F
Sbjct  161  LLGGEIPSSLARC--SRLQKLSCCCNRLSGQLPSFLGQLRNLTLLDLSHNSLNGSIPRGF  218

Query  524  FSMKTLRSLNLRGNMLFGEIPT-PMVAYSLESLDVSSNDLN  643
             ++ +L  LNL GN L GEIPT  +V+ +L  L + +N+L 
Sbjct  219  ANLSSLEELNLEGNDLEGEIPTFLLVSKTLVGLHLHANNLE  259


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 61/213 (29%), Positives = 85/213 (40%), Gaps = 62/213 (29%)
 Frame = +2

Query  257  WNSTSSPCDWPGIS---------------CNSNGS-VTRISLSEMIMGGSFPASAIICQL  388
            W S    C+  GIS               C  N S +  + LS   + G  P+S +    
Sbjct  457  WGSLPRACNLAGISKLDLSFNSLTGSIPSCLGNSSSLWTLDLSGNQISGEIPSS-LGANA  515

Query  389  NNLVSINFSSNSLWGTIPANLSSCS--------------------KLETLDLSINDLTGK  508
            + L  ++ S N L G++PA+L +CS                    +L+ +DLS N LTG 
Sbjct  516  SQLYYLDLSQNRLVGSLPASLGNCSSLSILMIHGFIPSCIWSSLPQLKVVDLSQNRLTGN  575

Query  509  IAGEFFSMKTLRSLNLR-------------------GNMLFGEI----PTPMVAY--SLE  613
            I G    + + + +N R                   G M F  I      P   Y   L 
Sbjct  576  IPGSIGELISFKDVNSRPDDPEGWHNIPGLACPECPGGMRFEMIIKGSRLPFAQYFNGLT  635

Query  614  SLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              D+SSN L G+IPDDIG    + YL+LS N L
Sbjct  636  LFDLSSNLLEGAIPDDIGLLVGMKYLNLSFNGL  668


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 66/141 (47%), Gaps = 12/141 (9%)
 Frame = +2

Query  248  FEQWNST-SSPCDW---PGISCNSNGSVTRISLSEMIMGGS-FPASAIICQLNNLVSINF  412
            F+  NS    P  W   PG++C       R    EMI+ GS  P +      N L   + 
Sbjct  586  FKDVNSRPDDPEGWHNIPGLACPECPGGMRF---EMIIKGSRLPFAQY---FNGLTLFDL  639

Query  413  SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
            SSN L G IP ++     ++ L+LS N LTG I      +  L SL+L  N L G IP  
Sbjct  640  SSNLLEGAIPDDIGLLVGMKYLNLSFNGLTGSIPLALTRLVKLESLDLSSNKLQGTIPAQ  699

Query  593  MVAYS-LESLDVSSNDLNGSI  652
            +   S L S +VS N L+G +
Sbjct  700  ISDLSQLGSFNVSHNHLSGMV  720



>gb|EAZ43185.1| hypothetical protein OsJ_27777 [Oryza sativa Japonica Group]
Length=1093

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 88/156 (56%), Gaps = 2/156 (1%)
 Frame = +2

Query  248  FEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNS  424
             + W ++ +SPC W G+SC++ G V  +++  + +GG+ PA++++    +L ++  S  +
Sbjct  55   LDSWRASDASPCRWLGVSCDARGDVVAVTIKTVDLGGALPAASVLPLARSLKTLVLSGTN  114

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G IP  L   ++L TLDL+ N LTG I  E   ++ L+SL L  N L G IP  +   
Sbjct  115  LTGAIPKELGDLAELSTLDLTKNQLTGAIPAELCRLRKLQSLALNSNSLRGAIPDAIGNL  174

Query  605  S-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            + L SL +  N+L+G+IP  IGN   L  L    N 
Sbjct  175  TGLTSLTLYDNELSGAIPASIGNLKKLQVLRAGGNQ  210


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 3/112 (3%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L NL       N L G IPA+L+ C  L++LDLS N+LTG I  E F+++ L  L L  
Sbjct  390  RLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYNNLTGAIPRELFALQNLTKLLLLS  449

Query  563  NMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G IP P +    +L  L ++ N L+G+IP +IGN  NL++LDL  N L
Sbjct  450  NDLAGFIP-PEIGNCTNLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLGGNRL  500


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR-S  547
            A I  L  L  +N   N + G IP  L SC KL+ LDL  N L+G I  E   +  L  S
Sbjct  552  AGIGSLPELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELGKLPFLEIS  611

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            LNL  N L GEIP+       L  LDVS N L+GS+ + +    NL  L++S N+
Sbjct  612  LNLSCNRLSGEIPSQFAGLDKLGCLDVSYNQLSGSL-EPLARLENLVTLNISYNA  665


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 3/124 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T + L +  + G  P    + QL  L ++    N L GTIP  + +C +L  +DLS+N+
Sbjct  274  LTSLYLYQNTLSGGIPPQ--LGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLNE  331

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG I   F  +  L+ L L  N L G IP  +    SL  ++V +N L G+I  D    
Sbjct  332  LTGPIPRSFGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEVDNNQLTGAIGVDFPRL  391

Query  674  YNLS  685
             NL+
Sbjct  392  RNLT  395


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 70/154 (45%), Gaps = 29/154 (19%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SL+E+   G  P S     L NL  +  S+N L G IP  LS+C+ L  +++  N LTG
Sbjct  327  LSLNELT--GPIPRS--FGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEVDNNQLTG  382

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVS------------------  628
             I  +F  ++ L       N L G IP  +     L+SLD+S                  
Sbjct  383  AIGVDFPRLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYNNLTGAIPRELFALQNL  442

Query  629  ------SNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                  SNDL G IP +IGN  NL  L L+ N L
Sbjct  443  TKLLLLSNDLAGFIPPEIGNCTNLYRLRLNGNRL  476


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 66/119 (55%), Gaps = 8/119 (7%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PA+   C  +NL  ++  SN+L GT+P +L     L+ +D+S N LTG +     S+
Sbjct  502  GPLPAAMSGC--DNLEFMDLHSNALTGTLPGDLPR--SLQFVDVSDNRLTGVLGAGIGSL  557

Query  533  KTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              L  LNL  N + G IP  + +   L+ LD+  N L+G IP ++G    L +L++S+N
Sbjct  558  PELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELG---KLPFLEISLN  613


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 1/112 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I    NL  +  + N L GTIPA + +   L  LDL  N LTG +         L  ++L
Sbjct  460  IGNCTNLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLGGNRLTGPLPAAMSGCDNLEFMDL  519

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N L G +P  +   SL+ +DVS N L G +   IG+   L+ L+L  N +
Sbjct  520  HSNALTGTLPGDL-PRSLQFVDVSDNRLTGVLGAGIGSLPELTKLNLGKNRI  570


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (52%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            +L  +  +   + G++PA + +  K++T+ +    LTG I     +   L SL L  N L
Sbjct  225  DLTMLGLAETGISGSLPATIGNLKKIQTIAIYTAMLTGSIPESIGNCTELTSLYLYQNTL  284

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP  +     L+++ +  N L G+IP +IGN   L  +DLS+N L
Sbjct  285  SGGIPPQLGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLNEL  332



>dbj|BAD10022.1| putative receptor protein kinase [Oryza sativa Japonica Group]
Length=1104

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 88/156 (56%), Gaps = 2/156 (1%)
 Frame = +2

Query  248  FEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNS  424
             + W ++ +SPC W G+SC++ G V  +++  + +GG+ PA++++    +L ++  S  +
Sbjct  55   LDSWRASDASPCRWLGVSCDARGDVVAVTIKTVDLGGALPAASVLPLARSLKTLVLSGTN  114

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G IP  L   ++L TLDL+ N LTG I  E   ++ L+SL L  N L G IP  +   
Sbjct  115  LTGAIPKELGDLAELSTLDLTKNQLTGAIPAELCRLRKLQSLALNSNSLRGAIPDAIGNL  174

Query  605  S-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            + L SL +  N+L+G+IP  IGN   L  L    N 
Sbjct  175  TGLTSLTLYDNELSGAIPASIGNLKKLQVLRAGGNQ  210


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            +G  FP      +L NL       N L G IPA+L+ C  L++LDLS N+LTG I  E F
Sbjct  384  IGVDFP------RLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYNNLTGAIPRELF  437

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            +++ L  L L  N L G IP P +    +L  L ++ N L+G+IP +IGN  NL++LDL 
Sbjct  438  ALQNLTKLLLLSNDLAGFIP-PEIGNCTNLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLG  496

Query  701  MNSL  712
             N L
Sbjct  497  GNRL  500


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR-S  547
            A I  L  L  +N   N + G IP  L SC KL+ LDL  N L+G I  E   +  L  S
Sbjct  552  AGIGSLPELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELGKLPFLEIS  611

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            LNL  N L GEIP+       L  LDVS N L+GS+ + +    NL  L++S N+
Sbjct  612  LNLSCNRLSGEIPSQFAGLDKLGCLDVSYNQLSGSL-EPLARLENLVTLNISYNA  665


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 3/124 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T + L +  + G  P    + QL  L ++    N L GTIP  + +C +L  +DLS+N+
Sbjct  274  LTSLYLYQNTLSGGIPPQ--LGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLNE  331

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG I   F  +  L+ L L  N L G IP  +    SL  ++V +N L G+I  D    
Sbjct  332  LTGPIPRSFGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEVDNNQLTGAIGVDFPRL  391

Query  674  YNLS  685
             NL+
Sbjct  392  RNLT  395


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 70/154 (45%), Gaps = 29/154 (19%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SL+E+   G  P S     L NL  +  S+N L G IP  LS+C+ L  +++  N LTG
Sbjct  327  LSLNELT--GPIPRS--FGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEVDNNQLTG  382

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVS------------------  628
             I  +F  ++ L       N L G IP  +     L+SLD+S                  
Sbjct  383  AIGVDFPRLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYNNLTGAIPRELFALQNL  442

Query  629  ------SNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                  SNDL G IP +IGN  NL  L L+ N L
Sbjct  443  TKLLLLSNDLAGFIPPEIGNCTNLYRLRLNGNRL  476


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 66/119 (55%), Gaps = 8/119 (7%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PA+   C  +NL  ++  SN+L GT+P +L     L+ +D+S N LTG +     S+
Sbjct  502  GPLPAAMSGC--DNLEFMDLHSNALTGTLPGDLPR--SLQFVDVSDNRLTGVLGAGIGSL  557

Query  533  KTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              L  LNL  N + G IP  + +   L+ LD+  N L+G IP ++G    L +L++S+N
Sbjct  558  PELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELG---KLPFLEISLN  613


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 1/107 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  + N L GTIPA + +   L  LDL  N LTG +         L  ++L  N L
Sbjct  465  NLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLGGNRLTGPLPAAMSGCDNLEFMDLHSNAL  524

Query  572  FGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G +P  +   SL+ +DVS N L G +   IG+   L+ L+L  N +
Sbjct  525  TGTLPGDL-PRSLQFVDVSDNRLTGVLGAGIGSLPELTKLNLGKNRI  570


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (49%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P     C   +L  +  +   + G++PA + +  K++T+ +    LTG I     
Sbjct  212  LKGPLPPEIGGC--TDLTMLGLAETGISGSLPATIGNLKKIQTIAIYTAMLTGSIPESIG  269

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            +   L SL L  N L G IP  +     L+++ +  N L G+IP +IGN   L  +DLS+
Sbjct  270  NCTELTSLYLYQNTLSGGIPPQLGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSL  329

Query  704  NSL  712
            N L
Sbjct  330  NEL  332



>gb|EAZ07465.1| hypothetical protein OsI_29720 [Oryza sativa Indica Group]
Length=1104

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 88/156 (56%), Gaps = 2/156 (1%)
 Frame = +2

Query  248  FEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNS  424
             + W ++ +SPC W G+SC++ G V  +++  + +GG+ PA++++    +L ++  S  +
Sbjct  55   LDSWRASDASPCRWLGVSCDARGDVVAVTIKTVDLGGALPAASVLPLARSLKTLVLSGTN  114

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G IP  L   ++L TLDL+ N LTG I  E   ++ L+SL L  N L G IP  +   
Sbjct  115  LTGAIPKELGDLAELSTLDLTKNQLTGAIPAELCRLRKLQSLALNSNSLRGAIPDAIGNL  174

Query  605  S-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            + L SL +  N+L+G+IP  IGN   L  L    N 
Sbjct  175  TGLTSLTLYDNELSGAIPASIGNLKKLQVLRAGGNQ  210


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            +G  FP      +L NL       N L G IPA+L+ C  L++LDLS N+LTG I  E F
Sbjct  384  IGVDFP------RLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYNNLTGAIPRELF  437

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            +++ L  L L  N L G IP P +    +L  L ++ N L+G+IP +IGN  NL++LDL 
Sbjct  438  ALQNLTKLLLLSNDLAGFIP-PEIGNCTNLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLG  496

Query  701  MNSL  712
             N L
Sbjct  497  GNRL  500


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR-S  547
            A I  L  L  +N   N + G IP  L SC KL+ LDL  N L+G I  E   +  L  S
Sbjct  552  AGIGSLPELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELGKLPFLEIS  611

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            LNL  N L GEIP+       L  LDVS N L+GS+ + +    NL  L++S N+
Sbjct  612  LNLSCNRLSGEIPSQFAGLDKLGCLDVSYNQLSGSL-EPLARLENLVTLNISYNA  665


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 3/124 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T + L +  + G  P    + QL  L ++    N L GTIP  + +C +L  +DLS+N+
Sbjct  274  LTSLYLYQNTLSGGIPPQ--LGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLNE  331

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG I   F  +  L+ L L  N L G IP  +    SL  ++V +N L G+I  D    
Sbjct  332  LTGPIPRSFGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEVDNNQLTGAIGVDFPRL  391

Query  674  YNLS  685
             NL+
Sbjct  392  RNLT  395


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 70/154 (45%), Gaps = 29/154 (19%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SL+E+   G  P S     L NL  +  S+N L G IP  LS+C+ L  +++  N LTG
Sbjct  327  LSLNELT--GPIPRS--FGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEVDNNQLTG  382

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVS------------------  628
             I  +F  ++ L       N L G IP  +     L+SLD+S                  
Sbjct  383  AIGVDFPRLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYNNLTGAIPRELFALQNL  442

Query  629  ------SNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                  SNDL G IP +IGN  NL  L L+ N L
Sbjct  443  TKLLLLSNDLAGFIPPEIGNCTNLYRLRLNGNRL  476


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 66/119 (55%), Gaps = 8/119 (7%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PA+   C  +NL  ++  SN+L GT+P +L     L+ +D+S N LTG +     S+
Sbjct  502  GPLPAAMSGC--DNLEFMDLHSNALTGTLPGDLPR--SLQFVDVSDNRLTGVLGAGIGSL  557

Query  533  KTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              L  LNL  N + G IP  + +   L+ LD+  N L+G IP ++G    L +L++S+N
Sbjct  558  PELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELG---KLPFLEISLN  613


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 1/107 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +  + N L GTIPA + +   L  LDL  N LTG +         L  ++L  N L
Sbjct  465  NLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLGGNRLTGPLPAAMSGCDNLEFMDLHSNAL  524

Query  572  FGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G +P  +   SL+ +DVS N L G +   IG+   L+ L+L  N +
Sbjct  525  TGTLPGDL-PRSLQFVDVSDNRLTGVLGAGIGSLPELTKLNLGKNRI  570


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (52%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            +L  +  +   + G++PA + +  K++T+ +    LTG I     +   L SL L  N L
Sbjct  225  DLTMLGLAETGISGSLPATIGNLKKIQTIAIYTAMLTGSIPESIGNCTELTSLYLYQNTL  284

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP  +     L+++ +  N L G+IP +IGN   L  +DLS+N L
Sbjct  285  SGGIPPQLGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLNEL  332



>ref|XP_010234069.1| PREDICTED: receptor-like protein kinase HSL1 [Brachypodium distachyon]
Length=1000

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 97/178 (54%), Gaps = 10/178 (6%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSS----PCDWPGISCNSNGSVTRISLSEMIMGGSF  361
            E   LL +++ WG P +L   W   SS     C+W G++CNSNG VT +S +++ +    
Sbjct  25   ELQTLLTIRRDWGSPAAL-SSWKPKSSVHLAHCNWDGVTCNSNGQVTTLSFAKLHIANPI  83

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKT-  538
            PAS  +C+L +L S++ S N+L G  P  L  CS L+ LDLS N L G + G+   + + 
Sbjct  84   PAS--VCRLKHLSSLDLSYNNLTGEFPKVLYGCSTLQYLDLSNNQLAGSLPGDIGKLSSE  141

Query  539  LRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIP-DDIGNFYNLSYLDLSMN  706
            +  LNL  N   G +P+ +  +  L+SL + +N  NGS P   IG    L  L L+ N
Sbjct  142  MLHLNLSANGFIGHVPSAIGGFLKLKSLVLDTNSFNGSYPAAAIGRLVELETLTLASN  199


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 74/145 (51%), Gaps = 26/145 (18%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSN-------------------------SLWGTIPANLSS  457
            GS+PA+AI  +L  L ++  +SN                         +L G IP++LS+
Sbjct  178  GSYPAAAI-GRLVELETLTLASNPFAPGPLPDAFGKLTKLTLLWLSGMNLTGRIPSSLSA  236

Query  458  CSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSND  637
             ++L  LD+++N+L GKI    + ++ L+ L + GN   G I     A S+  LD+SSN 
Sbjct  237  LNELSILDMAMNNLQGKIPVWIWKLQKLQYLYMYGNRFTGGIGPFDAAVSMLQLDLSSNR  296

Query  638  LNGSIPDDIGNFYNLSYLDLSMNSL  712
            L G I D IG+  NLS L L  N +
Sbjct  297  LTGPIHDTIGSMKNLSLLFLYYNDI  321


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 70/133 (53%), Gaps = 7/133 (5%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++RI +      G+ P +A   Q     + +  +N   G +P N++  + L  L+L+ N 
Sbjct  453  ISRIEMDNNRFSGAIPMTAYRLQ-----TFHAQNNLFSGILPPNMTGLANLADLNLARNR  507

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
            L+G I      ++ L  L+L  N + G IPT + +  +L  LD+S N+L G IP D  N 
Sbjct  508  LSGPIPMSVQFLRRLNFLDLSSNKISGPIPTGIGSLPALNVLDLSKNELTGDIPPDFSNL  567

Query  674  YNLSYLDLSMNSL  712
            + +++++LS N L
Sbjct  568  H-INFINLSCNQL  579


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 0/90 (0%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L NL  +N + N L G IP ++    +L  LDLS N ++G I     S+  L  L+L  N
Sbjct  495  LANLADLNLARNRLSGPIPMSVQFLRRLNFLDLSSNKISGPIPTGIGSLPALNVLDLSKN  554

Query  566  MLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
             L G+IP       +  +++S N L G IP
Sbjct  555  ELTGDIPPDFSNLHINFINLSCNQLTGVIP  584



>gb|EYU36356.1| hypothetical protein MIMGU_mgv1a018150mg, partial [Erythranthe 
guttata]
Length=838

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 106/184 (58%), Gaps = 9/184 (5%)
 Frame = +2

Query  170  SLTTYGEDERAILLILKQ-HWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSEM  343
            S+TT   D+ A+L +  Q H   P +    W+  + SPC+W G+SC S   VT + LS +
Sbjct  14   SITT---DKEALLSLKSQFHVEIPNNPLSTWDQQNLSPCNWSGVSC-SEQRVTGLDLSGL  69

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             M GS   S  +  L++L S++  +N L G IP+ +S C  L TL+L  N + G I  E 
Sbjct  70   GMTGSI--SPYLGNLSSLRSLHLQNNQLTGKIPSTISGCRDLTTLELMQNRIWGSIPHEI  127

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
              +  L+ LNL GN L GEIP+ +    SL  L++ +N+L GSIP D+    NL +LDL+
Sbjct  128  SQLMQLQILNLGGNQLSGEIPSSLTNISSLVDLNLGTNNLGGSIPSDLWRLSNLKFLDLT  187

Query  701  MNSL  712
            +N+L
Sbjct  188  INNL  191


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 73/134 (54%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLET-LDLSIN  493
            + +I LS     GS P +     L NL+SI+ S N L G+IP  + +  KL   L+LS N
Sbjct  320  LIKIDLSRNKFVGSVPNT--FTNLQNLISIDLSDNMLNGSIPIEILNLPKLSVFLNLSRN  377

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             LTG I  E  S++ +  +N+  NML G IP+ +    SLE L  + N L+G IPD +G 
Sbjct  378  QLTGSIPVEIGSLENIAVINICDNMLSGSIPSSIGRCKSLEHLSFARNMLSGPIPDTLGL  437

Query  671  FYNLSYLDLSMNSL  712
               L  LDLS N L
Sbjct  438  VRGLETLDLSANQL  451


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 66/124 (53%), Gaps = 4/124 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  PA   I  LN L  +  + N L G IP +L +   L  +DLS N   G +   F 
Sbjct  282  ISGEIPAE--IGLLNELRVLGLAGNKLSGKIPNSLGNLQHLIKIDLSRNKFVGSVPNTFT  339

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLES--LDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            +++ L S++L  NML G IP  ++     S  L++S N L GSIP +IG+  N++ +++ 
Sbjct  340  NLQNLISIDLSDNMLNGSIPIEILNLPKLSVFLNLSRNQLTGSIPVEIGSLENIAVINIC  399

Query  701  MNSL  712
             N L
Sbjct  400  DNML  403


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 80/141 (57%), Gaps = 10/141 (7%)
 Frame = +2

Query  311  GSVTRISLSEMIMGG-----SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLET  475
            G+++++ L+++ MGG     + P+S  I +L  L  +N S  S+ G IPA +   ++L  
Sbjct  242  GNLSKV-LTKLYMGGNDIHGTIPSS--IGELRALDLLNMSYCSISGEIPAEIGLLNELRV  298

Query  476  LDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSI  652
            L L+ N L+GKI     +++ L  ++L  N   G +P       +L S+D+S N LNGSI
Sbjct  299  LGLAGNKLSGKIPNSLGNLQHLIKIDLSRNKFVGSVPNTFTNLQNLISIDLSDNMLNGSI  358

Query  653  PDDIGNFYNLS-YLDLSMNSL  712
            P +I N   LS +L+LS N L
Sbjct  359  PIEILNLPKLSVFLNLSRNQL  379


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 75/142 (53%), Gaps = 22/142 (15%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+S  +  +++LV +N  +N+L G+IP++L   S L+ LDL+IN+L+G +    +
Sbjct  143  LSGEIPSS--LTNISSLVDLNLGTNNLGGSIPSDLWRLSNLKFLDLTINNLSGTVPPSIY  200

Query  527  SMKTLRSLNLRGNMLFGEIP--------------------TPMVAYSLESLDVSSNDLNG  646
            +M +L  + L  N L+GE+P                    T  ++  L  L +  ND++G
Sbjct  201  NMSSLVYVALASNNLWGELPPDIGITLPNLLGLDFCFNKFTGNLSKVLTKLYMGGNDIHG  260

Query  647  SIPDDIGNFYNLSYLDLSMNSL  712
            +IP  IG    L  L++S  S+
Sbjct  261  TIPSSIGELRALDLLNMSYCSI  282


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  I++ + ++ GS P+S   C+  +L  ++F+ N L G IP  L     LETLDLS N 
Sbjct  393  IAVINICDNMLSGSIPSSIGRCK--SLEHLSFARNMLSGPIPDTLGLVRGLETLDLSANQ  450

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFY  676
            L+GKI     ++++L+ LNL  N L GEIP           D+  +D +G     I ++ 
Sbjct  451  LSGKIPLNLQNLQSLQFLNLSFNNLEGEIPAKKTMIE----DLFDDDQSGERKPQIISYK  506

Query  677  NLSY  688
             L +
Sbjct  507  ELCF  510



>ref|XP_008242547.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Prunus mume]
Length=979

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 98/186 (53%), Gaps = 12/186 (6%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW---NSTSSPCDW-PGISCNSNGSVTRIS  331
            SQSL    + E+A+LL LK +   P      W    S +S C W P I+C +N SVT +S
Sbjct  30   SQSLQ---DQEQAVLLKLKSYLQSP-PFLSHWIPSTSNTSHCSWRPEITC-TNNSVTGLS  84

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L    +  + P    IC L NL  I+ S N   G  P    +CSKL+ LDLS N   GKI
Sbjct  85   LVNTNI--TLPVPPFICDLKNLTLIDLSYNYFPGEFPKAFYNCSKLQYLDLSQNYFVGKI  142

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
              +  S++ LR LNL  N   G+IP  +     L +L +  N+ NGS+P +IGN  NL  
Sbjct  143  PDDIDSLRRLRYLNLARNNFSGDIPVAIGRLQELRNLQLCMNEFNGSVPPEIGNLSNLED  202

Query  689  LDLSMN  706
            L+LS N
Sbjct  203  LNLSYN  208


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 0/108 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  L ++    + L G +P  +     LE LDL+IN L+G I    F ++ L  ++L  
Sbjct  222  RLKKLKTLCIRQSYLVGELPGTIGEMEALEELDLAINSLSGTIPSGLFLLENLSIIHLFQ  281

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            N+L G++P  + A +L ++D+S N L G IP+D G    L+ L LS N
Sbjct  282  NILSGDVPQMVEALNLSAIDLSGNYLTGPIPEDYGKLTKLTVLALSYN  329


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (52%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ + +    G+ PA   +    NL   +  +N   GT+P  L+S   L TL L  N 
Sbjct  463  LSRLEIRDNRFSGNIPAG--VSSWTNLQVFDAGNNFFNGTVPQELTSLPSLITLYLDQNK  520

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG +  +  S KTL +LN   N L+G IP    +   L +LD+S N L+G IP  +G  
Sbjct  521  LTGFLPTDIISWKTLYTLNFSRNQLYGPIPAKLGLLPGLAALDLSENQLSGQIPAQLGRL  580

Query  674  YNLSYLDLSMNSL  712
              L+ L+LS N L
Sbjct  581  -KLNNLNLSSNHL  592


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 71/134 (53%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +T ++LS     G  P +  I +L NL++   S+N+L GT+  +    S+LE+ ++S+N
Sbjct  320  KLTVLALSYNDFSGEIPTN--IGRLPNLINFKLSNNNLSGTLHPDFGRYSELESFEVSVN  377

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
             LTGK+         L  L    N L GE+PT +    SL ++ V  N L+G+IP  +  
Sbjct  378  RLTGKLPDNLCYWGKLLGLEAYENNLTGELPTSLGNCSSLSTVKVYDNGLSGNIPSGMWT  437

Query  671  FYNLSYLDLSMNSL  712
              NLS + +S NS 
Sbjct  438  APNLSSVLMSNNSF  451


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 57/114 (50%), Gaps = 4/114 (4%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            I L + I+ G  P    + +  NL +I+ S N L G IP +    +KL  L LS ND +G
Sbjct  277  IHLFQNILSGDVPQ---MVEALNLSAIDLSGNYLTGPIPEDYGKLTKLTVLALSYNDFSG  333

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
            +I      +  L +  L  N L G +      YS LES +VS N L G +PD++
Sbjct  334  EIPTNIGRLPNLINFKLSNNNLSGTLHPDFGRYSELESFEVSVNRLTGKLPDNL  387


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 64/130 (49%), Gaps = 4/130 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + + +  + G  P +  I ++  L  ++ + NSL GTIP+ L     L  + L  N L+G
Sbjct  229  LCIRQSYLVGELPGT--IGEMEALEELDLAINSLSGTIPSGLFLLENLSIIHLFQNILSG  286

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
             +  +      L +++L GN L G IP      + L  L +S ND +G IP +IG   NL
Sbjct  287  DVP-QMVEALNLSAIDLSGNYLTGPIPEDYGKLTKLTVLALSYNDFSGEIPTNIGRLPNL  345

Query  683  SYLDLSMNSL  712
                LS N+L
Sbjct  346  INFKLSNNNL  355



>ref|NP_001062124.1| Os08g0493800 [Oryza sativa Japonica Group]
 dbj|BAF24038.1| Os08g0493800, partial [Oryza sativa Japonica Group]
Length=944

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 88/156 (56%), Gaps = 2/156 (1%)
 Frame = +2

Query  248  FEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNS  424
             + W ++ +SPC W G+SC++ G V  +++  + +GG+ PA++++    +L ++  S  +
Sbjct  55   LDSWRASDASPCRWLGVSCDARGDVVAVTIKTVDLGGALPAASVLPLARSLKTLVLSGTN  114

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G IP  L   ++L TLDL+ N LTG I  E   ++ L+SL L  N L G IP  +   
Sbjct  115  LTGAIPKELGDLAELSTLDLTKNQLTGAIPAELCRLRKLQSLALNSNSLRGAIPDAIGNL  174

Query  605  S-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            + L SL +  N+L+G+IP  IGN   L  L    N 
Sbjct  175  TGLTSLTLYDNELSGAIPASIGNLKKLQVLRAGGNQ  210


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 3/112 (3%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L NL       N L G IPA+L+ C  L++LDLS N+LTG I  E F+++ L  L L  
Sbjct  390  RLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYNNLTGAIPRELFALQNLTKLLLLS  449

Query  563  NMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G IP P +    +L  L ++ N L+G+IP +IGN  NL++LDL  N L
Sbjct  450  NDLAGFIP-PEIGNCTNLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLGGNRL  500


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR-S  547
            A I  L  L  +N   N + G IP  L SC KL+ LDL  N L+G I  E   +  L  S
Sbjct  552  AGIGSLPELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELGKLPFLEIS  611

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            LNL  N L GEIP+       L  LDVS N L+GS+ + +    NL  L++S N+
Sbjct  612  LNLSCNRLSGEIPSQFAGLDKLGCLDVSYNQLSGSL-EPLARLENLVTLNISYNA  665


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 3/124 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T + L +  + G  P    + QL  L ++    N L GTIP  + +C +L  +DLS+N+
Sbjct  274  LTSLYLYQNTLSGGIPPQ--LGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLNE  331

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG I   F  +  L+ L L  N L G IP  +    SL  ++V +N L G+I  D    
Sbjct  332  LTGPIPRSFGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEVDNNQLTGAIGVDFPRL  391

Query  674  YNLS  685
             NL+
Sbjct  392  RNLT  395


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 70/154 (45%), Gaps = 29/154 (19%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SL+E+   G  P S     L NL  +  S+N L G IP  LS+C+ L  +++  N LTG
Sbjct  327  LSLNELT--GPIPRS--FGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEVDNNQLTG  382

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVS------------------  628
             I  +F  ++ L       N L G IP  +     L+SLD+S                  
Sbjct  383  AIGVDFPRLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYNNLTGAIPRELFALQNL  442

Query  629  ------SNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                  SNDL G IP +IGN  NL  L L+ N L
Sbjct  443  TKLLLLSNDLAGFIPPEIGNCTNLYRLRLNGNRL  476


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 66/119 (55%), Gaps = 8/119 (7%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PA+   C  +NL  ++  SN+L GT+P +L     L+ +D+S N LTG +     S+
Sbjct  502  GPLPAAMSGC--DNLEFMDLHSNALTGTLPGDLPR--SLQFVDVSDNRLTGVLGAGIGSL  557

Query  533  KTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              L  LNL  N + G IP  + +   L+ LD+  N L+G IP ++G    L +L++S+N
Sbjct  558  PELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELG---KLPFLEISLN  613


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 1/112 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I    NL  +  + N L GTIPA + +   L  LDL  N LTG +         L  ++L
Sbjct  460  IGNCTNLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLGGNRLTGPLPAAMSGCDNLEFMDL  519

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N L G +P  +   SL+ +DVS N L G +   IG+   L+ L+L  N +
Sbjct  520  HSNALTGTLPGDL-PRSLQFVDVSDNRLTGVLGAGIGSLPELTKLNLGKNRI  570


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (52%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            +L  +  +   + G++PA + +  K++T+ +    LTG I     +   L SL L  N L
Sbjct  225  DLTMLGLAETGISGSLPATIGNLKKIQTIAIYTAMLTGSIPESIGNCTELTSLYLYQNTL  284

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP  +     L+++ +  N L G+IP +IGN   L  +DLS+N L
Sbjct  285  SGGIPPQLGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLNEL  332



>gb|KDO46301.1| hypothetical protein CISIN_1g001275mg [Citrus sinensis]
Length=1109

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 98/173 (57%), Gaps = 6/173 (3%)
 Frame = +2

Query  206  LLILKQHW-GYPFSLFEQWNST-SSPCDWPGISCNSNG-SVTRISLSEMIMGGSFPASAI  376
            LL L +HW   P  +   WNS+ S+PC W GI C+ +  +V   +LS   + G       
Sbjct  33   LLSLMRHWNSVPPLIISSWNSSDSTPCQWVGIECDDDAHNVVSFNLSSYGVSGQLGPE--  90

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I  L+ L +I+ SSN+  G IP  L +CS LE LDLS N  TG I   F +++ L+ LNL
Sbjct  91   IGHLSKLQTIDLSSNNFSGNIPPKLGNCSALEYLDLSTNGFTGDIPDNFENLQNLQYLNL  150

Query  557  RGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GN+L GEIP P+     L+ + +++N L+GSIP ++G+   +  L L  N L
Sbjct  151  YGNLLDGEIPEPLFRILGLQYVFLNNNSLSGSIPRNVGDLKEVEALWLFSNRL  203


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +  NL  ++ S N   G I  NL +CS L  LD+  + LTG I   F  +  L SL+L  
Sbjct  261  KCKNLTFLDLSYNRFSGGISPNLGNCSSLTHLDIVGSKLTGSIPSSFGLLARLSSLDLSE  320

Query  563  NMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G+IP  +     L  L + +N L G IPD++G   NL  L+L  N L
Sbjct  321  NQLSGKIPPELGKCKYLTVLHLYANQLEGEIPDELGQLSNLQDLELFDNRL  371


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 64/129 (50%), Gaps = 2/129 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ISL      G  P S  I   ++L+ ++F +NS  G IP NL    +L  L++  N   G
Sbjct  412  ISLYNNQFSGVIPQSLGIN--SSLMQLDFINNSFTGEIPPNLCFGKQLRVLNMGQNQFHG  469

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
             I     S  TL  + L+ N L G +P       L  LDVS N+++G+IP  IGN  NL+
Sbjct  470  PIPSLLGSCPTLWRVILKQNQLTGALPEFSKNPVLSHLDVSRNNISGAIPSSIGNSINLT  529

Query  686  YLDLSMNSL  712
             +D S N  
Sbjct  530  SIDFSSNKF  538


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  + L+E  + G  P S  +  L NLV ++   N+L G I      C  L  LDLS N 
Sbjct  217  LQELYLNENKLMGFLPES--LSNLENLVYLDVGDNNLEGRINFGSEKCKNLTFLDLSYNR  274

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
             +G I+    +  +L  L++ G+ L G IP+   +   L SLD+S N L+G IP ++G  
Sbjct  275  FSGGISPNLGNCSSLTHLDIVGSKLTGSIPSSFGLLARLSSLDLSENQLSGKIPPELGKC  334

Query  674  YNLSYLDLSMNSL  712
              L+ L L  N L
Sbjct  335  KYLTVLHLYANQL  347


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 69/158 (44%), Gaps = 28/158 (18%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T I  S     G  P    +  L +LV++N S N + G++P+ LS C  LE  D+S N 
Sbjct  528  LTSIDFSSNKFSGLMPQE--LGNLVSLVTLNISLNHVEGSLPSQLSKCKNLEVFDVSFNL  585

Query  497  LTGKIAGEFFSMKTLRSLNLR------------------------GNMLFGEIPTPMVAY  604
            L G I     S K+L  L L                         GN L GEIP  + A 
Sbjct  586  LNGSIPSSLRSWKSLSILKLSENHFTGGIPTFISELEKLLELQLGGNQLGGEIPPSIGAL  645

Query  605  SLES--LDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
               S  L++S N L G IP D+     L  LD+S N+L
Sbjct  646  QDLSYALNLSKNGLTGRIPSDLEKLSKLEQLDISSNNL  683


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 1/107 (1%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  ++   + L G+IP++    ++L +LDLS N L+GKI  E    K L  L+L  N L 
Sbjct  289  LTHLDIVGSKLTGSIPSSFGLLARLSSLDLSENQLSGKIPPELGKCKYLTVLHLYANQLE  348

Query  575  GEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            GEIP  +   S L+ L++  N L G  P  I    +L YL +  N+L
Sbjct  349  GEIPDELGQLSNLQDLELFDNRLTGEFPVSIWRIASLEYLLVYNNNL  395


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 72/162 (44%), Gaps = 28/162 (17%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNS--------------------  424
             N  ++ + +S   + G+ P+S  I    NL SI+FSSN                     
Sbjct  500  KNPVLSHLDVSRNNISGAIPSS--IGNSINLTSIDFSSNKFSGLMPQELGNLVSLVTLNI  557

Query  425  ----LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
                + G++P+ LS C  LE  D+S N L G I     S K+L  L L  N   G IPT 
Sbjct  558  SLNHVEGSLPSQLSKCKNLEVFDVSFNLLNGSIPSSLRSWKSLSILKLSENHFTGGIPTF  617

Query  593  M-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY-LDLSMNSL  712
            +     L  L +  N L G IP  IG   +LSY L+LS N L
Sbjct  618  ISELEKLLELQLGGNQLGGEIPPSIGALQDLSYALNLSKNGL  659



>ref|XP_007204807.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
 gb|EMJ06006.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
Length=1018

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 99/187 (53%), Gaps = 12/187 (6%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW---NSTSSPCDW-PGISCNSNGSVTRIS  331
            SQSL    + E+A+LL LK +   P      W    S +S C W P I+C +N SVT +S
Sbjct  30   SQSLQ---DQEQAVLLKLKSYLQSP-PFLSHWIPSTSNTSHCSWRPEITC-TNNSVTGLS  84

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L  M +  + P    IC L NL  I+ S N   G  P   ++CSKL+ L+LS N   GKI
Sbjct  85   LVNMNI--TLPVPPFICDLKNLTLIDLSYNYFAGEFPKAFNNCSKLQYLNLSQNSFDGKI  142

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
              +  S+  L+ L+L  N   G+IP  +     L +L +  N  NGS+P +IGN  NL +
Sbjct  143  PDDIDSLPRLQYLDLNANYFSGDIPAAIGRLQELRNLQLYMNHFNGSVPPEIGNLSNLKH  202

Query  689  LDLSMNS  709
            L LS N+
Sbjct  203  LSLSFNT  209


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 0/108 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L NL +++   ++L G +P  L   + LE LDL+ N L G I    F +K L  + L  
Sbjct  222  KLKNLKTLHIHGSNLIGELPGTLGEMAALEELDLATNSLNGTIPNGLFLLKNLSIIYLFN  281

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            N L G +P  + A +L  +D+S NDL G IP+D GN   L+ L L +N
Sbjct  282  NSLSGHVPQVVEALNLSIIDISGNDLTGPIPEDYGNLTKLTELALFLN  329


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 74/138 (54%), Gaps = 6/138 (4%)
 Frame = +2

Query  311  GSVTRISLSEMIM---GGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G++T+++   + +    G+ PAS  I +L NL       N+L GT+P +L   S+LE  +
Sbjct  316  GNLTKLTELALFLNGFSGAVPAS--IGRLPNLKQFRVFINNLSGTLPPDLGRYSELEGFE  373

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPD  658
            +S N LTGK+         L +L    N L GE+P+ +    SL  + VS N L+G+IP 
Sbjct  374  VSGNRLTGKLPDHLCYRGKLSTLVAYENNLTGELPSSLGNCTSLTEVKVSDNGLSGNIPS  433

Query  659  DIGNFYNLSYLDLSMNSL  712
             +    NLS + +S NSL
Sbjct  434  GLWTAPNLSQVLMSNNSL  451


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 66/133 (50%), Gaps = 5/133 (4%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +TR+ + +    G+ P         NL   +  +N   GTIP  L++   L TL L  N 
Sbjct  463  LTRLEIRDNRFSGNIPTGVSSW---NLKVFDAGNNLFNGTIPQELTALRSLITLSLDQNQ  519

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG +  E  S ++L  LN   N L G IP  + +   L +LD+S N L+G IP  +G+ 
Sbjct  520  LTGFLPSEIMSWESLNILNFSRNQLSGPIPARLGLLPVLTALDLSENQLSGQIPAQLGHL  579

Query  674  YNLSYLDLSMNSL  712
              LS  +LS N L
Sbjct  580  -KLSNFNLSSNHL  591


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            +  G+ P    +  L +L++++   N L G +P+ + S   L  L+ S N L+G I    
Sbjct  495  LFNGTIPQE--LTALRSLITLSLDQNQLTGFLPSEIMSWESLNILNFSRNQLSGPIPARL  552

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
              +  L +L+L  N L G+IP  +    L + ++SSN L+G IP +  N  Y+ S+LD
Sbjct  553  GLLPVLTALDLSENQLSGQIPAQLGHLKLSNFNLSSNHLSGKIPIEFENPAYDGSFLD  610


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 66/134 (49%), Gaps = 4/134 (3%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
            G ++ +   E  + G  P+S   C   +L  +  S N L G IP+ L +   L  + +S 
Sbjct  391  GKLSTLVAYENNLTGELPSSLGNC--TSLTEVKVSDNGLSGNIPSGLWTAPNLSQVLMSN  448

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
            N LTG++  +    + L  L +R N   G IPT + +++L+  D  +N  NG+IP ++  
Sbjct  449  NSLTGELPEKI--SQNLTRLEIRDNRFSGNIPTGVSSWNLKVFDAGNNLFNGTIPQELTA  506

Query  671  FYNLSYLDLSMNSL  712
              +L  L L  N L
Sbjct  507  LRSLITLSLDQNQL  520



>gb|KCW84032.1| hypothetical protein EUGRSUZ_B00906 [Eucalyptus grandis]
Length=935

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 103/180 (57%), Gaps = 4/180 (2%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T Y E E  +    K   G  F+L   WN T+ PC W GI+C+S GSV  ++LS   + G
Sbjct  22   TRYEEVEALLTWKSKLDSGSRFTL-SSWNGTN-PCSWRGINCDSLGSVASLNLSNSTIHG  79

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            +        +L NL++   ++NS +G IP ++++ +KL  LDLS N+L+G I  +  S++
Sbjct  80   TL-HYLNFSRLPNLIAFTLANNSFFGKIPLSMANLAKLTYLDLSRNNLSGNIPTQLGSLR  138

Query  536  TLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +LR LNL  N L G IP  + + S L  L +S N L G IP +IG   +L+YL ++ N +
Sbjct  139  SLRDLNLSNNYLTGPIPNEIFSLSNLTYLYLSDNKLAGFIPKEIGRLKSLAYLHIANNRI  198


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 60/121 (50%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P    IC    L  I   +N   G IP  L +C+ L  + L  N L G I+    + 
Sbjct  373  GQLPQD--ICSGQVLEKIAADNNHFIGPIPRGLKNCTSLYRVRLQNNHLEGNISDGLGTY  430

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L  L L  N L+GE+P  +  YS L SL +S+  ++G IP ++GN   L  LDLS NS
Sbjct  431  PYLDYLELSNNKLYGELPPRLGEYSNLTSLKISNTRISGVIPFEVGNMSRLHILDLSSNS  490

Query  710  L  712
            L
Sbjct  491  L  491


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 65/110 (59%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L++L  I+ + N+L G+IP     CS+L  L+LS N+L   I  E   +++L+ L+L  N
Sbjct  526  LSDLSRIDVAGNNLTGSIPKQFGDCSRLLFLNLSRNNLDRSIPVEIGKLQSLQVLDLSQN  585

Query  566  MLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L G IP  + +   LE+L++S N L+G I     +  +L+ +D+S N L
Sbjct  586  LLTGGIPRQLGLLQRLEALNLSHNQLSGLIASAFEDMASLTSIDISYNEL  635


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 51/99 (52%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N L G IP  L + S L  +D++ N+LTG I  +F     L  LNL  N L   IP  + 
Sbjct  513  NQLVGYIPRELGTLSDLSRIDVAGNNLTGSIPKQFGDCSRLLFLNLSRNNLDRSIPVEIG  572

Query  599  A-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
               SL+ LD+S N L G IP  +G    L  L+LS N L
Sbjct  573  KLQSLQVLDLSQNLLTGGIPRQLGLLQRLEALNLSHNQL  611


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 62/115 (54%), Gaps = 3/115 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++RI ++   + GS P     C  + L+ +N S N+L  +IP  +     L+ LDLS N 
Sbjct  529  LSRIDVAGNNLTGSIPKQFGDC--SRLLFLNLSRNNLDRSIPVEIGKLQSLQVLDLSQNL  586

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPD  658
            LTG I  +   ++ L +LNL  N L G I +      SL S+D+S N+L G +P+
Sbjct  587  LTGGIPRQLGLLQRLEALNLSHNQLSGLIASAFEDMASLTSIDISYNELGGPLPN  641


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 1/102 (1%)
 Frame = +2

Query  410  FSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT  589
             S N+L G+IP+ + + SKL +L LS N   G++  +  S + L  +    N   G IP 
Sbjct  342  LSGNNLSGSIPSIIGNLSKLISLQLSGNKFVGQLPQDICSGQVLEKIAADNNHFIGPIPR  401

Query  590  PMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             +    SL  + + +N L G+I D +G +  L YL+LS N L
Sbjct  402  GLKNCTSLYRVRLQNNHLEGNISDGLGTYPYLDYLELSNNKL  443



>ref|XP_006470715.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Citrus sinensis]
Length=910

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 89/180 (49%), Gaps = 31/180 (17%)
 Frame = +2

Query  260  NSTSSPCDWPGISCNSNGSVTRISLSEM----------------------------IMGG  355
            N TS  C W GI+CNS GS+  IS  EM                            ++ G
Sbjct  74   NYTSDHCKWMGITCNSAGSIVEISSDEMDNNFTGAELSQLNFTCFPNLVTFRIWGTLLSG  133

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
              P+   I  L+ L  +  S NSL G IP+ + + S+L+ LDLS N LTG I  E  S+K
Sbjct  134  RMPSE--IGALSKLEKLVLSHNSLTGRIPSEIGALSRLKVLDLSYNRLTGTIPSEIGSLK  191

Query  536  TLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L  LNL  N+L G IP        L+ L +  N L+G IP  IGN  NL+YLDLS+N L
Sbjct  192  DLLDLNLSNNILNGSIPLEFGNLKDLDQLRLQGNKLDGLIPLTIGNLTNLTYLDLSLNQL  251


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 71/134 (53%), Gaps = 5/134 (4%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T + LS   + G  P    +  L NL S+   +N L G IP+ L   ++L TL L  N+
Sbjct  241  LTYLDLSLNQLSGRLPQE--VGNLKNLKSLFLDNNHLSGPIPSTLYHLNQLATLCLGYNN  298

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS--LESLDVSSNDLNGSIPDDIGN  670
            L G +  E  +MK L  L+L  N L G IP+  + Y   L+ L +S N L+G IP  IGN
Sbjct  299  LVGPVTKEVGNMKNLDRLHLNRNNLTGSIPS-TIGYLNLLDELHLSHNRLDGPIPPTIGN  357

Query  671  FYNLSYLDLSMNSL  712
              NL  LDLS N L
Sbjct  358  LTNLIALDLSSNQL  371


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 76/154 (49%), Gaps = 29/154 (19%)
 Frame = +2

Query  323  RISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            R+ L+   + GS P++  I  LN L  ++ S N L G IP  + + + L  LDLS N L+
Sbjct  315  RLHLNRNNLTGSIPST--IGYLNLLDELHLSHNRLDGPIPPTIGNLTNLIALDLSSNQLS  372

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--------------------------  604
            G +  E  ++K L SL+L GN+L G IP P + Y                          
Sbjct  373  GLLPREVGNLKYLASLSLNGNILIGPIP-PTIGYLTNLTYLNLGYNRLSSSIPPELMNCS  431

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             L +L +S N L+GSIP +IGN   L  LDLS N
Sbjct  432  QLLNLVLSHNSLSGSIPSEIGNLIFLRQLDLSRN  465


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ++LS  I+ GS P       L +L  +    N L G IP  + + + L  LDLS+N L+G
Sbjct  196  LNLSNNILNGSIPLE--FGNLKDLDQLRLQGNKLDGLIPLTIGNLTNLTYLDLSLNQLSG  253

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNL  682
            ++  E  ++K L+SL L  N L G IP+ +     L +L +  N+L G +  ++GN  NL
Sbjct  254  RLPQEVGNLKNLKSLFLDNNHLSGPIPSTLYHLNQLATLCLGYNNLVGPVTKEVGNMKNL  313

Query  683  SYLDLSMNSL  712
              L L+ N+L
Sbjct  314  DRLHLNRNNL  323


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 64/129 (50%), Gaps = 25/129 (19%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SL+  I+ G  P +  I  L NL  +N   N L  +IP  L +CS+L  L LS N L+G
Sbjct  388  LSLNGNILIGPIPPT--IGYLTNLTYLNLGYNRLSSSIPPELMNCSQLLNLVLSHNSLSG  445

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
             I  E             GN++F           L  LD+S N +NG+IP  +G   N+S
Sbjct  446  SIPSEI------------GNLIF-----------LRQLDLSRNFINGTIPSQLGKIPNIS  482

Query  686  YLDLSMNSL  712
             +DLS N+L
Sbjct  483  AVDLSKNNL  491



>ref|XP_011033023.1| PREDICTED: receptor-like protein kinase isoform X1 [Populus euphratica]
Length=1115

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 103/186 (55%), Gaps = 5/186 (3%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCNSNG-SVTRISLS  337
            + S++    D  A++ +L++    P S+  +WNS+ S+PC W GI C+    SV  ++LS
Sbjct  21   TNSVSGLNNDGLALMSLLRKWDSVPTSITSRWNSSDSTPCSWLGIGCDHRSHSVVSLNLS  80

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
             + + G  P    I QL  L +++ ++N   G IP+ L +CS LE LDLS N LTG I  
Sbjct  81   GLRISG--PLGPEIGQLKQLKTVDLNTNYFSGDIPSQLGNCSLLEYLDLSKNSLTGGIPD  138

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
             F  ++ LR+L L  N L GEIP  +   S L+ L + +N  NGSIP  +GN   L  L 
Sbjct  139  GFKYLQNLRTLILFSNSLSGEIPESLFQDSALQVLYLDTNKFNGSIPRSVGNLNELLQLS  198

Query  695  LSMNSL  712
            L  N L
Sbjct  199  LFGNQL  204


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L+ ++F++N   G IP NL    +L  L++  N L G I  +     TL  L LR N L 
Sbjct  434  LLQLDFTANKFTGEIPPNLCHGKQLRVLNMGRNQLQGSIPSDVGGCLTLWRLILRENNLS  493

Query  575  GEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            G +P       L  +D+S N++ G IP  IGN   L+++ LSMN L
Sbjct  494  GALPEFSENPILYHMDISKNNITGPIPPSIGNCSGLTFIHLSMNKL  539


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 52/99 (53%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-  595
            N L GTIP  L +C  L TL+L  N+L GKI  E   +  L  L L  N L GEIP  + 
Sbjct  322  NRLSGTIPPELGNCKSLVTLNLYTNELEGKIPSELGRLNKLEDLELFNNHLSGEIPISIW  381

Query  596  VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
               SL+ L V +N L+G +P +I +  NL  L L  N  
Sbjct  382  KIASLKYLLVYNNSLSGELPLEITHLKNLKNLSLYNNQF  420


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 66/116 (57%), Gaps = 3/116 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P S  +  LN L+ ++   N L GTIP ++ +C KL++L LS N L+G +     ++
Sbjct  182  GSIPRS--VGNLNELLQLSLFGNQLSGTIPESIGNCRKLQSLSLSDNKLSGSLPEILTNL  239

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
            ++L  L +  N L G IP       +L+ LD+S N  +G +P D+GN  +L+ L +
Sbjct  240  ESLVELFVGHNSLEGRIPLGFGKCKNLKILDLSFNSYSGGLPPDLGNCSSLATLAI  295


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 4/131 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + GS P+    C   NL   +   NSL  ++P++L + + L TL L  N   G
Sbjct  556  VDLSSNQLEGSLPSQLSKCH--NLGKFDVGFNSLNSSVPSSLRNWTSLSTLILKENHFIG  613

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLE-SLDVSSNDLNGSIPDDIGNFYN  679
             I      ++ L  L L GN L GEIP+ + +  SL+ +L++SSN L G +P ++GN   
Sbjct  614  GIPPFLSELEKLTELQLGGNFLGGEIPSWIGSLQSLQYALNLSSNGLFGELPSELGNLIK  673

Query  680  LSYLDLSMNSL  712
            L  L LS N+L
Sbjct  674  LEQLQLSNNNL  684


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 1/105 (1%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  ++ S N++ G IP ++ +CS L  + LS+N LTG I  E  ++  L  ++L  N L 
Sbjct  505  LYHMDISKNNITGPIPPSIGNCSGLTFIHLSMNKLTGFIPSELGNLVNLLVVDLSSNQLE  564

Query  575  GEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            G +P+ +   ++L   DV  N LN S+P  + N+ +LS L L  N
Sbjct  565  GSLPSQLSKCHNLGKFDVGFNSLNSSVPSSLRNWTSLSTLILKEN  609


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SLS+  + GS P   I+  L +LV +    NSL G IP     C  L+ LDLS N  +G
Sbjct  221  LSLSDNKLSGSLPE--ILTNLESLVELFVGHNSLEGRIPLGFGKCKNLKILDLSFNSYSG  278

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNL  682
             +  +  +  +L +L +  + L G IP+       L  LD+S N L+G+IP ++GN  +L
Sbjct  279  GLPPDLGNCSSLATLAIIHSNLIGAIPSSFGQLKKLSLLDLSENRLSGTIPPELGNCKSL  338

Query  683  SYLDLSMNSL  712
              L+L  N L
Sbjct  339  VTLNLYTNEL  348



>emb|CDX94621.1| BnaC07g10370D [Brassica napus]
Length=998

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 99/174 (57%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSN-GSVTRISLSEMIMGGSFPA  367
            E +IL  +K     P S    WN    SPC W G+SC     SVT + LS+  + G FP+
Sbjct  19   EGSILQQVKLSLDDPNSSLSNWNPRDDSPCHWSGVSCGGAFSSVTSVDLSDANLAGPFPS  78

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              +IC+L NL S++  +NS+  T+P ++ +C  L+TLDLS N LTG++      +  L S
Sbjct  79   --LICRLPNLSSLSLYNNSINSTLPLDIGACKTLKTLDLSQNLLTGELPHTLADLPLLTS  136

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN   G+IP     + +LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  137  LDLNGNNFSGDIPASFSRFETLEVLSLVFNLLDGAIPPFLGNITSLKMLNLSYN  190


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + QL  LV ++ + N L G IP +L   + +  ++L  N LTG I
Sbjct  212  LTECNLIGQIPDS--LSQLTKLVDLDLALNDLVGPIPRSLGGLTSVVQIELYNNSLTGTI  269

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G IP  +    LESL++  N+L G +P  I +  NL  L
Sbjct  270  PPELGNLKSLRLLDASMNQLTGSIPDELCRVPLESLNLYENNLEGELPASIASSPNLYEL  329

Query  692  DLSMNSL  712
             +  N L
Sbjct  330  RIFGNRL  336


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I   +N S+  ++ +E    G  P    I  LNNL  
Sbjct  417  WGLPHVYLLELINNSFSGEIAKTIGGAANLSLLILTNNEFT--GGLPEE--IGSLNNLNQ  472

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N L G +P +L +  +L TLDL  N  +G+++ +  S K L  LNL GN   G I
Sbjct  473  LSASGNKLSGFLPESLMNLGELSTLDLQGNRFSGELSPKIKSWKKLNELNLAGNQFSGSI  532

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  +     L+ L+LS N L
Sbjct  533  PNEIGSLSVLNYLDLSGNLFSGEIPVSLQGL-KLNQLNLSNNRL  575


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 3/126 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S   + G  P S  +  L  L +++   N   G +   + S  KL  L+L+ N 
Sbjct  470  LNQLSASGNKLSGFLPES--LMNLGELSTLDLQGNRFSGELSPKIKSWKKLNELNLAGNQ  527

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-F  673
             +G I  E  S+  L  L+L GN+  GEIP  +    L  L++S+N L G IP  +    
Sbjct  528  FSGSIPNEIGSLSVLNYLDLSGNLFSGEIPVSLQGLKLNQLNLSNNRLTGDIPPSLAKEM  587

Query  674  YNLSYL  691
            Y  S+L
Sbjct  588  YKNSFL  593



>emb|CDY26259.1| BnaA06g11580D [Brassica napus]
Length=1079

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 86/154 (56%), Gaps = 4/154 (3%)
 Frame = +2

Query  257  WN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWG  433
            WN S S+PC+W G+ CN  G+VT + LS M + G+   S +IC L+ L  +N S+N + G
Sbjct  25   WNRSDSNPCNWTGVECNRLGTVTSVDLSGMNLSGTL--SPLICNLHGLSYLNVSTNFISG  82

Query  434  TIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SL  610
             IP +LS C  LE LDL  N   G I  +   + TL+ L+L  N LFG IP  +    SL
Sbjct  83   PIPRDLSLCRTLEILDLCTNRFHGVIPIQLTMITTLQKLSLCENYLFGSIPRFIGNMSSL  142

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L++ SN+L G IP  IG    L  +    N L
Sbjct  143  QELEIYSNNLTGVIPSSIGKLRQLRVIRAGRNML  176


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T++ L + ++ G+ P    +  LNNL ++    N L G I A+L     LE L L+ N
Sbjct  429  SLTKLMLGDNMLTGTLPVE--LFNLNNLSALELHQNMLSGNISADLGKLKSLERLRLANN  486

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
            + TG+I  E  ++  +  LN+  N L G IP  +    +++ LD+S N  +G I +++G 
Sbjct  487  NFTGEIPPEIKNLTKIVGLNISSNHLTGHIPRELGSCVTIQRLDLSGNKFSGEIAEELGQ  546

Query  671  FYNLSYLDLSMNSL  712
              NL  L LS N L
Sbjct  547  LVNLEILKLSDNRL  560


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 70/132 (53%), Gaps = 3/132 (2%)
 Frame = +2

Query  320  TRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDL  499
            T + +S   + GS PA    C+   L+ ++  SN L G IP +L++C  L  L L  N L
Sbjct  383  TVLDMSANNLSGSIPAH--FCRFQKLILLSLGSNKLSGNIPRDLTTCKSLTKLMLGDNML  440

Query  500  TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFY  676
            TG +  E F++  L +L L  NML G I   +    SLE L +++N+  G IP +I N  
Sbjct  441  TGTLPVELFNLNNLSALELHQNMLSGNISADLGKLKSLERLRLANNNFTGEIPPEIKNLT  500

Query  677  NLSYLDLSMNSL  712
             +  L++S N L
Sbjct  501  KIVGLNISSNHL  512


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 73/148 (49%), Gaps = 10/148 (7%)
 Frame = +2

Query  275  PCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLS  454
            PC+   ++         I  SE  + G  P    + Q+ NL  ++   N+L G IP  L 
Sbjct  277  PCEIGNLT-----DAVEIDFSENQLTGYIPRE--LGQVLNLKLLHLFENNLQGVIPRELG  329

Query  455  SCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVS  628
              S L+ LDLSIN LTG I  E   + +L  L L  N L G IP P++ Y  +   LD+S
Sbjct  330  ELSLLQKLDLSINRLTGTIPQELQLLTSLVDLQLFDNNLEGTIP-PLIGYYSNFTVLDMS  388

Query  629  SNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +N+L+GSIP     F  L  L L  N L
Sbjct  389  ANNLSGSIPAHFCRFQKLILLSLGSNKL  416


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 72/159 (45%), Gaps = 28/159 (18%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ L+     G  P    I  L  +V +N SSN L G IP  L SC  ++ LDLS N
Sbjct  477  SLERLRLANNNFTGEIPPE--IKNLTKIVGLNISSNHLTGHIPRELGSCVTIQRLDLSGN  534

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIP----------------------TPMVAYS  607
              +G+IA E   +  L  L L  N L GEIP                       P+    
Sbjct  535  KFSGEIAEELGQLVNLEILKLSDNRLTGEIPHSFGDLTRLMELQLGGNLLSGNIPLELGK  594

Query  608  LESLDV----SSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L SL +    S N+L+G+IPD +GN   L  L L+ N L
Sbjct  595  LTSLQISLNMSHNNLSGAIPDSLGNLQMLEILYLNDNKL  633


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +2

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            SA + +L +L  +  ++N+  G IP  + + +K+  L++S N LTG I  E  S  T++ 
Sbjct  469  SADLGKLKSLERLRLANNNFTGEIPPEIKNLTKIVGLNISSNHLTGHIPRELGSCVTIQR  528

Query  548  LNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+L GN   GEI   +    +LE L +S N L G IP   G+   L  L L  N L
Sbjct  529  LDLSGNKFSGEIAEELGQLVNLEILKLSDNRLTGEIPHSFGDLTRLMELQLGGNLL  584


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++ LS   + G+ P    +  L +LV +    N+L GTIP  +   S    LD+S N+
Sbjct  334  LQKLDLSINRLTGTIPQELQL--LTSLVDLQLFDNNLEGTIPPLIGYYSNFTVLDMSANN  391

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNF  673
            L+G I   F   + L  L+L  N L G IP  +    SL  L +  N L G++P ++ N 
Sbjct  392  LSGSIPAHFCRFQKLILLSLGSNKLSGNIPRDLTTCKSLTKLMLGDNMLTGTLPVELFNL  451

Query  674  YNLSYLDLSMNSL  712
             NLS L+L  N L
Sbjct  452  NNLSALELHQNML  464


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+S  +  + +L  +    N   GTIP  +     ++ L L  N LTG+I  E  
Sbjct  224  LSGEIPSS--VGNITSLQVLALHENYFTGTIPREIGKLVNIKRLYLYTNQLTGEIPCEIG  281

Query  527  SMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            ++     ++   N L G IP  +    +L+ L +  N+L G IP ++G    L  LDLS+
Sbjct  282  NLTDAVEIDFSENQLTGYIPRELGQVLNLKLLHLFENNLQGVIPRELGELSLLQKLDLSI  341

Query  704  NSL  712
            N L
Sbjct  342  NRL  344



>ref|XP_011033024.1| PREDICTED: receptor-like protein kinase isoform X2 [Populus euphratica]
Length=1115

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 103/186 (55%), Gaps = 5/186 (3%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCNSNG-SVTRISLS  337
            + S++    D  A++ +L++    P S+  +WNS+ S+PC W GI C+    SV  ++LS
Sbjct  21   TNSVSGLNNDGLALMSLLRKWDSVPTSITSRWNSSDSTPCSWLGIGCDHRSHSVVSLNLS  80

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
             + + G  P    I QL  L +++ ++N   G IP+ L +CS LE LDLS N LTG I  
Sbjct  81   GLRISG--PLGPEIGQLKQLKTVDLNTNYFSGDIPSQLGNCSLLEYLDLSKNSLTGGIPD  138

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLD  694
             F  ++ LR+L L  N L GEIP  +   S L+ L + +N  NGSIP  +GN   L  L 
Sbjct  139  GFKYLQNLRTLILFSNSLSGEIPESLFQDSALQVLYLDTNKFNGSIPRSVGNLNELLQLS  198

Query  695  LSMNSL  712
            L  N L
Sbjct  199  LFGNQL  204


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L+ ++F++N   G IP NL    +L  L++  N L G I  +     TL  L LR N L 
Sbjct  434  LLQLDFTANKFTGEIPPNLCHGKQLRVLNMGRNQLQGSIPSDVGGCLTLWRLILRENNLS  493

Query  575  GEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            G +P       L  +D+S N++ G IP  IGN   L+++ LSMN L
Sbjct  494  GALPEFSENPILYHMDISKNNITGPIPPSIGNCSGLTFIHLSMNKL  539


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 52/99 (53%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-  595
            N L GTIP  L +C  L TL+L  N+L GKI  E   +  L  L L  N L GEIP  + 
Sbjct  322  NRLSGTIPPELGNCKSLVTLNLYTNELEGKIPSELGRLNKLEDLELFNNHLSGEIPISIW  381

Query  596  VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
               SL+ L V +N L+G +P +I +  NL  L L  N  
Sbjct  382  KIASLKYLLVYNNSLSGELPLEITHLKNLKNLSLYNNQF  420


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 65/114 (57%), Gaps = 3/114 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P S  +  LN L+ ++   N L GTIP ++ +C KL++L LS N L+G +     ++
Sbjct  182  GSIPRS--VGNLNELLQLSLFGNQLSGTIPESIGNCRKLQSLSLSDNKLSGSLPEILTNL  239

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
            ++L  L +  N L G IP       +L+ LD+S N  +G +P D+GN  +L+ L
Sbjct  240  ESLVELFVGHNSLEGRIPLGFGKCKNLKILDLSFNSYSGGLPPDLGNCSSLATL  293


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 4/131 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + GS P+    C   NL   +   NSL  ++P++L + + L TL L  N   G
Sbjct  556  VDLSSNQLEGSLPSQLSKCH--NLGKFDVGFNSLNSSVPSSLRNWTSLSTLILKENHFIG  613

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLE-SLDVSSNDLNGSIPDDIGNFYN  679
             I      ++ L  L L GN L GEIP+ + +  SL+ +L++SSN L G +P ++GN   
Sbjct  614  GIPPFLSELEKLTELQLGGNFLGGEIPSWIGSLQSLQYALNLSSNGLFGELPSELGNLIK  673

Query  680  LSYLDLSMNSL  712
            L  L LS N+L
Sbjct  674  LEQLQLSNNNL  684


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 1/105 (1%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  ++ S N++ G IP ++ +CS L  + LS+N LTG I  E  ++  L  ++L  N L 
Sbjct  505  LYHMDISKNNITGPIPPSIGNCSGLTFIHLSMNKLTGFIPSELGNLVNLLVVDLSSNQLE  564

Query  575  GEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            G +P+ +   ++L   DV  N LN S+P  + N+ +LS L L  N
Sbjct  565  GSLPSQLSKCHNLGKFDVGFNSLNSSVPSSLRNWTSLSTLILKEN  609


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SLS+  + GS P   I+  L +LV +    NSL G IP     C  L+ LDLS N  +G
Sbjct  221  LSLSDNKLSGSLPE--ILTNLESLVELFVGHNSLEGRIPLGFGKCKNLKILDLSFNSYSG  278

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNL  682
             +  +  +  +L +L +  + L G IP+       L  LD+S N L+G+IP ++GN  +L
Sbjct  279  GLPPDLGNCSSLATLAIIHSNLIGAIPSSFGQLKKLSLLDLSENRLSGTIPPELGNCKSL  338

Query  683  SYLDLSMNSL  712
              L+L  N L
Sbjct  339  VTLNLYTNEL  348



>ref|XP_010655181.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Vitis 
vinifera]
Length=1523

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 102/204 (50%), Gaps = 26/204 (13%)
 Frame = +2

Query  179  TYG-EDERAILLILKQHW-GYPFSLFEQWNSTSSPCDWPGISC-NSNGSVTRISLSEMIM  349
            T+G E ++  LL +K H    P  +   WN +   C W G++C      VT + L    +
Sbjct  499  TFGNETDKLALLTIKHHLVDVPKGVLSSWNDSLHFCQWQGVTCSRRRQRVTALRLEGQSL  558

Query  350  GGSFPASAIICQLNNLV---------------------SINFSSNSLWGTIPANLSSCSK  466
            GGS P    +  L  LV                      +N S+NSL G IP  L++CS 
Sbjct  559  GGSLPPIGNLTFLRELVLSNNLLHGTIPSDIGLLRRMRHLNLSTNSLQGEIPIELTNCSN  618

Query  467  LETLDLSINDLTGKIAGEFFSMKT-LRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDL  640
            LET+DL+ N+LTG+I     +M T L  L L GN L G IP+ +    SL+ L VS N L
Sbjct  619  LETVDLTRNNLTGQIPFRVGNMSTKLLVLRLGGNGLTGVIPSTLGNLSSLQHLSVSFNHL  678

Query  641  NGSIPDDIGNFYNLSYLDLSMNSL  712
             GSIP D+G   +L  L LS+N+L
Sbjct  679  EGSIPHDLGRLKSLKILYLSVNNL  702


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 63/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  353   GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
             GS PA   + QL NL  +  S N L G IP  L SC  LE LD++ N   G I   F S+
Sbjct  977   GSLPAD--VGQLKNLNELLVSDNKLSGEIPTELGSCLVLEYLDMARNSFQGNIPLSFSSL  1034

Query  533   KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             + ++ L+L  N L G IP  +    L SL++S N L G +P   G F N+S + ++ N
Sbjct  1035  RGIQFLDLSCNNLSGRIPNELEDLGLLSLNLSYNYLEGEVPSG-GVFKNVSGISITGN  1091


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 62/122 (51%), Gaps = 4/122 (3%)
 Frame = +2

Query  353   GSFPASAIICQLNNLVSINFSSNSLWGTIPAN-LSSCSKLETLDLSINDLTGKIAGEFFS  529
             G+ P S   CQ  N+  +    N L G +P N +   ++L +L L  N  TG +  +   
Sbjct  928   GNIPTSLRNCQ--NMEILLLDHNKLSGGVPENVIGHFNQLRSLYLQQNTFTGSLPADVGQ  985

Query  530   MKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             +K L  L +  N L GEIPT + +   LE LD++ N   G+IP    +   + +LDLS N
Sbjct  986   LKNLNELLVSDNKLSGEIPTELGSCLVLEYLDMARNSFQGNIPLSFSSLRGIQFLDLSCN  1045

Query  707   SL  712
             +L
Sbjct  1046  NL  1047


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 73/165 (44%), Gaps = 33/165 (20%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            SV   ++++ I+ G+F  S +      L  +  + N   G IP  LS+ S LE LDL  N
Sbjct  715  SVIEFAVTDNILSGNF-LSTMRFSFPQLRKLGIALNQFTGIIPDTLSNISGLELLDLGPN  773

Query  494  DLTGKIAGEFFSMK------------------------------TLRSLNLRGNMLFGEI  583
             LTG++      +K                              +LR+++L  N   G +
Sbjct  774  YLTGQVPDSLGVLKDLYWLNVESNNLGRGTSGDLNFLNSLTNISSLRTISLYQNNFGGVL  833

Query  584  PTPMVAYS--LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  +V  S  L++L +  N + G+IP++IGN  NL+  D   N L
Sbjct  834  PNSIVNLSTQLQALHLGENKIFGNIPEEIGNLINLTTFDAGQNYL  878


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 68/151 (45%), Gaps = 29/151 (19%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKI--  511
            +GG+     I   L NL S+     S N L G+IP +L     L+ L LS+N+L+G I  
Sbjct  649  LGGNGLTGVIPSTLGNLSSLQHLSVSFNHLEGSIPHDLGRLKSLKILYLSVNNLSGTIPP  708

Query  512  ------------------AGEF-----FSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESL  619
                              +G F     FS   LR L +  N   G IP  +   S LE L
Sbjct  709  SLYNLSSVIEFAVTDNILSGNFLSTMRFSFPQLRKLGIALNQFTGIIPDTLSNISGLELL  768

Query  620  DVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            D+  N L G +PD +G   +L +L++  N+L
Sbjct  769  DLGPNYLTGQVPDSLGVLKDLYWLNVESNNL  799



>gb|KDO36824.1| hypothetical protein CISIN_1g037538mg, partial [Citrus sinensis]
Length=461

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 99/188 (53%), Gaps = 6/188 (3%)
 Frame = +2

Query  161  YSQSLTTYG-EDERAILLILKQHWGY-PFSLFEQWNSTSSPCDWPGISCN-SNGSVTRIS  331
            YS++L +   E ++  LL  K H    P  +   WN +   C+W G++C+ SNG VT + 
Sbjct  25   YSKNLESATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLK  84

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L    + GS PAS  I  L NL  IN   N   G IP  +    KL+ L+L+ N L+GKI
Sbjct  85   LESKQLVGSIPAS--IGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKI  142

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSY  688
                     LRS     N   G+IP  +++ + LE + + +++L G+IP  +GNF +L  
Sbjct  143  PTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQV  202

Query  689  LDLSMNSL  712
            L L+ N+L
Sbjct  203  LLLARNNL  210


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (53%), Gaps = 3/108 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            +M G+ P    I  L NL  +    N+L G++P  +   +KLE L+L+ N  +G +    
Sbjct  356  LMHGNIPVG--IENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSL  413

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDI  664
             ++  L  L +  N   G IP  +     L+ L++SSN+LNG+IP ++
Sbjct  414  GNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIPKEV  461



>ref|XP_010045705.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1048

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 103/180 (57%), Gaps = 4/180 (2%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T Y E E  +    K   G  F+L   WN T+ PC W GI+C+S GSV  ++LS   + G
Sbjct  45   TRYEEVEALLTWKSKLDSGSRFTL-SSWNGTN-PCSWRGINCDSLGSVASLNLSNSTIHG  102

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            +        +L NL++   ++NS +G IP ++++ +KL  LDLS N+L+G I  +  S++
Sbjct  103  TL-HYLNFSRLPNLIAFTLANNSFFGKIPLSMANLAKLTYLDLSRNNLSGNIPTQLGSLR  161

Query  536  TLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +LR LNL  N L G IP  + + S L  L +S N L G IP +IG   +L+YL ++ N +
Sbjct  162  SLRDLNLSNNYLTGPIPNEIFSLSNLTYLYLSDNKLAGFIPKEIGRLKSLAYLHIANNRI  221


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 60/121 (50%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P    IC    L  I   +N   G IP  L +C+ L  + L  N L G I+    + 
Sbjct  384  GQLPQD--ICSGQVLEKIAADNNHFIGPIPRGLKNCTSLYRVRLQNNHLEGNISDGLGTY  441

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L  L L  N L+GE+P  +  YS L SL +S+  ++G IP ++GN   L  LDLS NS
Sbjct  442  PYLDYLELSNNKLYGELPPRLGEYSNLTSLKISNTRISGVIPFEVGNMSRLHILDLSSNS  501

Query  710  L  712
            L
Sbjct  502  L  502


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 65/110 (59%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L++L  I+ + N+L G+IP     CS+L  L+LS N+L   I  E   +++L+ L+L  N
Sbjct  537  LSDLSRIDVAGNNLTGSIPKQFGDCSRLLFLNLSRNNLDRSIPVEIGKLQSLQVLDLSQN  596

Query  566  MLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L G IP  + +   LE+L++S N L+G I     +  +L+ +D+S N L
Sbjct  597  LLTGGIPRQLGLLQRLEALNLSHNQLSGLIASAFEDMASLTSIDISYNEL  646


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 51/99 (52%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N L G IP  L + S L  +D++ N+LTG I  +F     L  LNL  N L   IP  + 
Sbjct  524  NQLVGYIPRELGTLSDLSRIDVAGNNLTGSIPKQFGDCSRLLFLNLSRNNLDRSIPVEIG  583

Query  599  A-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
               SL+ LD+S N L G IP  +G    L  L+LS N L
Sbjct  584  KLQSLQVLDLSQNLLTGGIPRQLGLLQRLEALNLSHNQL  622


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 62/115 (54%), Gaps = 3/115 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++RI ++   + GS P     C  + L+ +N S N+L  +IP  +     L+ LDLS N 
Sbjct  540  LSRIDVAGNNLTGSIPKQFGDC--SRLLFLNLSRNNLDRSIPVEIGKLQSLQVLDLSQNL  597

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPD  658
            LTG I  +   ++ L +LNL  N L G I +      SL S+D+S N+L G +P+
Sbjct  598  LTGGIPRQLGLLQRLEALNLSHNQLSGLIASAFEDMASLTSIDISYNELGGPLPN  652



>ref|XP_004505098.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1000

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 92/160 (58%), Gaps = 4/160 (3%)
 Frame = +2

Query  236  PFSLFEQWNST-SSPCDWPGISCNS-NGSVTRISLSEMIMGGSFPASAIICQLNNLVSIN  409
            P S    WN T ++PC+W G+ C+S N SVT + LS+  + G F AS I+C+L NL SIN
Sbjct  41   PDSRLSSWNPTDTTPCNWYGVRCDSTNTSVTELDLSDTNIQGPFTAS-ILCRLPNLSSIN  99

Query  410  FSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT  589
            F +NS+  T P  ++ C+ L  LDLS N LTG +      +  LR L+L GN   G IP 
Sbjct  100  FFNNSINQTFPLKINLCNNLVHLDLSQNLLTGPLPETLSLLPNLRYLDLTGNNFSGPIPF  159

Query  590  PMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
                +  LE L + SN L G+IP  +GN   L  L+LS N
Sbjct  160  SFGTFQKLEVLSLVSNLLEGTIPPSLGNLTTLKMLNLSYN  199


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 2/118 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +   S  + +  GS P S  I  L  L  ++F +N L G +P  + S  KL  L+L+ N+
Sbjct  479  LVEFSAGDNMFTGSLPDS--IVNLGQLGILDFHNNKLSGEMPKGIGSWKKLNDLNLANNE  536

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
            + GKI  E  S+  L  L+L  N   G+IP  +    L  L++S N L+G +P  +  
Sbjct  537  IGGKIPDEIGSLSVLNFLDLSKNQFSGKIPHGLQNLKLNQLNLSYNRLSGELPPQLAK  594


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 70/135 (52%), Gaps = 4/135 (3%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
            G+++ + LSE    G+ P    I  + NLV  +   N   G++P ++ +  +L  LD   
Sbjct  453  GNLSLLILSENNFSGTVPDE--IGWVENLVEFSAGDNMFTGSLPDSIVNLGQLGILDFHN  510

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIG  667
            N L+G++     S K L  LNL  N + G+IP  + + S L  LD+S N  +G IP  + 
Sbjct  511  NKLSGEMPKGIGSWKKLNDLNLANNEIGGKIPDEIGSLSVLNFLDLSKNQFSGKIPHGLQ  570

Query  668  NFYNLSYLDLSMNSL  712
            N   L+ L+LS N L
Sbjct  571  NL-KLNQLNLSYNRL  584


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 54/98 (55%), Gaps = 0/98 (0%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N L+G+IP++L+  + L  ++L  N L+G++     ++ +LR L+   N L G IP  + 
Sbjct  248  NDLYGSIPSSLTELTSLRQIELYNNSLSGELPRGMGNLTSLRLLDASMNHLTGSIPVELC  307

Query  599  AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +  LESL++  N   G +P  I +  NL  L L  N L
Sbjct  308  SLPLESLNLYENRFEGELPASIADSPNLYELRLFGNRL  345


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +2

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ SSN  WG+IPA+L    +LE L +  N  TG+I     + ++L  + L  N   GE+
Sbjct  362  LDVSSNQFWGSIPASLCDLGELEELLMIYNLFTGEIPASLGTCQSLTRVRLGYNRFSGEV  421

Query  584  PTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  +     +  L+++ N   GSI   I    NLS L LS N+ 
Sbjct  422  PAGIWGLPHVNLLELAHNSFTGSISKTIAGAGNLSLLILSENNF  465


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (50%), Gaps = 3/111 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS PAS  +C L  L  +    N   G IPA+L +C  L  + L  N  +G++    + +
Sbjct  371  GSIPAS--LCDLGELEELLMIYNLFTGEIPASLGTCQSLTRVRLGYNRFSGEVPAGIWGL  428

Query  533  KTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNL  682
              +  L L  N   G I   +  A +L  L +S N+ +G++PD+IG   NL
Sbjct  429  PHVNLLELAHNSFTGSISKTIAGAGNLSLLILSENNFSGTVPDEIGWVENL  479



>gb|KDO44090.1| hypothetical protein CISIN_1g001274mg [Citrus sinensis]
Length=1109

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 93/176 (53%), Gaps = 5/176 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            +E   LL  K     P +  E WNS+  +PC+W G+ C ++  VT + L  + + G    
Sbjct  32   EEGVSLLEFKASLIDPSNNLESWNSSDMTPCNWIGVEC-TDFKVTSVDLHGLNLSGIL--  88

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S  IC L  LV  N S N + G+IP +L++CS LE LDL  N L G I  + F + TLR 
Sbjct  89   SPRICDLPRLVEFNISMNFVTGSIPTDLANCSSLEILDLCTNRLHGVIPFQLFFINTLRK  148

Query  548  LNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N +FGEIP  +    SLE L + SN+L G+IP  I     L  +    NSL
Sbjct  149  LYLCENYIFGEIPEEIGNLTSLEELVIYSNNLTGAIPASISKLRQLRVIRAGHNSL  204


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 76/144 (53%), Gaps = 7/144 (5%)
 Frame = +2

Query  287  PGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSK  466
            P I  NS+ SV  +S++ +   GS P    +C    L+ ++  SN L G IP  L +C  
Sbjct  402  PHIGVNSHLSVLDVSMNNL--DGSIPPH--LCMYQKLIFLSLGSNRLSGNIPPGLKTCRS  457

Query  467  LETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDL  640
            L  L L  N LTG +  EF++++ L +L L  N   G IP P +    +LE L +S N  
Sbjct  458  LMQLMLGQNQLTGSLPIEFYNLQNLSALELYQNRFSGLIP-PEIGKLRNLERLHLSENYF  516

Query  641  NGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP ++GN  +L   ++S NSL
Sbjct  517  VGYIPSEVGNLEHLVTFNISSNSL  540


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    +  + NL  +    N L G+IP  L   ++L  LDLSIN
Sbjct  313  SAVEIDLSENQLTGFIPRE--LGLIPNLCLLQLFENMLQGSIPRELGQLTQLHKLDLSIN  370

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  EF ++  L  L L  N L G IP  + V   L  LDVS N+L+GSIP  +  
Sbjct  371  NLTGTIPLEFQNLTYLVDLQLFDNHLEGTIPPHIGVNSHLSVLDVSMNNLDGSIPPHLCM  430

Query  671  FYNLSYLDLSMNSL  712
            +  L +L L  N L
Sbjct  431  YQKLIFLSLGSNRL  444


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LSE    G  P+   +  L +LV+ N SSNSL GTIP  L +C  L+ LDLS N 
Sbjct  506  LERLHLSENYFVGYIPSE--VGNLEHLVTFNISSNSLSGTIPHELGNCVNLQRLDLSRNQ  563

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
             TG    E   +  L  L L  N L G IP+ +   + L  L +  N  +GSIP  +G  
Sbjct  564  FTGSAPEELGQLVNLELLKLSDNKLTGAIPSSLGGLARLTELQMGGNIFSGSIPVALGQL  623

Query  674  YNLSY-LDLSMNSL  712
              L   L++S N+L
Sbjct  624  TALQIALNISHNNL  637


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 66/135 (49%), Gaps = 10/135 (7%)
 Frame = +2

Query  329  SLSEMI-----MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            SL E++     + G+ PAS  I +L  L  I    NSL G IP  +S C  LE L L+ N
Sbjct  169  SLEELVIYSNNLTGAIPAS--ISKLRQLRVIRAGHNSLSGPIPPEISECEGLEVLGLAQN  226

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIG  667
             L G +  E   ++ L  L L  N L GEIP P +    SLE L +  N  +G +P ++G
Sbjct  227  SLEGFLPSELEKLRNLTDLILWQNHLSGEIP-PTIGNIQSLELLALHENSFSGGLPKELG  285

Query  668  NFYNLSYLDLSMNSL  712
                L  L +  N L
Sbjct  286  KLSRLKKLYVYTNEL  300


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 7/132 (5%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  ++L E    G  P    + +L+ L  +   +N L GTIP  L +C+    +DLS N
Sbjct  265  SLELLALHENSFSGGLPKE--LGKLSRLKKLYVYTNELNGTIPHELGNCTSAVEIDLSEN  322

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I  E   +  L  L L  NML G IP  +   + L  LD+S N+L G+IP +   
Sbjct  323  QLTGFIPRELGLIPNLCLLQLFENMLQGSIPRELGQLTQLHKLDLSINNLTGTIPLE---  379

Query  671  FYNLSYL-DLSM  703
            F NL+YL DL +
Sbjct  380  FQNLTYLVDLQL  391



>ref|XP_006478014.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230-like [Citrus sinensis]
Length=1109

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 93/176 (53%), Gaps = 5/176 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            +E   LL  K     P +  E WNS+  +PC+W G+ C ++  VT + L  + + G    
Sbjct  32   EEGVSLLEFKASLIDPSNNLESWNSSDMTPCNWIGVEC-TDFKVTSVDLHGLNLSGIL--  88

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S  IC L  LV  N S N + G+IP +L++CS LE LDL  N L G I  + F + TLR 
Sbjct  89   SPRICDLPRLVEFNISMNFVTGSIPTDLANCSSLEILDLCTNRLHGVIPFQLFFINTLRK  148

Query  548  LNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N +FGEIP  +    SLE L + SN+L G+IP  I     L  +    NSL
Sbjct  149  LYLCENYIFGEIPEEIGNLTSLEELVIYSNNLTGAIPASISKLRQLRVIRAGHNSL  204


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 76/144 (53%), Gaps = 7/144 (5%)
 Frame = +2

Query  287  PGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSK  466
            P I  NS+ SV  +S++ +   GS P    +C    L+ ++  SN L G IP  L +C  
Sbjct  402  PHIGVNSHLSVLDVSMNNL--DGSIPPH--LCMYQKLIFLSLGSNRLSGNIPPGLKTCRS  457

Query  467  LETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDL  640
            L  L L  N LTG +  EF++++ L +L L  N   G IP P +    +LE L +S N  
Sbjct  458  LMQLMLGQNQLTGSLPIEFYNLQNLSALELYQNRFSGLIP-PEIGKLRNLERLHLSENYF  516

Query  641  NGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP ++GN  +L   ++S NSL
Sbjct  517  VGYIPSEVGNLEHLVTFNISSNSL  540


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    +  + NL  +    N L G+IP  L   ++L  LDLSIN
Sbjct  313  SAVEIDLSENQLTGFIPRE--LGLIPNLCLLQLFENMLQGSIPRELGQLTQLHKLDLSIN  370

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  EF ++  L  L L  N L G IP  + V   L  LDVS N+L+GSIP  +  
Sbjct  371  NLTGTIPLEFQNLTYLVDLQLFDNHLEGTIPPHIGVNSHLSVLDVSMNNLDGSIPPHLCM  430

Query  671  FYNLSYLDLSMNSL  712
            +  L +L L  N L
Sbjct  431  YQKLIFLSLGSNRL  444


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LSE    G  P+   +  L +LV+ N SSNSL GTIP  L +C  L+ LDLS N 
Sbjct  506  LERLHLSENYFVGYIPSE--VGNLEHLVTFNISSNSLSGTIPHELGNCVNLQRLDLSRNQ  563

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
             TG    E   +  L  L L  N L G IP+ +   + L  L +  N  +GSIP  +G  
Sbjct  564  FTGSAPEELGQLVNLELLKLSDNKLTGAIPSSLGGLARLTELQMGGNIFSGSIPVALGQL  623

Query  674  YNLSY-LDLSMNSL  712
              L   L++S N+L
Sbjct  624  TALQIALNISHNNL  637


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 66/135 (49%), Gaps = 10/135 (7%)
 Frame = +2

Query  329  SLSEMI-----MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            SL E++     + G+ PAS  I +L  L  I    NSL G IP  +S C  LE L L+ N
Sbjct  169  SLEELVIYSNNLTGAIPAS--ISKLRQLRVIRAGHNSLSGPIPPEISECEGLEVLGLAQN  226

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIG  667
             L G +  E   ++ L  L L  N L GEIP P +    SLE L +  N  +G +P ++G
Sbjct  227  SLEGFLPSELEKLRNLTDLILWQNHLSGEIP-PTIGNIQSLELLALHENSFSGGLPKELG  285

Query  668  NFYNLSYLDLSMNSL  712
                L  L +  N L
Sbjct  286  KLSRLKKLYVYTNVL  300


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 7/132 (5%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  ++L E    G  P    + +L+ L  +   +N L GTIP  L +C+    +DLS N
Sbjct  265  SLELLALHENSFSGGLPKE--LGKLSRLKKLYVYTNVLNGTIPHELGNCTSAVEIDLSEN  322

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I  E   +  L  L L  NML G IP  +   + L  LD+S N+L G+IP +   
Sbjct  323  QLTGFIPRELGLIPNLCLLQLFENMLQGSIPRELGQLTQLHKLDLSINNLTGTIPLE---  379

Query  671  FYNLSYL-DLSM  703
            F NL+YL DL +
Sbjct  380  FQNLTYLVDLQL  391



>gb|KDO64793.1| hypothetical protein CISIN_1g042931mg, partial [Citrus sinensis]
Length=471

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 8/161 (5%)
 Frame = +2

Query  248  FEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLN-----NLVSINF  412
            F   N +S  C W G +CNS GS+  + LS     GSF     + QLN     NL ++ F
Sbjct  82   FWTANYSSDHCKWIGFTCNSAGSIIGLHLSRDY--GSFEEPVQLSQLNFSCFPNLENLTF  139

Query  413  SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
             S  L G+IP  +S+ SKL+ LDLS N LTG I  E  +++ L  LN+  N+L G +P+ 
Sbjct  140  QSFPLAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGNLRNLVYLNISKNILTGTVPST  199

Query  593  MVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + + + L+++ +S N L+G +P +IGN  NL  LDL  NSL
Sbjct  200  LGSLTNLKNMGLSYNQLSGPLPQEIGNLKNLMELDLGTNSL  240


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             + R+ LS   + GS P+   I  L NLV +N S N L GT+P+ L S + L+ + LS N
Sbjct  157  KLQRLDLSSNRLTGSIPSE--IGNLRNLVYLNISKNILTGTVPSTLGSLTNLKNMGLSYN  214

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             L+G +  E  ++K L  L+L  N L G IP+ +   + L  + +S N   G +P +IGN
Sbjct  215  QLSGPLPQEIGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSRNMFGGLLPQEIGN  274

Query  671  FYNLSYLDLSMNSL  712
              NL  L++  NSL
Sbjct  275  LKNLIELNVGSNSL  288


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 62/121 (51%), Gaps = 6/121 (5%)
 Frame = +2

Query  311  GSVTRIS---LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            GS+T +    LS   + G  P    I  L NL+ ++  +NSL G IP+ L   + L  + 
Sbjct  201  GSLTNLKNMGLSYNQLSGPLPQE--IGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMS  258

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPD  658
            LS N   G +  E  ++K L  LN+  N L G IP+ + +   L  LD+S N  + SIP+
Sbjct  259  LSRNMFGGLLPQEIGNLKNLIELNVGSNSLIGPIPSTLGLLTDLSYLDLSCNQFSSSIPN  318

Query  659  D  661
            D
Sbjct  319  D  319



>ref|XP_006343221.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=995

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 97/176 (55%), Gaps = 6/176 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWN--STSSPCDWPGISCNS-NGSVTRISLSEMIMGGSFP  364
            E   L  +K  +  P  +F  WN    SSPC+W G+ C+S   SVT I LS   + G FP
Sbjct  21   ESLYLHTIKLGFDDPNGVFSNWNLHDNSSPCNWFGVKCDSLTRSVTSIDLSNTNIAGPFP  80

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPAN-LSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            AS ++C+L  +  I+F +NS+  T+P   LS+C  L  LDL+ N L G +      +  L
Sbjct  81   AS-LLCRLKYIKYISFYNNSINSTLPVEELSACKSLVHLDLAQNLLVGSLPSSLAELPEL  139

Query  542  RSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            + L+L GN   GEIP    A+  LE L +  N L G+IP +IGN  +L  L+LS N
Sbjct  140  KYLDLTGNNFTGEIPARFGAFRRLEVLGLVENLLTGTIPLEIGNISSLKQLNLSYN  195


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P S  I  L  L  ++F +N L G  P+ + S  KL  L+ + NDL+G+I  E  S+
Sbjct  488  GSLPVS--IVNLEQLGRMDFHNNELSGKFPSGVHSLKKLNELNFANNDLSGEIPREIGSL  545

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
              L  L+L GN   GEIP  +    L  L++S+N L+G IP
Sbjct  546  SVLNYLDLSGNKFSGEIPVALQNLKLNQLNLSNNGLSGGIP  586


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 4/128 (3%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            LS+    G+ P    I  L +LV    + N   G++P ++ +  +L  +D   N+L+GK 
Sbjct  457  LSKNEFSGNIPEE--IGFLESLVDFVGNDNKFSGSLPVSIVNLEQLGRMDFHNNELSGKF  514

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSY  688
                 S+K L  LN   N L GEIP  + + S L  LD+S N  +G IP  + N   L+ 
Sbjct  515  PSGVHSLKKLNELNFANNDLSGEIPREIGSLSVLNYLDLSGNKFSGEIPVALQNL-KLNQ  573

Query  689  LDLSMNSL  712
            L+LS N L
Sbjct  574  LNLSNNGL  581



>ref|XP_009149170.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 isoform X1 [Brassica rapa]
Length=1143

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 96/183 (52%), Gaps = 5/183 (3%)
 Frame = +2

Query  170  SLTTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMI  346
            S+T+  E+  A LL  K       S    WN S S+PC+W G+ CN  G+VT + LS M 
Sbjct  53   SVTSLNEEGHA-LLEFKSSLNDSNSYLINWNRSDSNPCNWTGVECNRLGTVTSVDLSGMN  111

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+   S +IC L+ L  +N S+N + G IP + S C  LE LDL  N   G I  +  
Sbjct  112  LSGTL--SPLICNLHGLSYLNVSTNFISGPIPRDFSLCRTLEILDLCTNRFHGVIPIQLT  169

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             + TL+ L+L  N LFG IP  +    SL+ L++ SN+L G IP  IG    L  +    
Sbjct  170  MITTLQKLSLCENYLFGSIPRFIGNMSSLQELEIYSNNLTGVIPSSIGKLRQLRVIRAGR  229

Query  704  NSL  712
            N L
Sbjct  230  NML  232


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T++ L + ++ G+ P    +  LNNL ++    N L G I A+L     LE L L+ N
Sbjct  485  SLTKLMLGDNMLTGTLPVE--LFNLNNLSALELHQNMLSGNISADLGKLKSLERLRLANN  542

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
            + TG+I  E  ++  +  LN+  N L G IP  +    +++ LD+S N  +G I +++G 
Sbjct  543  NFTGEIPPEIKNLTKIVGLNISSNHLTGHIPRELGSCVTIQRLDLSGNKFSGEIAEELGQ  602

Query  671  FYNLSYLDLSMNSL  712
              NL  L LS N L
Sbjct  603  LVNLEILKLSDNRL  616


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 70/132 (53%), Gaps = 3/132 (2%)
 Frame = +2

Query  320  TRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDL  499
            T + +S   + GS PA    C+   L+ ++  SN L G IP +L++C  L  L L  N L
Sbjct  439  TVLDMSANNLSGSIPAH--FCRFQKLILLSLGSNKLSGNIPRDLTTCKSLTKLMLGDNML  496

Query  500  TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFY  676
            TG +  E F++  L +L L  NML G I   +    SLE L +++N+  G IP +I N  
Sbjct  497  TGTLPVELFNLNNLSALELHQNMLSGNISADLGKLKSLERLRLANNNFTGEIPPEIKNLT  556

Query  677  NLSYLDLSMNSL  712
             +  L++S N L
Sbjct  557  KIVGLNISSNHL  568


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 10/148 (7%)
 Frame = +2

Query  275  PCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLS  454
            PC+   ++         I  SE  + G  P    + Q+ NL  ++   N+L G+IP  L 
Sbjct  333  PCEIGNLT-----DAVEIDFSENQLTGYIPRE--LGQILNLKLLHLFENNLQGSIPRELG  385

Query  455  SCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVS  628
              S L+ LDLSIN LTG I  E   + +L  L L  N L G IP P++ Y  +   LD+S
Sbjct  386  ELSLLQKLDLSINRLTGTIPEELQLLTSLVDLQLFDNNLEGTIP-PLIGYYSNFTVLDMS  444

Query  629  SNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +N+L+GSIP     F  L  L L  N L
Sbjct  445  ANNLSGSIPAHFCRFQKLILLSLGSNKL  472


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 72/159 (45%), Gaps = 28/159 (18%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ L+     G  P    I  L  +V +N SSN L G IP  L SC  ++ LDLS N
Sbjct  533  SLERLRLANNNFTGEIPPE--IKNLTKIVGLNISSNHLTGHIPRELGSCVTIQRLDLSGN  590

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIP----------------------TPMVAYS  607
              +G+IA E   +  L  L L  N L GEIP                       P+    
Sbjct  591  KFSGEIAEELGQLVNLEILKLSDNRLTGEIPHSFGDLTRLMELQLGGNLLSGSIPLELGK  650

Query  608  LESLDV----SSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L SL +    S N+L+G+IPD +GN   L  L L+ N L
Sbjct  651  LTSLQISLNMSHNNLSGAIPDSLGNLQMLEILYLNDNKL  689


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +2

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            SA + +L +L  +  ++N+  G IP  + + +K+  L++S N LTG I  E  S  T++ 
Sbjct  525  SADLGKLKSLERLRLANNNFTGEIPPEIKNLTKIVGLNISSNHLTGHIPRELGSCVTIQR  584

Query  548  LNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+L GN   GEI   +    +LE L +S N L G IP   G+   L  L L  N L
Sbjct  585  LDLSGNKFSGEIAEELGQLVNLEILKLSDNRLTGEIPHSFGDLTRLMELQLGGNLL  640


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++ LS   + G+ P    +  L +LV +    N+L GTIP  +   S    LD+S N+
Sbjct  390  LQKLDLSINRLTGTIPEELQL--LTSLVDLQLFDNNLEGTIPPLIGYYSNFTVLDMSANN  447

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNF  673
            L+G I   F   + L  L+L  N L G IP  +    SL  L +  N L G++P ++ N 
Sbjct  448  LSGSIPAHFCRFQKLILLSLGSNKLSGNIPRDLTTCKSLTKLMLGDNMLTGTLPVELFNL  507

Query  674  YNLSYLDLSMNSL  712
             NLS L+L  N L
Sbjct  508  NNLSALELHQNML  520


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+S  +  + +L  +    N   GTIP  +     ++ L L  N LTG+I  E  
Sbjct  280  LSGEIPSS--VGNITSLEVLALHENYFTGTIPREIGKLVNIKRLYLYTNQLTGEIPCEIG  337

Query  527  SMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            ++     ++   N L G IP  +    +L+ L +  N+L GSIP ++G    L  LDLS+
Sbjct  338  NLTDAVEIDFSENQLTGYIPRELGQILNLKLLHLFENNLQGSIPRELGELSLLQKLDLSI  397

Query  704  NSL  712
            N L
Sbjct  398  NRL  400



>ref|XP_006446083.1| hypothetical protein CICLE_v10018319mg, partial [Citrus clementina]
 gb|ESR59323.1| hypothetical protein CICLE_v10018319mg, partial [Citrus clementina]
Length=542

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 95/161 (59%), Gaps = 13/161 (8%)
 Frame = +2

Query  257  WNS---TSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLN-----NLVSINF  412
            WNS   T+  C W GI+CNS GS+  + LS    G ++  S    QLN     NLV +  
Sbjct  53   WNSSFWTTDHCKWEGITCNSAGSIFELYLSGYYAGFNWRLS----QLNFSCFPNLVKLTI  108

Query  413  SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
               +L G+IP  +S+ SKL+ LDLS N LTG I  E  ++K L  LN+  N L G IP+ 
Sbjct  109  QFFALTGSIPPEISALSKLQLLDLSSNGLTGTIPPEIGNLKNLIELNVGSNSLIGPIPSA  168

Query  593  MVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + + + L +LD+SSN L+G IP +I    NL++LDLS N++
Sbjct  169  LGSLTNLSNLDLSSNKLSGKIPPEIAGMKNLTWLDLSNNNI  209



>emb|CBN80058.1| LRR-GTPase of the ROCO family [Ectocarpus siliculosus]
Length=1166

 Score =   100 bits (250),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 60/157 (38%), Positives = 87/157 (55%), Gaps = 11/157 (7%)
 Frame = +2

Query  257  WNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSI---NFSSNSL  427
            W++ +   DW G+  +  G V ++SLS   + GS P      QL NL+ +    F+ N L
Sbjct  27   WDTNADLSDWHGVKADDQGRVVKLSLSANKLRGSIPP-----QLGNLIELKEMQFNDNPL  81

Query  428  WGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA--  601
             G+IP  L S S+L  L L  N L+G I  E  ++  L++L+LRGN L G+IP P +   
Sbjct  82   TGSIPPELGSLSQLRLLKLYRNQLSGPIPPELGTLAALKNLSLRGNRLSGQIP-PQLGNL  140

Query  602  YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             +LE+L +S N LNG+IP+ +G    L  L L  N L
Sbjct  141  RALETLALSGNKLNGTIPEKLGKLTALEDLSLRNNKL  177



>emb|CDY15668.1| BnaA07g08390D [Brassica napus]
Length=984

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 98/174 (56%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSN-GSVTRISLSEMIMGGSFPA  367
            E +IL  +K     P S    WN    SPC W G+SC     SVT + LS+  + G FP+
Sbjct  19   EGSILQQVKLSLDDPDSSLSNWNPRDDSPCHWSGVSCGGAFSSVTSVDLSDANLAGPFPS  78

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              +IC+L NL S++  +NS+  T+P ++ +C  L+TLDLS N LTG++      +  L S
Sbjct  79   --LICRLPNLSSLSLYNNSINSTLPLDIGACKTLKTLDLSQNLLTGELPHTLADLPLLTS  136

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN   G+IP     +  LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  137  LDLTGNNFSGDIPASFSRFEKLEVLSLVFNLLDGAIPPLLGNITSLKMLNLSYN  190


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 67/127 (53%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L  LV ++ + N L G IP +L   + +  ++L  N LTG I
Sbjct  212  LTECNLIGQIPDS--LSRLTRLVDLDLALNDLVGPIPRSLGGLTSVVQIELYNNSLTGSI  269

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G IP  +    LESL++  N+L G +P  I +  NL  L
Sbjct  270  PRELGNLKSLRLLDASMNQLTGSIPDELCRVPLESLNLYENNLEGELPASIASSPNLYEL  329

Query  692  DLSMNSL  712
             +  N L
Sbjct  330  RIFGNRL  336


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 3/126 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S   + G  P S  +  L  L S++   N   G +   + S  KL  L+L+ N 
Sbjct  470  LNQLSASGNKLSGFLPES--LMNLGELSSLDLQGNRFSGELSPKIKSWKKLNELNLAGNQ  527

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-F  673
             +G I  E  S+  L  L+L GN+  GEIP  +    L  L++S+N L G IP  +    
Sbjct  528  FSGSIPNEIGSLSVLNYLDLSGNLFSGEIPVSLQGLKLNQLNLSNNRLTGDIPPSLAKEM  587

Query  674  YNLSYL  691
            Y  S+L
Sbjct  588  YKNSFL  593


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 82/164 (50%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I   +N S+  ++ +E    G  P    I  LNNL  
Sbjct  417  WGLPHVYLLELINNSFSGEIAKTIGGAANLSLLILTNNEFT--GGLPEE--IGSLNNLNQ  472

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N L G +P +L +  +L +LDL  N  +G+++ +  S K L  LNL GN   G I
Sbjct  473  LSASGNKLSGFLPESLMNLGELSSLDLQGNRFSGELSPKIKSWKKLNELNLAGNQFSGSI  532

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  +     L+ L+LS N L
Sbjct  533  PNEIGSLSVLNYLDLSGNLFSGEIPVSLQGL-KLNQLNLSNNRL  575


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            SV +I L    + GS P    +  L +L  ++ S N L G+IP  L     LE+L+L  N
Sbjct  254  SVVQIELYNNSLTGSIPRE--LGNLKSLRLLDASMNQLTGSIPDELCRVP-LESLNLYEN  310

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
            +L G++     S   L  L + GN L GE+P  +   S L+ LDVS N+ +G +P D+ +
Sbjct  311  NLEGELPASIASSPNLYELRIFGNRLSGELPRDLGLNSPLKWLDVSDNEFSGELPPDLCS  370

Query  671  FYNLSYLDLSMNSL  712
               L  L +  NS 
Sbjct  371  KGELEELLIIHNSF  384



>ref|XP_010045748.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
 gb|KCW84071.1| hypothetical protein EUGRSUZ_B00951 [Eucalyptus grandis]
Length=1091

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 104/180 (58%), Gaps = 4/180 (2%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T Y E E  +    K   G  F+L   WN T+ PC W GI+C+S GSV  ++LS  I+ G
Sbjct  45   TRYEEVEALLTWKSKLDSGSRFTL-SSWNGTN-PCSWRGINCDSLGSVASLNLSNSIIHG  102

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            +        QL NL+++  ++NS +G IP ++++ +KL  LDLS N+L+G I  +   ++
Sbjct  103  TL-HYLNFSQLPNLIALTLTNNSFFGKIPLSMANLAKLTYLDLSRNNLSGNIPTQLGLLR  161

Query  536  TLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +LR LN+  N L G IP  + + + L  L +S N L G IP +IG   +L+YL ++ N +
Sbjct  162  SLRDLNISNNDLTGPIPKEIFSLTNLTYLYLSDNKLAGFIPKEIGRLKSLAYLHIANNRI  221


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 66/134 (49%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +T + LS+    G  P    IC    L   +  +N   G IP  L +C+ L  + L  N
Sbjct  402  KLTNLQLSDNKFVGQLPQD--ICSGQVLEFFSADNNHFTGPIPRGLKNCTSLYRVRLQNN  459

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             L G I+    +   L  L L  N L+GE+P  +  YS L SL +S+  ++G IP ++GN
Sbjct  460  QLEGNISDGLGTYPYLDYLELSNNKLYGELPPRLGEYSNLTSLKISNTRISGVIPFEVGN  519

Query  671  FYNLSYLDLSMNSL  712
               L  LDLS NSL
Sbjct  520  MSQLHILDLSSNSL  533


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L++L  I+ + N+L G+IP  L  CS+L  L+LS N+L   I  E   +++L+ L+L  N
Sbjct  568  LSDLSRIDVAGNNLTGSIPKQLGDCSRLLFLNLSRNNLDRSIPVEIGKLQSLQVLDLSQN  627

Query  566  MLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L G IP  + +   LE+L++S N L+G I     +  +L+ +D+S N L
Sbjct  628  LLTGGIPGQLGLLQRLEALNLSHNQLSGLIASTFEDMTSLTSIDISYNEL  677


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++RI ++   + GS P     C  + L+ +N S N+L  +IP  +     L+ LDLS N 
Sbjct  571  LSRIDVAGNNLTGSIPKQLGDC--SRLLFLNLSRNNLDRSIPVEIGKLQSLQVLDLSQNL  628

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPD  658
            LTG I G+   ++ L +LNL  N L G I +      SL S+D+S N+L G +P+
Sbjct  629  LTGGIPGQLGLLQRLEALNLSHNQLSGLIASTFEDMTSLTSIDISYNELEGPLPN  683


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 50/99 (51%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N L G IP  L + S L  +D++ N+LTG I  +      L  LNL  N L   IP  + 
Sbjct  555  NQLVGYIPRELGTLSDLSRIDVAGNNLTGSIPKQLGDCSRLLFLNLSRNNLDRSIPVEIG  614

Query  599  A-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
               SL+ LD+S N L G IP  +G    L  L+LS N L
Sbjct  615  KLQSLQVLDLSQNLLTGGIPGQLGLLQRLEALNLSHNQL  653


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +2

Query  356  SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK  535
            S P    +  L +L S+    NSL G+IP+ + + SKL  L LS N   G++  +  S +
Sbjct  366  SGPIPKELGMLGSLSSLVLIGNSLSGSIPSIMGNLSKLTNLQLSDNKFVGQLPQDICSGQ  425

Query  536  TLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L   +   N   G IP  +    SL  + + +N L G+I D +G +  L YL+LS N L
Sbjct  426  VLEFFSADNNHFTGPIPRGLKNCTSLYRVRLQNNQLEGNISDGLGTYPYLDYLELSNNKL  485



>gb|ERN15172.1| hypothetical protein AMTR_s00056p00147890 [Amborella trichopoda]
Length=865

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 94/164 (57%), Gaps = 7/164 (4%)
 Frame = +2

Query  182  YGEDERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSEMIMGGS  358
            +G++++ ILL +K+ WG P  L   WNSTS   C+W GI+C+SN S+  ISLS   +   
Sbjct  35   HGQEDQ-ILLKIKRQWGNPPPLL-SWNSTSGHHCNWFGITCDSN-SIRGISLSNQNITEK  91

Query  359  FPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKT  538
             P S  IC L NL  ++ S N + G  P  L +CS LE LDLS N   G I  E + +  
Sbjct  92   IPDS--ICDLKNLTHLDVSYNYITGEFPEVLFNCSHLEFLDLSQNYFVGPIPSEIYRISE  149

Query  539  LRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIG  667
            L+ LN+  N  FG+IP+ +   S LE+L +  N  N SI  +IG
Sbjct  150  LKQLNMSSNNFFGDIPSGIGRISGLENLYLHYNQFNSSISPEIG  193


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +2

Query  359  FPASAIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
            F ++ I+ ++  L  + F     N+L G IP    + +++  LDL  N L+GKI     S
Sbjct  208  FSSANILPEIGRLKKLTFLWMRGNNLVGEIPDFFGNLTEVRQLDLCGNRLSGKIPVSLMS  267

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            +K L  L L  N L G IP P+ A  L ++D+S N L+G+IP+DIGN  NL+   L  N 
Sbjct  268  LKKLEFLYLYYNNLSGIIPRPIQALGLINMDLSINQLSGTIPEDIGNLKNLTNFALYRNK  327

Query  710  L  712
            L
Sbjct  328  L  328


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 5/121 (4%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  PA  I+ +   L  +   +N   G IP+ +SS   L     S N  +G++  E  ++
Sbjct  450  GQIPA--ILAK--RLTRLEVQNNRFTGNIPSGISSSVNLTVFKGSNNQFSGQLPAEITAL  505

Query  533  KTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            + L +L L  N L GE+P  + ++ SL  LD+S N+L G+IP+ +G+  +L+ LDL+ N 
Sbjct  506  RKLETLLLDRNKLSGELPAKIESWESLARLDMSYNELEGTIPESLGSLPSLNSLDLTNNK  565

Query  710  L  712
            L
Sbjct  566  L  566


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 77/160 (48%), Gaps = 8/160 (5%)
 Frame = +2

Query  233  YPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINF  412
            Y   LFE   +   P D        +  +  + +SE  + G+ P S  +C    L +I  
Sbjct  343  YDVKLFENKLTGVLPPDL-----GKDSPLYNLEVSENSLSGNLPES--LCASGYLDAIVV  395

Query  413  SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
             SN   G +P +LS+C  L ++ + +N  +G+I  + +S++ +  + L  N  FG+IP  
Sbjct  396  FSNIFSGALPESLSNCRNLRSMQVHLNKFSGEIPAKIWSLEFMEVMMLGNNSFFGQIPA-  454

Query  593  MVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            ++A  L  L+V +N   G+IP  I +  NL+    S N  
Sbjct  455  ILAKRLTRLEVQNNRFTGNIPSGISSSVNLTVFKGSNNQF  494


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 62/122 (51%), Gaps = 4/122 (3%)
 Frame = +2

Query  290  GISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKL  469
            GIS + N +V + S ++    G  PA   I  L  L ++    N L G +PA + S   L
Sbjct  477  GISSSVNLTVFKGSNNQF--SGQLPAE--ITALRKLETLLLDRNKLSGELPAKIESWESL  532

Query  470  ETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGS  649
              LD+S N+L G I     S+ +L SL+L  N L GEI   +    L  L++S N+L G 
Sbjct  533  ARLDMSYNELEGTIPESLGSLPSLNSLDLTNNKLSGEISPEIGKLRLSFLNLSGNNLAGK  592

Query  650  IP  655
            IP
Sbjct  593  IP  594


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             V ++ L    + G  P S  +  L  L  +    N+L G IP  + +   L  +DLSIN
Sbjct  246  EVRQLDLCGNRLSGKIPVS--LMSLKKLEFLYLYYNNLSGIIPRPIQALG-LINMDLSIN  302

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
             L+G I  +  ++K L +  L  N L GEIP  +    SL  + +  N L G +P D+G 
Sbjct  303  QLSGTIPEDIGNLKNLTNFALYRNKLTGEIPLGLAQIPSLYDVKLFENKLTGVLPPDLGK  362

Query  671  FYNLSYLDLSMNSL  712
               L  L++S NSL
Sbjct  363  DSPLYNLEVSENSL  376



>ref|XP_009804334.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 [Nicotiana sylvestris]
Length=1111

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 94/176 (53%), Gaps = 4/176 (2%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            +E  ILL  ++    P++  E WNS+  SPC+W G+ C+ NG V  +S+  + + GS  +
Sbjct  31   EEGLILLEFRKSLNDPYNNLESWNSSDLSPCNWNGVECSKNGQVISLSIDRLNLTGSLSS  90

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S  IC+L  L  +N S+N + G IP + + C  LE L+L  N    +   +  ++ +L  
Sbjct  91   S--ICKLPYLTKLNVSTNFISGHIPDDFALCQSLEKLNLCTNRFNVEFPVQLCNISSLTQ  148

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N ++GEIP  +   S LE L + SN+L G IPD IG    L  +    N L
Sbjct  149  LYLCENYIYGEIPEDIGNLSQLEELVIYSNNLTGKIPDSIGKLKRLRIIRAGRNYL  204


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ ++ L + ++ GSF  S  IC+L NL S+    N   G +P  + +  KLE L LS N
Sbjct  457  SIEQLMLGDNLLTGSF--SVDICKLQNLSSLELFHNRFSGMLPPEVGNLRKLERLLLSRN  514

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
               G+I  +   +  L + N+  N   GEIP  +     L+ LD+S+N   G +P ++GN
Sbjct  515  YFFGQIPPDIGKLVKLVAFNISSNHFSGEIPHELGNCIRLQRLDLSNNLFAGILPGELGN  574

Query  671  FYNLSYLDLSMNSL  712
              NL  L LS N  
Sbjct  575  LVNLELLKLSDNEF  588


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             + R+ LS     G  P    I +L  LV+ N SSN   G IP  L +C +L+ LDLS N
Sbjct  505  KLERLLLSRNYFFGQIPPD--IGKLVKLVAFNISSNHFSGEIPHELGNCIRLQRLDLSNN  562

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGN  670
               G + GE  ++  L  L L  N   G+IP+ +     L  L++  N  +GSIPD++G 
Sbjct  563  LFAGILPGELGNLVNLELLKLSDNEFSGQIPSGLGGLVRLTELEMGGNFFSGSIPDELGQ  622

Query  671  FYNLSY-LDLSMNSL  712
               L   L+LS N+L
Sbjct  623  LGTLQISLNLSHNAL  637


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 58/123 (47%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P S  I +L  L  I    N L G IPA +S C  L  L ++ N L G    E  
Sbjct  180  LTGKIPDS--IGKLKRLRIIRAGRNYLSGPIPAEISECESLLILGVAENRLEGSFPIELQ  237

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +K+L SL L  N   G IP  +  +S LE L +  N   GS+P +IG   NL  L +  
Sbjct  238  KLKSLTSLILWANFFSGAIPPEIGNFSNLELLALHENSFTGSLPKEIGKLTNLRRLYIYT  297

Query  704  NSL  712
            N L
Sbjct  298  NQL  300


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 72/134 (54%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P S     L+NL  ++   N L G IP  L     L+ LDLSIN
Sbjct  313  SAAEIDLSENQLSGYIPKSLG--LLSNLRLLHLFENRLHGKIPKELGKLKLLKNLDLSIN  370

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             LTG+I  EF  ++ L +L L  N L G IP  + +  +L  +D+S N+L GSIP ++  
Sbjct  371  KLTGRIPSEFQYLEFLENLQLFDNQLEGHIPRFIGLKSNLSVVDLSKNNLEGSIPSNLCQ  430

Query  671  FYNLSYLDLSMNSL  712
            F  L++L L  N L
Sbjct  431  FQKLTFLSLGSNKL  444


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 59/107 (55%), Gaps = 4/107 (4%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNL----VSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            + L+E+ MGG+F + +I  +L  L    +S+N S N+L G+IP+NL +   LETL L+ N
Sbjct  600  VRLTELEMGGNFFSGSIPDELGQLGTLQISLNLSHNALNGSIPSNLGNLQMLETLYLNDN  659

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSN  634
             L G+I      + +L   NL  N L G +P       ++S + + N
Sbjct  660  QLIGEIPTSIGQLMSLIVCNLSNNNLVGSVPNTPAFRRMDSSNFAGN  706



>ref|XP_009102909.1| PREDICTED: receptor-like protein kinase HSL1 [Brassica rapa]
Length=998

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 98/174 (56%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSN-GSVTRISLSEMIMGGSFPA  367
            E +IL  +K     P S    WN    SPC W G+SC     SVT + LS+  + G FP+
Sbjct  19   EGSILQQVKLSLDDPDSSLSNWNPRDDSPCHWSGVSCGGAFSSVTSVDLSDANLAGPFPS  78

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              +IC+L NL S++  +NS+  T+P ++ +C  L+TLDLS N LTG++      +  L S
Sbjct  79   --LICRLPNLSSLSLYNNSINSTLPLDIGACKTLKTLDLSQNLLTGELPHTLADLPLLTS  136

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN   G+IP     +  LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  137  LDLTGNNFSGDIPASFSRFEKLEVLSLVFNLLDGAIPPLLGNITSLKMLNLSYN  190


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 67/127 (53%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L  LV ++ + N L G IP +L   + +  ++L  N LTG I
Sbjct  212  LTECNLIGQIPDS--LSRLTRLVDLDLALNDLVGPIPRSLGGLTSVVQIELYNNSLTGSI  269

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G IP  +    LESL++  N+L G +P  I +  NL  L
Sbjct  270  PRELGNLKSLRLLDASMNQLTGSIPDELCRVPLESLNLYENNLEGELPASIASSPNLYEL  329

Query  692  DLSMNSL  712
             +  N L
Sbjct  330  RIFGNRL  336


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I   +N S+  ++ +E    G  P    I  LNNL  
Sbjct  417  WGLPHVYLLELINNSFSGEIAKTIGGAANLSLLILTNNEFT--GGLPEE--IGSLNNLNQ  472

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N L G +P +L +  +L TLDL  N  +G+++ +  S K L  LNL GN   G I
Sbjct  473  LSASGNKLSGFLPESLMNLGELSTLDLQGNRFSGELSPKIKSWKKLNELNLAGNQFSGSI  532

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  +     L+ L+LS N L
Sbjct  533  PNEIGSLSVLNYLDLSGNLFSGEIPVSLQGL-KLNQLNLSNNRL  575


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 3/126 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S   + G  P S  +  L  L +++   N   G +   + S  KL  L+L+ N 
Sbjct  470  LNQLSASGNKLSGFLPES--LMNLGELSTLDLQGNRFSGELSPKIKSWKKLNELNLAGNQ  527

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-F  673
             +G I  E  S+  L  L+L GN+  GEIP  +    L  L++S+N L G IP  +    
Sbjct  528  FSGSIPNEIGSLSVLNYLDLSGNLFSGEIPVSLQGLKLNQLNLSNNRLTGDIPPSLAKEM  587

Query  674  YNLSYL  691
            Y  S+L
Sbjct  588  YKNSFL  593


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            SV +I L    + GS P    +  L +L  ++ S N L G+IP  L     LE+L+L  N
Sbjct  254  SVVQIELYNNSLTGSIPRE--LGNLKSLRLLDASMNQLTGSIPDELCRVP-LESLNLYEN  310

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
            +L G++     S   L  L + GN L GE+P  +   S L+ LDVS N+ +G +P D+ +
Sbjct  311  NLEGELPASIASSPNLYELRIFGNRLSGELPRDLGLNSPLKWLDVSDNEFSGELPPDLCS  370

Query  671  FYNLSYLDLSMNSL  712
               L  L +  NS 
Sbjct  371  KGELEELLIIHNSF  384



>ref|XP_009609979.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nicotiana tomentosiformis]
Length=1128

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 90/161 (56%), Gaps = 6/161 (4%)
 Frame = +2

Query  236  PFSLFEQWNSTS--SPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSIN  409
            P      W+S S  +PCDW GI C  N SV+ + L  + + G  P +A I  L  L  ++
Sbjct  43   PIGALNNWDSKSPSAPCDWRGIVC-LNDSVSELRLPRLQLSG--PLTAEIANLRMLRKLS  99

Query  410  FSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT  589
              SN   GTIPA+LS C+ L+T+ L  N  +G+I  E   +K L + N+ GN ++GEIP 
Sbjct  100  LRSNFFNGTIPASLSKCTLLDTVFLQYNSFSGEIPPEILKLKQLLTFNVAGNQMYGEIPG  159

Query  590  PMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             + A S+   D+SSN  +GSIP++I     L+  ++S N  
Sbjct  160  ELPA-SIRYFDISSNLFSGSIPEEISEPSQLTLFNISYNQF  199


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 78/160 (49%), Gaps = 27/160 (17%)
 Frame = +2

Query  308  NGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLS  487
            N ++  + LS  +  G  P S  I  L  L  +  ++NS  G IP  ++ CS L  LDL 
Sbjct  336  NSTLRSLDLSGNLFSGKIPGS--IGNLLRLEQLRMANNSFEGDIPVGITKCSGLMVLDLE  393

Query  488  INDLTGKIA---GEFFSMK---------------------TLRSLNLRGNMLFGEIPTPM  595
             N L G+I    G+F S+K                     +L SLNL GN L G +P  +
Sbjct  394  GNRLIGEIPRFLGDFKSLKILSLGRNQFSGLIPSSFGNITSLESLNLEGNRLTGSLPEEL  453

Query  596  VAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +  S L  LD+S N  +GSIPD I NF  LS L++S N L
Sbjct  454  MFLSNLSILDLSGNKFSGSIPDGIWNFQQLSVLNMSRNGL  493


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 68/130 (52%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            I+L E  + G+ P       L  L  +N SSNS  G IP+     + L  L LS N+++G
Sbjct  534  IALQENKLSGNVPEG--FSSLMGLQYLNLSSNSFSGHIPSTFGFLTSLVVLSLSNNNISG  591

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
             I  +  +   L +LNLR N L G+IP  +   S L  L++  N+L G IP+ I N  +L
Sbjct  592  SIPPDLGNSSALEALNLRSNSLSGQIPADLARLSRLSVLNLGRNNLTGEIPEIISNCSSL  651

Query  683  SYLDLSMNSL  712
            + L L MN L
Sbjct  652  TSLVLDMNHL  661


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 67/134 (50%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  +SL      G  P+S     + +L S+N   N L G++P  L   S L  LDLS N
Sbjct  410  SLKILSLGRNQFSGLIPSS--FGNITSLESLNLEGNRLTGSLPEELMFLSNLSILDLSGN  467

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
              +G I    ++ + L  LN+  N L G IP+ +   Y L +LD+S  +L+G +P DI  
Sbjct  468  KFSGSIPDGIWNFQQLSVLNMSRNGLSGSIPSSIGTLYKLVALDLSGQNLSGELPSDIAG  527

Query  671  FYNLSYLDLSMNSL  712
              NL  + L  N L
Sbjct  528  LPNLQVIALQENKL  541


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 69/147 (47%), Gaps = 7/147 (5%)
 Frame = +2

Query  287  PGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS----INFSSNSLWGTIPANLS  454
            P + CN  GSV   SL  + +  +     +  QL+  VS    ++   N + G  P  L+
Sbjct  277  PSMFCN--GSVNPPSLRIIQLNHNAFTEILQPQLSTCVSFLQVLDLQQNQIHGNFPTFLT  334

Query  455  SCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSS  631
              S L +LDLS N  +GKI G   ++  L  L +  N   G+IP  +   S L  LD+  
Sbjct  335  DNSTLRSLDLSGNLFSGKIPGSIGNLLRLEQLRMANNSFEGDIPVGITKCSGLMVLDLEG  394

Query  632  NDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G IP  +G+F +L  L L  N  
Sbjct  395  NRLIGEIPRFLGDFKSLKILSLGRNQF  421


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 64/121 (53%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P    I     L  +N S N L G+IP+++ +  KL  LDLS  +L+G++  +   +
Sbjct  471  GSIPDG--IWNFQQLSVLNMSRNGLSGSIPSSIGTLYKLVALDLSGQNLSGELPSDIAGL  528

Query  533  KTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L+ + L+ N L G +P    +   L+ L++SSN  +G IP   G   +L  L LS N+
Sbjct  529  PNLQVIALQENKLSGNVPEGFSSLMGLQYLNLSSNSFSGHIPSTFGFLTSLVVLSLSNNN  588

Query  710  L  712
            +
Sbjct  589  I  589


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 71/134 (53%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  +SLS   + GS P    +   + L ++N  SNSL G IPA+L+  S+L  L+L  N
Sbjct  578  SLVVLSLSNNNISGSIPPD--LGNSSALEALNLRSNSLSGQIPADLARLSRLSVLNLGRN  635

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVS-SNDLNGSIPDDIGN  670
            +LTG+I     +  +L SL L  N L G IP  + +    +      N+LNG IP+++  
Sbjct  636  NLTGEIPEIISNCSSLTSLVLDMNHLSGIIPASLSSLLSLNTLDLSGNNLNGEIPENLTM  695

Query  671  FYNLSYLDLSMNSL  712
              NL   ++S N L
Sbjct  696  LPNLVNFNVSNNKL  709


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L +LV ++ S+N++ G+IP +L + S LE L+L  N L+G+I  +   +  L  LNL  N
Sbjct  576  LTSLVVLSLSNNNISGSIPPDLGNSSALEALNLRSNSLSGQIPADLARLSRLSVLNLGRN  635

Query  566  MLFGEIPTPMV-AYSLESLDVSSNDLNGSIP  655
             L GEIP  +    SL SL +  N L+G IP
Sbjct  636  NLTGEIPEIISNCSSLTSLVLDMNHLSGIIP  666



>gb|EMT25886.1| Receptor-like protein kinase HSL1 [Aegilops tauschii]
Length=650

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 103/187 (55%), Gaps = 11/187 (6%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSS-PCDWPGISCNSNGSVTRISLS  337
            Y +S   Y  DE  ILL LK++WG   ++  +WNS SS  C W G++C + G VT ISL 
Sbjct  24   YPESTNQY-SDEHQILLGLKRYWGSS-TVLGRWNSISSDHCRWGGLTC-TKGEVTAISLP  80

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
            +  +    P S  +C L NL  ++ S N+   + P  L +CS L+ LDLS N   GK+A 
Sbjct  81   QQTLMKPIPPS--LCLLKNLAYLDLSYNNFSTSFPTILYNCSNLKYLDLSNNAFGGKLAA  138

Query  518  EFFSM-KTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIP-DDIGNFYNLS  685
            +  S+   L  LNL  N + GEIP P + +   L+SL + +N  +GS P  DI N  NL 
Sbjct  139  DINSLSAKLEHLNLSSNRIMGEIP-PSIGWFPKLKSLILDTNQFDGSYPVQDISNLANLE  197

Query  686  YLDLSMN  706
             L L+ N
Sbjct  198  MLTLADN  204


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +2

Query  431  GTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSL  610
            G IP ++SS ++L  L ++ N L G I    +  K L+ L +  N L GEI + + A +L
Sbjct  221  GEIPESVSSLTELSLLAVTNNMLQGTIPTWVWQHKKLQYLYMFNNGLTGEISSSVTAVNL  280

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              LDVSSN+L GSIPDD G   NL+ L L  N L
Sbjct  281  VELDVSSNNLTGSIPDDFGKLINLTLLFLYTNQL  314



>ref|XP_009149171.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 isoform X2 [Brassica rapa]
Length=1138

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 96/183 (52%), Gaps = 5/183 (3%)
 Frame = +2

Query  170  SLTTYGEDERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMI  346
            S+T+  E+  A LL  K       S    WN S S+PC+W G+ CN  G+VT + LS M 
Sbjct  53   SVTSLNEEGHA-LLEFKSSLNDSNSYLINWNRSDSNPCNWTGVECNRLGTVTSVDLSGMN  111

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+   S +IC L+ L  +N S+N + G IP + S C  LE LDL  N   G I  +  
Sbjct  112  LSGTL--SPLICNLHGLSYLNVSTNFISGPIPRDFSLCRTLEILDLCTNRFHGVIPIQLT  169

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             + TL+ L+L  N LFG IP  +    SL+ L++ SN+L G IP  IG    L  +    
Sbjct  170  MITTLQKLSLCENYLFGSIPRFIGNMSSLQELEIYSNNLTGVIPSSIGKLRQLRVIRAGR  229

Query  704  NSL  712
            N L
Sbjct  230  NML  232


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+T++ L + ++ G+ P    +  LNNL ++    N L G I A+L     LE L L+ N
Sbjct  485  SLTKLMLGDNMLTGTLPVE--LFNLNNLSALELHQNMLSGNISADLGKLKSLERLRLANN  542

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
            + TG+I  E  ++  +  LN+  N L G IP  +    +++ LD+S N  +G I +++G 
Sbjct  543  NFTGEIPPEIKNLTKIVGLNISSNHLTGHIPRELGSCVTIQRLDLSGNKFSGEIAEELGQ  602

Query  671  FYNLSYLDLSMNSL  712
              NL  L LS N L
Sbjct  603  LVNLEILKLSDNRL  616


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 70/132 (53%), Gaps = 3/132 (2%)
 Frame = +2

Query  320  TRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDL  499
            T + +S   + GS PA    C+   L+ ++  SN L G IP +L++C  L  L L  N L
Sbjct  439  TVLDMSANNLSGSIPAH--FCRFQKLILLSLGSNKLSGNIPRDLTTCKSLTKLMLGDNML  496

Query  500  TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFY  676
            TG +  E F++  L +L L  NML G I   +    SLE L +++N+  G IP +I N  
Sbjct  497  TGTLPVELFNLNNLSALELHQNMLSGNISADLGKLKSLERLRLANNNFTGEIPPEIKNLT  556

Query  677  NLSYLDLSMNSL  712
             +  L++S N L
Sbjct  557  KIVGLNISSNHL  568


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 10/148 (7%)
 Frame = +2

Query  275  PCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLS  454
            PC+   ++         I  SE  + G  P    + Q+ NL  ++   N+L G+IP  L 
Sbjct  333  PCEIGNLT-----DAVEIDFSENQLTGYIPRE--LGQILNLKLLHLFENNLQGSIPRELG  385

Query  455  SCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVS  628
              S L+ LDLSIN LTG I  E   + +L  L L  N L G IP P++ Y  +   LD+S
Sbjct  386  ELSLLQKLDLSINRLTGTIPEELQLLTSLVDLQLFDNNLEGTIP-PLIGYYSNFTVLDMS  444

Query  629  SNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +N+L+GSIP     F  L  L L  N L
Sbjct  445  ANNLSGSIPAHFCRFQKLILLSLGSNKL  472


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 72/159 (45%), Gaps = 28/159 (18%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ R+ L+     G  P    I  L  +V +N SSN L G IP  L SC  ++ LDLS N
Sbjct  533  SLERLRLANNNFTGEIPPE--IKNLTKIVGLNISSNHLTGHIPRELGSCVTIQRLDLSGN  590

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIP----------------------TPMVAYS  607
              +G+IA E   +  L  L L  N L GEIP                       P+    
Sbjct  591  KFSGEIAEELGQLVNLEILKLSDNRLTGEIPHSFGDLTRLMELQLGGNLLSGSIPLELGK  650

Query  608  LESLDV----SSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L SL +    S N+L+G+IPD +GN   L  L L+ N L
Sbjct  651  LTSLQISLNMSHNNLSGAIPDSLGNLQMLEILYLNDNKL  689


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +2

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            SA + +L +L  +  ++N+  G IP  + + +K+  L++S N LTG I  E  S  T++ 
Sbjct  525  SADLGKLKSLERLRLANNNFTGEIPPEIKNLTKIVGLNISSNHLTGHIPRELGSCVTIQR  584

Query  548  LNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+L GN   GEI   +    +LE L +S N L G IP   G+   L  L L  N L
Sbjct  585  LDLSGNKFSGEIAEELGQLVNLEILKLSDNRLTGEIPHSFGDLTRLMELQLGGNLL  640


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++ LS   + G+ P    +  L +LV +    N+L GTIP  +   S    LD+S N+
Sbjct  390  LQKLDLSINRLTGTIPEELQL--LTSLVDLQLFDNNLEGTIPPLIGYYSNFTVLDMSANN  447

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNF  673
            L+G I   F   + L  L+L  N L G IP  +    SL  L +  N L G++P ++ N 
Sbjct  448  LSGSIPAHFCRFQKLILLSLGSNKLSGNIPRDLTTCKSLTKLMLGDNMLTGTLPVELFNL  507

Query  674  YNLSYLDLSMNSL  712
             NLS L+L  N L
Sbjct  508  NNLSALELHQNML  520


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+S  +  + +L  +    N   GTIP  +     ++ L L  N LTG+I  E  
Sbjct  280  LSGEIPSS--VGNITSLEVLALHENYFTGTIPREIGKLVNIKRLYLYTNQLTGEIPCEIG  337

Query  527  SMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            ++     ++   N L G IP  +    +L+ L +  N+L GSIP ++G    L  LDLS+
Sbjct  338  NLTDAVEIDFSENQLTGYIPRELGQILNLKLLHLFENNLQGSIPRELGELSLLQKLDLSI  397

Query  704  NSL  712
            N L
Sbjct  398  NRL  400



>gb|KDO64794.1| hypothetical protein CISIN_1g038466mg, partial [Citrus sinensis]
Length=572

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 95/161 (59%), Gaps = 13/161 (8%)
 Frame = +2

Query  257  WNS---TSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLN-----NLVSINF  412
            WNS   T+  C W GI+CNS GS+  + LS    G ++  S    QLN     NLV +  
Sbjct  78   WNSSFWTTDHCKWEGITCNSAGSIFELYLSGYYAGFNWRLS----QLNFSCFPNLVKLTI  133

Query  413  SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
               +L G+IP  +S+ SKL+ LDLS N LTG I  E  ++K L  LN+  N L G IP+ 
Sbjct  134  QFFALTGSIPPEISALSKLQLLDLSSNGLTGTIPPEIGNLKNLIELNVGSNSLIGPIPSA  193

Query  593  MVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + + + L +LD+SSN L+G IP +I    NL++LDLS N++
Sbjct  194  LGSLTNLSNLDLSSNKLSGKIPPEIAGMKNLTWLDLSNNNI  234



>ref|XP_010508671.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein 
kinase At2g41820 [Camelina sativa]
Length=890

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 94/177 (53%), Gaps = 11/177 (6%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSP-CDWPGISCNSNGS-VTRISLSEMIMGGSFP  364
            ++ A LL + +  G P      W+S  +  C W GI C +N S V  ++LS + + G+  
Sbjct  26   NDEATLLAISKELGVP-----GWSSNGTDYCTWVGIKCGANNSFVELLNLSGLQLRGNV-  79

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
               +I  L +L  ++ S N+  G IPA+  + SKLE LDLS+N   G I  EF  ++ LR
Sbjct  80   --TLISDLRSLRHLDLSGNNFNGPIPASFGNLSKLEFLDLSLNRFVGDIPVEFGRLRGLR  137

Query  545  SLNLRGNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + N+  N+L GEIP   MV   LE   VS N LNGSIP  +GN  NL       N L
Sbjct  138  AFNISNNLLVGEIPDELMVLQRLEEFQVSGNGLNGSIPHWVGNLSNLRVFTAYENDL  194


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  281  DWPGISCNSNG-SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSS  457
            + P    N +G S  RI  +E++  G  P +  I  ++ L      +N+L G I A  S 
Sbjct  245  ELPEAVGNCSGLSSIRIGNNELV--GVIPRT--IGNISGLTYFEADNNNLSGEIVAEFSK  300

Query  458  CSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSN  634
            C+ L  L+L+ N   G I  E   +  L+ L L GN LFGEIP   + + +L  LD+S+N
Sbjct  301  CTNLTLLNLAANGFAGTIPTELGQLMNLQELILSGNSLFGEIPKSFLGHGNLNKLDLSNN  360

Query  635  DLNGSIPDDIGNFYNLSYLDLSMNSL  712
             LNG+IP ++ +   L YL L  NS+
Sbjct  361  RLNGTIPKELCSMQRLQYLLLDQNSI  386


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 71/137 (52%), Gaps = 4/137 (3%)
 Frame = +2

Query  308  NGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLS  487
            +G++ ++ LS   + G+ P    +C +  L  +    NS+ G IP  + +C KL  L L 
Sbjct  349  HGNLNKLDLSNNRLNGTIPKE--LCSMQRLQYLLLDQNSIRGDIPNEIGNCVKLLQLQLG  406

Query  488  INDLTGKIAGEFFSMKTLR-SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDD  661
             N LTG I  E   M+ L+ +LNL  N L G +P  +     L SLDVS+N L GSIP  
Sbjct  407  RNYLTGTIPPEIGRMRNLQIALNLSFNHLHGSLPLELGKLDKLVSLDVSNNLLTGSIPQL  466

Query  662  IGNFYNLSYLDLSMNSL  712
            +    +L  ++ S N L
Sbjct  467  LKGMMSLIEVNFSNNLL  483


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T ++L+     G+ P    + QL NL  +  S NSL+G IP +      L  LDLS N 
Sbjct  304  LTLLNLAANGFAGTIPTE--LGQLMNLQELILSGNSLFGEIPKSFLGHGNLNKLDLSNNR  361

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            L G I  E  SM+ L+ L L  N + G+IP  +     L  L +  N L G+IP +IG  
Sbjct  362  LNGTIPKELCSMQRLQYLLLDQNSIRGDIPNEIGNCVKLLQLQLGRNYLTGTIPPEIGRM  421

Query  674  YNLSY-LDLSMNSL  712
             NL   L+LS N L
Sbjct  422  RNLQIALNLSFNHL  435


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 57/113 (50%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            +  L+NL       N L G IP  L   S+LE L+L  N L GKI    F    L+ L L
Sbjct  178  VGNLSNLRVFTAYENDLVGEIPNGLGLVSELELLNLHSNQLEGKIPKGIFEKGKLKVLVL  237

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N L GE+P  +   S L S+ + +N+L G IP  IGN   L+Y +   N+L
Sbjct  238  TQNRLTGELPEAVGNCSGLSSIRIGNNELVGVIPRTIGNISGLTYFEADNNNL  290


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 59/128 (46%), Gaps = 3/128 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            +S  ++ G  P   ++ Q   L     S N L G+IP  + + S L       NDL G+I
Sbjct  141  ISNNLLVGEIPDELMVLQ--RLEEFQVSGNGLNGSIPHWVGNLSNLRVFTAYENDLVGEI  198

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSY  688
                  +  L  LNL  N L G+IP  +     L+ L ++ N L G +P+ +GN   LS 
Sbjct  199  PNGLGLVSELELLNLHSNQLEGKIPKGIFEKGKLKVLVLTQNRLTGELPEAVGNCSGLSS  258

Query  689  LDLSMNSL  712
            + +  N L
Sbjct  259  IRIGNNEL  266



>ref|XP_007152512.1| hypothetical protein PHAVU_004G136500g [Phaseolus vulgaris]
 gb|ESW24506.1| hypothetical protein PHAVU_004G136500g [Phaseolus vulgaris]
Length=1003

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 98/185 (53%), Gaps = 9/185 (5%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEM  343
            SQSL    + E A+LL +KQ+   P S    WNSTSS C W  I+C S GSVT ++LS  
Sbjct  28   SQSLN---DQEHAVLLKIKQYLEDP-SFLSHWNSTSSHCSWAEITCTS-GSVTSLTLSHS  82

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
             +  + P     C L NL  ++FS N + G  P  L +CSKLE LDLS N+  GK+  + 
Sbjct  83   NINKTIPP--FTCDLTNLTHLDFSFNLIPGDFPTPLYNCSKLEYLDLSGNNFDGKVPLDI  140

Query  524  FSM-KTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
              +   L+ LNL      G +P  +     L  L +    LNGS+  +I +  NL YLDL
Sbjct  141  DHLGANLQYLNLGSTNFHGGVPASIANLKQLRQLRLQFCLLNGSVAAEIDSLSNLEYLDL  200

Query  698  SMNSL  712
            S N L
Sbjct  201  SSNFL  205


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 53/98 (54%), Gaps = 0/98 (0%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            + + N L        +L G IP N+     LE LD S N LTG I    F +K L SL L
Sbjct  215  LTKFNKLKVFYLYGTNLVGEIPDNIGDMVALEKLDASKNGLTGGIPSGLFLLKNLTSLYL  274

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
              N L GEIP+ + A +L +LD++ N+L G IPDD G 
Sbjct  275  FENDLSGEIPSVVEALNLVNLDLARNNLTGKIPDDFGK  312


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 69/133 (52%), Gaps = 6/133 (5%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            V+R  +S     G  P+   +    NLV  + S N+  G+IP  L++  KL TL L  N 
Sbjct  458  VSRFEISYNQFSGKIPSG--VSSWTNLVVFDASKNNFNGSIPKELTALRKLTTLLLDQNQ  515

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
            LTG +  +  S K+L +LNL  N L G+IP  +     L  LD+S N+L+G +P      
Sbjct  516  LTGALPSDIISWKSLVTLNLSQNQLSGQIPHAIGQLPVLSQLDLSENELSGQVPSLPSRL  575

Query  674  YNLSYLDLSMNSL  712
             N   L+LS N+L
Sbjct  576  TN---LNLSYNNL  585



>ref|XP_003516786.2| PREDICTED: receptor-like protein kinase 5-like [Glycine max]
Length=1013

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 95/181 (52%), Gaps = 7/181 (4%)
 Frame = +2

Query  161  YSQSLTTYG---EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRIS  331
            Y+ S + Y    + E A+LL +KQH   P  L     S SS C WP ISC +NGSVT ++
Sbjct  25   YANSQSQYSLLYDQEHAVLLRIKQHLQNPPFLNHWTPSNSSHCTWPEISC-TNGSVTSLT  83

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            +    +  + P    +C L NL  ++F  N + G  P  L +CSKLE LDLS N   GKI
Sbjct  84   MINTNITQTLPP--FLCDLTNLTHVDFQWNFIPGEFPKYLYNCSKLEYLDLSQNYFVGKI  141

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
              +   + +L  L+L GN   G+IP  +     L SL +    LNG+ P +IGN  NL  
Sbjct  142  PDDIDHLASLSFLSLGGNNFSGDIPASIGRLKELRSLQLYQCLLNGTFPAEIGNLSNLES  201

Query  689  L  691
            L
Sbjct  202  L  202


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 70/125 (56%), Gaps = 2/125 (2%)
 Frame = +2

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
             M+     P+S  + QLN L   +   +SL G IP  +     LE LDLS NDL+G+I  
Sbjct  208  HMLPPTKLPSS--LTQLNKLKVFHMYESSLVGEIPEAIGHMVALEELDLSKNDLSGQIPN  265

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
            + F +K L  L L  N L GEIP  + A+ L  LD+S N L+G IPDD+G   NL YL+L
Sbjct  266  DLFMLKNLSILYLYRNSLSGEIPGVVEAFHLTDLDLSENKLSGKIPDDLGRLNNLKYLNL  325

Query  698  SMNSL  712
              N L
Sbjct  326  YSNQL  330


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 5/133 (4%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T+I ++E    G  P     C   NL  ++ S N   G IP  +SS   +   + S N 
Sbjct  440  LTKIMINENKFTGQLP-ERFHC---NLSVLSISYNQFSGRIPLGVSSLKNVVIFNASNNL  495

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
              G I  E  S+  L +L L  N L G +P+ ++++ SL +LD+  N L+G IPD I   
Sbjct  496  FNGSIPLELTSLPRLTTLLLDHNQLTGPLPSDIISWKSLITLDLCHNQLSGVIPDAIAQL  555

Query  674  YNLSYLDLSMNSL  712
              L+ LDLS N +
Sbjct  556  PGLNILDLSENKI  568


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++  + LS+  + G  P    +  L NL  +    NSL G IP  + +   L  LDLS N
Sbjct  248  ALEELDLSKNDLSGQIPNDLFM--LKNLSILYLYRNSLSGEIPGVVEAF-HLTDLDLSEN  304

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGN  670
             L+GKI  +   +  L+ LNL  N L G++P  +    +L    V  N+L+G++P D G 
Sbjct  305  KLSGKIPDDLGRLNNLKYLNLYSNQLSGKVPESIARLRALTDFVVFINNLSGTLPLDFGL  364

Query  671  FYNLSYLDLSMNSL  712
            F  L    ++ NS 
Sbjct  365  FSKLETFQVASNSF  378


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 60/118 (51%), Gaps = 3/118 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            +  GS P    +  L  L ++    N L G +P+++ S   L TLDL  N L+G I    
Sbjct  495  LFNGSIPLE--LTSLPRLTTLLLDHNQLTGPLPSDIISWKSLITLDLCHNQLSGVIPDAI  552

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
              +  L  L+L  N + G+IP  +    L +L++SSN L G IP ++ N  Y  S+L+
Sbjct  553  AQLPGLNILDLSENKISGQIPLQLALKRLTNLNLSSNLLTGRIPSELENLAYATSFLN  610



>ref|XP_006446084.1| hypothetical protein CICLE_v10017805mg [Citrus clementina]
 gb|ESR59324.1| hypothetical protein CICLE_v10017805mg [Citrus clementina]
Length=644

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 92/157 (59%), Gaps = 8/157 (5%)
 Frame = +2

Query  260  NSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLN-----NLVSINFSSNS  424
            N +S  C W G +CNS GS+  + LS     GSF     + QLN     NL ++ F S  
Sbjct  61   NYSSDHCKWIGFTCNSAGSIIGLHLSRDY--GSFEEPVQLSQLNFSCFPNLENLTFQSFP  118

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G+IP  +S+ SKL+ LDLS N LTG I  E  +++ L  LN+  N+L G +P+ + + 
Sbjct  119  LAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGNLRNLVYLNISKNILTGTVPSTLGSL  178

Query  605  S-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L+++ +S N L+G +P +IGN  NL  LDL  NSL
Sbjct  179  TNLKNMGLSYNQLSGPLPQEIGNLKNLMELDLGTNSL  215


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 78/143 (55%), Gaps = 5/143 (3%)
 Frame = +2

Query  287  PGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSK  466
            P IS  S   + R+ LS   + GS P+   I  L NLV +N S N L GT+P+ L S + 
Sbjct  125  PEISALSK--LQRLDLSSNRLTGSIPSE--IGNLRNLVYLNISKNILTGTVPSTLGSLTN  180

Query  467  LETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLN  643
            L+ + LS N L+G +  E  ++K L  L+L  N L G IP+ +   + L  + +S N   
Sbjct  181  LKNMGLSYNQLSGPLPQEIGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSRNMFG  240

Query  644  GSIPDDIGNFYNLSYLDLSMNSL  712
            G +P +IGN  NL  L++  NSL
Sbjct  241  GLLPQEIGNLKNLIELNVGSNSL  263


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 62/121 (51%), Gaps = 6/121 (5%)
 Frame = +2

Query  311  GSVTRIS---LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            GS+T +    LS   + G  P    I  L NL+ ++  +NSL G IP+ L   + L  + 
Sbjct  176  GSLTNLKNMGLSYNQLSGPLPQE--IGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMS  233

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPD  658
            LS N   G +  E  ++K L  LN+  N L G IP+ + +   L  LD+S N  + SIP+
Sbjct  234  LSRNMFGGLLPQEIGNLKNLIELNVGSNSLIGPIPSTLGLLTDLSYLDLSCNQFSSSIPN  293

Query  659  D  661
            D
Sbjct  294  D  294



>gb|EMT31747.1| LRR receptor-like serine/threonine-protein kinase EFR [Aegilops 
tauschii]
Length=940

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 98/177 (55%), Gaps = 5/177 (3%)
 Frame = +2

Query  188  EDERAILLILKQHW-GYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFP  364
            ED+R++LL+ K    G P      W S    C+W G++C++   V ++ LSE  + G   
Sbjct  28   EDDRSVLLVFKAGVSGDPKGALAGWGSPDV-CNWTGVACDTEHHVVKLILSEQELSGK--  84

Query  365  ASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLR  544
             S  +  L++L ++N S N   G++P  L + S L+ LD+S N LTG +  E  ++  L+
Sbjct  85   VSFALGNLSHLRTLNLSGNHFTGSVPPELGNLSYLKFLDVSSNTLTGTVPPELGNLSCLK  144

Query  545  SLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             LN+  NML   +P  +   S L+ LDVSSN L G +  ++GN   LS LDLS N L
Sbjct  145  FLNMSSNMLTQAVPPELGNLSRLKFLDVSSNTLTGMVAPELGNLSRLSILDLSENVL  201


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 75/131 (57%), Gaps = 3/131 (2%)
 Frame = +2

Query  323  RISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT  502
            R+ LS  ++ G  P+S  +  +  L  +NFS N L G IP ++  C  ++ LDLS N L 
Sbjct  446  RLHLSNNLLSGDIPSS--LGMIPWLGHVNFSQNRLTGAIPPSIVQCVMMQNLDLSYNMLQ  503

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYN  679
            G+I      +  L +LNL GN+L G IP  +     L+ L++SSN L+G+IP  +G+   
Sbjct  504  GQIPAGLSRLSGLLNLNLAGNLLSGAIPVTLGEMVRLQLLNLSSNKLSGTIPSQLGSCIE  563

Query  680  LSYLDLSMNSL  712
            L YLD+S N L
Sbjct  564  LKYLDVSCNGL  574


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLN-NLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            +  +S++   + G+ P   +I +L+  L+ ++   N ++G IPAN+++ + L TL+LS N
Sbjct  371  LKELSIARNNIAGTIPP--VIGRLSPGLMQLHLQLNRIFGPIPANIANLTNLNTLNLSHN  428

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP--MVAYSLESLDVSSNDLNGSIPDDIG  667
             L G I     +M+ L  L+L  N+L G+IP+   M+ + L  ++ S N L G+IP  I 
Sbjct  429  LLNGSIPQGITNMRQLERLHLSNNLLSGDIPSSLGMIPW-LGHVNFSQNRLTGAIPPSIV  487

Query  668  NFYNLSYLDLSMNSL  712
                +  LDLS N L
Sbjct  488  QCVMMQNLDLSYNML  502


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L+ L  ++ S N L G +P  L   S+L  L L+ N L G I  E   ++ L  LNL  N
Sbjct  188  LSRLSILDLSENVLSGVVPQELGKLSRLTQLSLNRNQLEGSIPVELSRIQHLLYLNLGDN  247

Query  566  MLFGEIPTPMVA--YSLESLDVSSNDLNGSIP  655
             L G IP+ +     +L  +D+SSN L+G IP
Sbjct  248  NLSGHIPSAIFCNLSALNYIDMSSNFLDGEIP  279


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P +  + ++  L  +N SSN L GTIP+ L SC +L+ LD+S N LTG +      +
Sbjct  528  GAIPVT--LGEMVRLQLLNLSSNKLSGTIPSQLGSCIELKYLDVSCNGLTGTLPQSLEKV  585

Query  533  KTLRSLNLRGNMLFGEIPT  589
             +L  +N   N   GE+P+
Sbjct  586  ASLVRVNFSYNDFSGEVPS  604



>emb|CDP19861.1| unnamed protein product [Coffea canephora]
Length=865

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 96/181 (53%), Gaps = 26/181 (14%)
 Frame = +2

Query  236  PFSLFEQWNSTSSPCDWPGISCNSNGS-VTRISLSEMIMGGSFP----------------  364
            P S ++Q   +SSPC+W G+ CN NG  V  + LS + + GS                  
Sbjct  54   PLSTWDQ--DSSSPCNWTGVVCNRNGQRVIGLDLSGLRLSGSISPYLGNLSFLRSLQMQN  111

Query  365  ---ASAIICQLNNLV---SINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
                  +  QL NL    S+N S NSL G IP+N+S C +L  LDL  N +TG I  E  
Sbjct  112  NQLTGNLPEQLGNLFRLRSLNVSFNSLTGAIPSNISQCKELRVLDLMQNRMTGGIPEEIG  171

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +K L+ LNL  N LFG   + +V  S L +L++ +N L+G IP D+ +  NL YLDL++
Sbjct  172  QLKELQVLNLARNQLFGPFSSSLVNISTLTNLNLGTNSLDGPIPSDLSHLRNLKYLDLTI  231

Query  704  N  706
            N
Sbjct  232  N  232


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 71/132 (54%), Gaps = 5/132 (4%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + L+  ++ G  P S  +  L  L  I+ S N L G+IPA   +   L ++DLS N L G
Sbjct  380  LGLAGNLLSGKIPNS--LGNLQKLNKIDLSKNELLGSIPATFKNFQNLLSMDLSNNKLNG  437

Query  506  KIAGEFFSMKTLRS-LNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIGNFY  676
             I  E   + +L + LNL  N L G +P  +  +  SLE L ++ N L+G IPD +G+  
Sbjct  438  SIPPEILHLPSLSAFLNLSRNCLTGPLPEEVGFLEGSLEHLLLARNMLSGHIPDTLGDIR  497

Query  677  NLSYLDLSMNSL  712
             L  LDLS+N L
Sbjct  498  GLGTLDLSLNQL  509


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 57/99 (58%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N ++G+IP ++     LE LD+S   + G+I  E   ++ L+ L L GN+L G+IP  + 
Sbjct  337  NRVYGSIPPSVGQLRGLELLDMSNEAIYGEIPPEIGQLEELQVLGLAGNLLSGKIPNSLG  396

Query  599  -AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                L  +D+S N+L GSIP    NF NL  +DLS N L
Sbjct  397  NLQKLNKIDLSKNELLGSIPATFKNFQNLLSMDLSNNKL  435


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 67/120 (56%), Gaps = 4/120 (3%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P S+ +  ++ L ++N  +NSL G IP++LS    L+ LDL+IN+ TG +    ++M +L
Sbjct  189  PFSSSLVNISTLTNLNLGTNSLDGPIPSDLSHLRNLKYLDLTINNFTGTVPASIYNMSSL  248

Query  542  RSLNLRGNMLFGEIPTPMVAYSLESL---DVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              L L  N L+G++P+  V  +L +L   +   N   G+IP  + N   +  + ++ N L
Sbjct  249  VYLALASNDLWGDLPSN-VGVTLPNLLGFNFCINKFTGTIPGSLHNLTRIRIIRMAHNLL  307


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 67/127 (53%), Gaps = 5/127 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLET-LDLSI  490
             + +I LS+  + GS PA+       NL+S++ S+N L G+IP  +     L   L+LS 
Sbjct  400  KLNKIDLSKNELLGSIPAT--FKNFQNLLSMDLSNNKLNGSIPPEILHLPSLSAFLNLSR  457

Query  491  NDLTGKIAGEF-FSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDI  664
            N LTG +  E  F   +L  L L  NML G IP  +     L +LD+S N LNG+IP D+
Sbjct  458  NCLTGPLPEEVGFLEGSLEHLLLARNMLSGHIPDTLGDIRGLGTLDLSLNQLNGTIPFDL  517

Query  665  GNFYNLS  685
             N   L 
Sbjct  518  KNLQALQ  524


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 70/143 (49%), Gaps = 12/143 (8%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  ++L+   + G  P S +   L NL+  NF  N   GTIP +L + +++  + ++ N
Sbjct  247  SLVYLALASNDLWGDLP-SNVGVTLPNLLGFNFCINKFTGTIPGSLHNLTRIRIIRMAHN  305

Query  494  DLTGKIAG--------EFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLN  643
             L G +          E +++   R   + GN ++G IP P V     LE LD+S+  + 
Sbjct  306  LLHGSVPPGLGNLPDLEMYNIGYNRIFYMGGNRVYGSIP-PSVGQLRGLELLDMSNEAIY  364

Query  644  GSIPDDIGNFYNLSYLDLSMNSL  712
            G IP +IG    L  L L+ N L
Sbjct  365  GEIPPEIGQLEELQVLGLAGNLL  387



>ref|XP_011081773.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 isoform X1 [Sesamum indicum]
 ref|XP_011081774.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 isoform X1 [Sesamum indicum]
Length=979

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 94/176 (53%), Gaps = 5/176 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            E E  +LL +K            WNS+ S C W GI+C  +  V++I L    + G  P 
Sbjct  32   EVEFELLLSMKASINDHSHALSNWNSSVSFCKWNGITCFGSSHVSKIELPGKNLSGRIPE  91

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S  I +L N+ SI+ SSN L   IP NLSSC  L  L+LS N+LTG I      +  L +
Sbjct  92   S--IFRLPNIQSIDLSSNQLSDEIPRNLSSCFSLRYLNLSSNNLTGLIPSAH--LPVLET  147

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+L  NML GEIP  +  +S L+ LD   N L+G IPD + N   L +L L+ N L
Sbjct  148  LDLSNNMLSGEIPEDIGLFSGLKVLDFGGNVLSGRIPDSVTNMTMLEFLTLASNQL  203


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS  ++ G  P    I   + L  ++F  N L G IP ++++ + LE L L+ N LTG
Sbjct  148  LDLSNNMLSGEIPED--IGLFSGLKVLDFGGNVLSGRIPDSVTNMTMLEFLTLASNQLTG  205

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNL  682
            +I  +   MK+LR + L  N   GEIP  +    +L+ LD+  N+L G IP  +GN  NL
Sbjct  206  EIPRKLGLMKSLRWIYLGYNNFSGEIPKEIGELTALKHLDLVYNNLTGEIPSSLGNLMNL  265

Query  683  SYLDLSMNSL  712
             YL L  N L
Sbjct  266  EYLFLYFNKL  275


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 62/118 (53%), Gaps = 1/118 (1%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P    I  L  LVS++ S NSL G IP   S    LE L L  N+ +GKI     S+  L
Sbjct  278  PIPKPIFNLKKLVSLDLSDNSLSGEIPELFSQLQNLEILHLFSNNFSGKIPNALSSLPHL  337

Query  542  RSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L L  N L GEIP  +  Y +L  LD+S+N+L G IP+++     L  L L  NSL
Sbjct  338  QVLQLWSNRLSGEIPRDLGKYNNLTVLDLSTNNLTGKIPENLCASGRLFKLILFSNSL  395


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 67/119 (56%), Gaps = 4/119 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P S    ++ NL   + S N+  G IP +    S+L  L LS N+L+G+I  +    
Sbjct  469  GPVPGSFGSKKVENL---DLSGNNFSGNIPQSFGELSELMELKLSENELSGQIPDQLSYC  525

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            K L +L+L  N L GEIPT + A   L  LD+S N+L G+IP ++GN  +L  +++S N
Sbjct  526  KKLVTLDLSHNHLTGEIPTSISAMPVLGQLDLSVNELTGTIPANLGNVESLVQVNISHN  584


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 68/145 (47%), Gaps = 27/145 (19%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P    I +L  L  ++   N+L G IP++L +   LE L L  N LTG I    F++
Sbjct  229  GEIPKE--IGELTALKHLDLVYNNLTGEIPSSLGNLMNLEYLFLYFNKLTGPIPKPIFNL  286

Query  533  KTLRSLNLRGNMLFGEIP----------------------TPMVAYSLESLDVS---SND  637
            K L SL+L  N L GEIP                       P    SL  L V    SN 
Sbjct  287  KKLVSLDLSDNSLSGEIPELFSQLQNLEILHLFSNNFSGKIPNALSSLPHLQVLQLWSNR  346

Query  638  LNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+G IP D+G + NL+ LDLS N+L
Sbjct  347  LSGEIPRDLGKYNNLTVLDLSTNNL  371


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 69/136 (51%), Gaps = 2/136 (1%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            ++G + ++ L    + G  P S  +C+  +L  +    N L G +    ++   +  LD+
Sbjct  381  ASGRLFKLILFSNSLEGEIPKSLSLCK--SLQRVRLQKNRLSGELSPEFTTLPVVYFLDI  438

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDI  664
            S N+L+G+I    + M  L+ LNL  N  FG +P    +  +E+LD+S N+ +G+IP   
Sbjct  439  SSNNLSGRIDDNKWDMPQLQMLNLASNSFFGPVPGSFGSKKVENLDLSGNNFSGNIPQSF  498

Query  665  GNFYNLSYLDLSMNSL  712
            G    L  L LS N L
Sbjct  499  GELSELMELKLSENEL  514


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 57/108 (53%), Gaps = 2/108 (2%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
             L  +N +SNS +G +P +  S  K+E LDLS N+ +G I   F  +  L  L L  N L
Sbjct  456  QLQMLNLASNSFFGPVPGSFGS-KKVENLDLSGNNFSGNIPQSFGELSELMELKLSENEL  514

Query  572  FGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G+IP  +     L +LD+S N L G IP  I     L  LDLS+N L
Sbjct  515  SGQIPDQLSYCKKLVTLDLSHNHLTGEIPTSISAMPVLGQLDLSVNEL  562


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             V  + LS     G+ P S    +L+ L+ +  S N L G IP  LS C KL TLDLS N
Sbjct  479  KVENLDLSGNNFSGNIPQS--FGELSELMELKLSENELSGQIPDQLSYCKKLVTLDLSHN  536

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIP  655
             LTG+I     +M  L  L+L  N L G IP  +    SL  +++S N  +GS+P
Sbjct  537  HLTGEIPTSISAMPVLGQLDLSVNELTGTIPANLGNVESLVQVNISHNHFHGSLP  591


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 58/110 (53%), Gaps = 2/110 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  + LSE  + G  P     C+   LV+++ S N L G IP ++S+   L  LDLS+N+
Sbjct  504  LMELKLSENELSGQIPDQLSYCK--KLVTLDLSHNHLTGEIPTSISAMPVLGQLDLSVNE  561

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNG  646
            LTG I     ++++L  +N+  N   G +P+     ++ S  V+ N L G
Sbjct  562  LTGTIPANLGNVESLVQVNISHNHFHGSLPSTGAFLAINSSAVTGNKLCG  611


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 49/97 (51%), Gaps = 1/97 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N+  G IP  +   + L+ LDL  N+LTG+I     ++  L  L L  N L G IP P+ 
Sbjct  225  NNFSGEIPKEIGELTALKHLDLVYNNLTGEIPSSLGNLMNLEYLFLYFNKLTGPIPKPIF  284

Query  599  -AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
                L SLD+S N L+G IP+      NL  L L  N
Sbjct  285  NLKKLVSLDLSDNSLSGEIPELFSQLQNLEILHLFSN  321


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (52%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L +L  +   SN L G IP +L   + L  LDLS N+LTGKI     +   L  L L  N
Sbjct  334  LPHLQVLQLWSNRLSGEIPRDLGKYNNLTVLDLSTNNLTGKIPENLCASGRLFKLILFSN  393

Query  566  MLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GEIP  + +  SL+ + +  N L+G +  +      + +LD+S N+L
Sbjct  394  SLEGEIPKSLSLCKSLQRVRLQKNRLSGELSPEFTTLPVVYFLDISSNNL  443



>ref|XP_006470750.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Citrus sinensis]
Length=649

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 92/157 (59%), Gaps = 8/157 (5%)
 Frame = +2

Query  260  NSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLN-----NLVSINFSSNS  424
            N +S  C W G +CNS GS+  + LS     GSF     + QLN     NL ++ F S  
Sbjct  75   NYSSDHCKWIGFTCNSAGSIIGLHLSRDY--GSFEEPVQLSQLNFSCFPNLENLTFQSFP  132

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G+IP  +S+ SKL+ LDLS N LTG I  E  +++ L  LN+  N+L G +P+ + + 
Sbjct  133  LAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGNLRNLVYLNISKNILTGTVPSTLGSL  192

Query  605  S-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L+++ +S N L+G +P +IGN  NL  LDL  NSL
Sbjct  193  TNLKNMGLSYNQLSGPLPQEIGNLKNLMELDLGTNSL  229


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 76/142 (54%), Gaps = 5/142 (4%)
 Frame = +2

Query  287  PGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSK  466
            P IS  S   + R+ LS   + GS P+   I  L NLV +N S N L GT+P+ L S + 
Sbjct  139  PEISALSK--LQRLDLSSNRLTGSIPSE--IGNLRNLVYLNISKNILTGTVPSTLGSLTN  194

Query  467  LETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLN  643
            L+ + LS N L+G +  E  ++K L  L+L  N L G IP+ +   + L  + +S N   
Sbjct  195  LKNMGLSYNQLSGPLPQEIGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSRNMFG  254

Query  644  GSIPDDIGNFYNLSYLDLSMNS  709
            G +P +IGN  NL  L++   S
Sbjct  255  GLLPQEIGNLKNLIELNVGKTS  276



>ref|XP_010505972.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein 
kinase At2g41820 [Camelina sativa]
Length=890

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 93/176 (53%), Gaps = 11/176 (6%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSP-CDWPGISCNSNGS-VTRISLSEMIMGGSFPA  367
            + A LL + +  G P      W+S  +  C W GI C +N S V  ++LS + + G+   
Sbjct  27   DEATLLAISRELGVP-----GWSSNGTDYCTWVGIKCGANNSFVEMLNLSGLQLRGNV--  79

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              +I  L +L  ++ S N+  G IPA+  + SKLE LDLS+N   G I  EF  ++ LR+
Sbjct  80   -TLISDLRSLKHLDLSGNNFNGPIPASFGNLSKLEFLDLSLNRFVGDIPVEFGRLRGLRA  138

Query  548  LNLRGNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             N+  N+L GEIP   MV   LE   VS N LNGSIP  +GN  NL       N L
Sbjct  139  FNISNNLLVGEIPDELMVLQRLEDFQVSGNGLNGSIPHWVGNLSNLRVFTAYENDL  194


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  281  DWPGISCNSNG-SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSS  457
            + P    N +G S  RI  +E++  G  P +  I  ++ L      +N+L G I A  S 
Sbjct  245  ELPEAVGNCSGLSSIRIGNNELV--GVIPRT--IGNISGLTYFEADNNNLSGEIVAEFSK  300

Query  458  CSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSN  634
            CS L  L+L+ N   G I  E   +  L+ L L GN LFGEIP   + + +L  LD+S+N
Sbjct  301  CSNLTLLNLAANGFAGTIPIELGQLMNLQELILSGNSLFGEIPKSFLGHGNLNKLDLSNN  360

Query  635  DLNGSIPDDIGNFYNLSYLDLSMNSL  712
             LNG+IP ++ +   L YL L  NS+
Sbjct  361  RLNGTIPKELCSMQRLQYLLLDQNSI  386


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 71/137 (52%), Gaps = 4/137 (3%)
 Frame = +2

Query  308  NGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLS  487
            +G++ ++ LS   + G+ P    +C +  L  +    NS+ G IP  + +C KL  L L 
Sbjct  349  HGNLNKLDLSNNRLNGTIPKE--LCSMQRLQYLLLDQNSIRGDIPNEIGNCVKLLQLQLG  406

Query  488  INDLTGKIAGEFFSMKTLR-SLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDD  661
             N LTG I  E   M+ L+ +LNL  N L G +P  +     L SLDVS+N L GSIP  
Sbjct  407  RNYLTGTIPPEIGRMRNLQIALNLSFNHLHGSLPPELGKLDKLVSLDVSNNLLTGSIPQL  466

Query  662  IGNFYNLSYLDLSMNSL  712
            +    +L  ++ S N L
Sbjct  467  LKGMMSLIEVNFSNNLL  483


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T ++L+     G+ P    + QL NL  +  S NSL+G IP +      L  LDLS N 
Sbjct  304  LTLLNLAANGFAGTIPIE--LGQLMNLQELILSGNSLFGEIPKSFLGHGNLNKLDLSNNR  361

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            L G I  E  SM+ L+ L L  N + G+IP  +     L  L +  N L G+IP +IG  
Sbjct  362  LNGTIPKELCSMQRLQYLLLDQNSIRGDIPNEIGNCVKLLQLQLGRNYLTGTIPPEIGRM  421

Query  674  YNLSY-LDLSMNSL  712
             NL   L+LS N L
Sbjct  422  RNLQIALNLSFNHL  435


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 57/113 (50%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            +  L+NL       N L G IP  L   S+LE L+L  N L GKI    F    L+ L L
Sbjct  178  VGNLSNLRVFTAYENDLVGEIPNGLGLVSELELLNLHSNQLEGKIPKGIFEKGKLKVLVL  237

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N L GE+P  +   S L S+ + +N+L G IP  IGN   L+Y +   N+L
Sbjct  238  TQNRLTGELPEAVGNCSGLSSIRIGNNELVGVIPRTIGNISGLTYFEADNNNL  290


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 59/128 (46%), Gaps = 3/128 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            +S  ++ G  P   ++ Q   L     S N L G+IP  + + S L       NDL G+I
Sbjct  141  ISNNLLVGEIPDELMVLQ--RLEDFQVSGNGLNGSIPHWVGNLSNLRVFTAYENDLVGEI  198

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSY  688
                  +  L  LNL  N L G+IP  +     L+ L ++ N L G +P+ +GN   LS 
Sbjct  199  PNGLGLVSELELLNLHSNQLEGKIPKGIFEKGKLKVLVLTQNRLTGELPEAVGNCSGLSS  258

Query  689  LDLSMNSL  712
            + +  N L
Sbjct  259  IRIGNNEL  266



>gb|KHG18466.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=994

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 97/174 (56%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNS-NGSVTRISLSEMIMGGSFPA  367
            E   LL +K     P S+   WN    +PC+W G+SC+S  GSVT + LS   + G FP+
Sbjct  23   EGLYLLQVKASLSDPDSVLSSWNPRDPTPCNWRGVSCDSATGSVTSLDLSNANVAGPFPS  82

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              ++C+L NL  +NF  N++  TIP ++S+C  L  LDL+ N LTG++      +  L+ 
Sbjct  83   --LLCRLQNLSFVNFFYNNINSTIPPDISTCQNLVHLDLAQNLLTGELPHTLADLPNLKY  140

Query  548  LNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+  GN + G+ P     +  LE L +  N L+G+IP  +GN   L  L+LS N
Sbjct  141  LDFTGNNISGDFPESFGRFQKLEVLSLVYNLLDGTIPAFLGNISTLRMLNLSYN  194


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 74/145 (51%), Gaps = 6/145 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I+  +N S+  IS +E    GS P    I  ++NLV 
Sbjct  421  WGLPHVYLLELVNNSFSGQIGKSIAKAANLSLLIISRNEF--NGSLPEE--IGLVDNLVQ  476

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N L G +P ++     L  LDL  N+L G++     S+K L  LNL  N   G+I
Sbjct  477  LSASGNKLGGPLPKSIVKLDGLGILDLHGNELEGELPSGIESLKKLNELNLADNKFSGKI  536

Query  584  PTPMVAYS-LESLDVSSNDLNGSIP  655
            P  + + S L  LD+S+N L G +P
Sbjct  537  PDGIGSLSVLNYLDLSNNQLTGRVP  561


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L  L  ++ + N L G IP++L+  + +  ++L  N LTG++
Sbjct  216  LTECNLVGEIPDS--LGRLKKLTDLDLALNHLVGNIPSSLTELASVVQIELYNNSLTGEL  273

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
               F  +  LR L+   N L G IP  +    LESL++  N+  G++P  I +   L  L
Sbjct  274  PRGFSKLTNLRLLDASMNQLTGTIPDELTQLPLESLNLYQNNFEGTLPSSIADSPALYEL  333

Query  692  DLSMNSL  712
             L  N L
Sbjct  334  RLFQNRL  340


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 61/121 (50%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P S  +C+  +L  +    NS  G IP++L+ C  L  + L  N L+G I   F+ +
Sbjct  366  GPIPPS--LCEKGSLEELLMIHNSFSGQIPSSLAECRSLNRIRLGYNKLSGDIPAGFWGL  423

Query  533  KTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              +  L L  N   G+I   +  A +L  L +S N+ NGS+P++IG   NL  L  S N 
Sbjct  424  PHVYLLELVNNSFSGQIGKSIAKAANLSLLIISRNEFNGSLPEEIGLVDNLVQLSASGNK  483

Query  710  L  712
            L
Sbjct  484  L  484



>ref|XP_010501502.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR2 
[Camelina sativa]
Length=923

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 103/177 (58%), Gaps = 9/177 (5%)
 Frame = +2

Query  200  AILLILKQHWGYPFSLFEQWN---STSSPC-DWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            A+L +L+     P  +   W    S ++PC +W G+SC S+G+V  + L    + G   +
Sbjct  34   ALLSLLEHFDKVPLEVASTWKKNTSETTPCGNWFGVSCGSSGNVEMLDLPASGVSGQLGS  93

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
               I +L +LV ++ S+NSL G +P++L +C+ LE LDLS ND +G +   F S+K L++
Sbjct  94   K--IGELKSLVILDLSNNSLSGVLPSSLRNCTSLEFLDLSNNDFSGDVPDIFGSLKNLKN  151

Query  548  LNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L L  N L G IP P V     L +L ++ NDL+G+IP+ IGN   L YL L+ N L
Sbjct  152  LYLDRNNLRGLIP-PSVGQLVKLVALSLTRNDLSGTIPESIGNCSKLKYLALNGNKL  207


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 69/122 (57%), Gaps = 3/122 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P+S  +  LN ++SI+ S N L G+IP  L +CS+LETL L+ N L G+I     
Sbjct  279  LTGTIPSS--LGMLNKVLSIDLSDNHLSGSIPQELGNCSRLETLKLNNNQLQGQIPHALG  336

Query  527  SMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
             +K L++L L  N L GEIP  +    SL  + V +N L G +P ++    +L  L L  
Sbjct  337  KLKKLQNLELFVNKLSGEIPISIWKIQSLTQVLVYNNTLTGELPVEVTQLKHLKNLTLFN  396

Query  704  NS  709
            NS
Sbjct  397  NS  398


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + GS P S  +  L NL  +  ++NSL G +    S+C KL  LDLS N   G +  E  
Sbjct  207  LNGSLPVSLNL--LENLGDLFVNNNSLGGRLHFGSSNCKKLVNLDLSYNGFQGGVPPEIG  264

Query  527  SMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            +  +LRSL +    L G IP+ + +   + S+D+S N L+GSIP ++GN   L  L L+ 
Sbjct  265  NCSSLRSLAIINCNLTGTIPSSLGMLNKVLSIDLSDNHLSGSIPQELGNCSRLETLKLNN  324

Query  704  NSL  712
            N L
Sbjct  325  NQL  327


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 73/175 (42%), Gaps = 37/175 (21%)
 Frame = +2

Query  293  ISCNSNGS----------VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIP  442
            I+CN  G+          V  I LS+  + GS P     C  + L ++  ++N L G IP
Sbjct  275  INCNLTGTIPSSLGMLNKVLSIDLSDNHLSGSIPQELGNC--SRLETLKLNNNQLQGQIP  332

Query  443  ANLSSCSKLETLDLSINDL------------------------TGKIAGEFFSMKTLRSL  550
              L    KL+ L+L +N L                        TG++  E   +K L++L
Sbjct  333  HALGKLKKLQNLELFVNKLSGEIPISIWKIQSLTQVLVYNNTLTGELPVEVTQLKHLKNL  392

Query  551  NLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L  N  +GEIP  + +  SLE +D+  N   G IP  + +   L    L  N L
Sbjct  393  TLFNNSFYGEIPMSLGMNQSLEEVDLLGNRFTGEIPPYLCHGQKLRIFVLGSNQL  447


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 52/117 (44%), Gaps = 5/117 (4%)
 Frame = +2

Query  329  SLSEM-IMGGSFPAS--AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDL  499
            SL E+ ++G  F       +C    L      SN L GTIPA++  C  LE + L  N L
Sbjct  412  SLEEVDLLGNRFTGEIPPYLCHGQKLRIFVLGSNQLHGTIPASIRQCKTLERVRLEENKL  471

Query  500  --TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDI  664
              TG+I      +  L  LN+  N L G +        L  +DVS N   G IP ++
Sbjct  472  TVTGEIPTALGDLINLERLNISNNKLTGSLSVLQRLKFLGQVDVSHNQFKGPIPANL  528



>ref|XP_011081775.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 isoform X2 [Sesamum indicum]
Length=955

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 94/176 (53%), Gaps = 5/176 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            E E  +LL +K            WNS+ S C W GI+C  +  V++I L    + G  P 
Sbjct  32   EVEFELLLSMKASINDHSHALSNWNSSVSFCKWNGITCFGSSHVSKIELPGKNLSGRIPE  91

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S  I +L N+ SI+ SSN L   IP NLSSC  L  L+LS N+LTG I      +  L +
Sbjct  92   S--IFRLPNIQSIDLSSNQLSDEIPRNLSSCFSLRYLNLSSNNLTGLIPSAH--LPVLET  147

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+L  NML GEIP  +  +S L+ LD   N L+G IPD + N   L +L L+ N L
Sbjct  148  LDLSNNMLSGEIPEDIGLFSGLKVLDFGGNVLSGRIPDSVTNMTMLEFLTLASNQL  203


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS  ++ G  P    I   + L  ++F  N L G IP ++++ + LE L L+ N LTG
Sbjct  148  LDLSNNMLSGEIPED--IGLFSGLKVLDFGGNVLSGRIPDSVTNMTMLEFLTLASNQLTG  205

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNL  682
            +I  +   MK+LR + L  N   GEIP  +    +L+ LD+  N+L G IP  +GN  NL
Sbjct  206  EIPRKLGLMKSLRWIYLGYNNFSGEIPKEIGELTALKHLDLVYNNLTGEIPSSLGNLMNL  265

Query  683  SYLDLSMNSL  712
             YL L  N L
Sbjct  266  EYLFLYFNKL  275


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 67/119 (56%), Gaps = 4/119 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P S    ++ NL   + S N+  G IP +    S+L  L LS N+L+G+I  +    
Sbjct  469  GPVPGSFGSKKVENL---DLSGNNFSGNIPQSFGELSELMELKLSENELSGQIPDQLSYC  525

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            K L +L+L  N L GEIPT + A   L  LD+S N+L G+IP ++GN  +L  +++S N
Sbjct  526  KKLVTLDLSHNHLTGEIPTSISAMPVLGQLDLSVNELTGTIPANLGNVESLVQVNISHN  584


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 62/118 (53%), Gaps = 1/118 (1%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P    I  L  LVS++ S NSL G IP   S    LE L L  N+ +GKI     S+  L
Sbjct  278  PIPKPIFNLKKLVSLDLSDNSLSGEIPELFSQLQNLEILHLFSNNFSGKIPNALSSLPHL  337

Query  542  RSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L L  N L GEIP  +  Y +L  LD+S+N+L G IP+++     L  L L  NSL
Sbjct  338  QVLQLWSNRLSGEIPRDLGKYNNLTVLDLSTNNLTGKIPENLCASGRLFKLILFSNSL  395


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 71/156 (46%), Gaps = 26/156 (17%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLET-------  475
            +T + LS   + G  P +  +C    L  +   SNSL G IP +LS C  L+        
Sbjct  361  LTVLDLSTNNLTGKIPEN--LCASGRLFKLILFSNSLEGEIPKSLSLCKSLQRVRLQKNR  418

Query  476  -----------------LDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
                             LD+S N+L+G+I    + M  L+ LNL  N  FG +P    + 
Sbjct  419  LSGELSPEFTTLPVVYFLDISSNNLSGRIDDNKWDMPQLQMLNLASNSFFGPVPGSFGSK  478

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             +E+LD+S N+ +G+IP   G    L  L LS N L
Sbjct  479  KVENLDLSGNNFSGNIPQSFGELSELMELKLSENEL  514


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 68/145 (47%), Gaps = 27/145 (19%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P    I +L  L  ++   N+L G IP++L +   LE L L  N LTG I    F++
Sbjct  229  GEIPKE--IGELTALKHLDLVYNNLTGEIPSSLGNLMNLEYLFLYFNKLTGPIPKPIFNL  286

Query  533  KTLRSLNLRGNMLFGEIP----------------------TPMVAYSLESLDVS---SND  637
            K L SL+L  N L GEIP                       P    SL  L V    SN 
Sbjct  287  KKLVSLDLSDNSLSGEIPELFSQLQNLEILHLFSNNFSGKIPNALSSLPHLQVLQLWSNR  346

Query  638  LNGSIPDDIGNFYNLSYLDLSMNSL  712
            L+G IP D+G + NL+ LDLS N+L
Sbjct  347  LSGEIPRDLGKYNNLTVLDLSTNNL  371


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 57/108 (53%), Gaps = 2/108 (2%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
             L  +N +SNS +G +P +  S  K+E LDLS N+ +G I   F  +  L  L L  N L
Sbjct  456  QLQMLNLASNSFFGPVPGSFGS-KKVENLDLSGNNFSGNIPQSFGELSELMELKLSENEL  514

Query  572  FGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G+IP  +     L +LD+S N L G IP  I     L  LDLS+N L
Sbjct  515  SGQIPDQLSYCKKLVTLDLSHNHLTGEIPTSISAMPVLGQLDLSVNEL  562


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             V  + LS     G+ P S    +L+ L+ +  S N L G IP  LS C KL TLDLS N
Sbjct  479  KVENLDLSGNNFSGNIPQS--FGELSELMELKLSENELSGQIPDQLSYCKKLVTLDLSHN  536

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIP  655
             LTG+I     +M  L  L+L  N L G IP  +    SL  +++S N  +GS+P
Sbjct  537  HLTGEIPTSISAMPVLGQLDLSVNELTGTIPANLGNVESLVQVNISHNHFHGSLP  591


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 58/110 (53%), Gaps = 2/110 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  + LSE  + G  P     C+   LV+++ S N L G IP ++S+   L  LDLS+N+
Sbjct  504  LMELKLSENELSGQIPDQLSYCK--KLVTLDLSHNHLTGEIPTSISAMPVLGQLDLSVNE  561

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNG  646
            LTG I     ++++L  +N+  N   G +P+     ++ S  V+ N L G
Sbjct  562  LTGTIPANLGNVESLVQVNISHNHFHGSLPSTGAFLAINSSAVTGNKLCG  611


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 49/97 (51%), Gaps = 1/97 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N+  G IP  +   + L+ LDL  N+LTG+I     ++  L  L L  N L G IP P+ 
Sbjct  225  NNFSGEIPKEIGELTALKHLDLVYNNLTGEIPSSLGNLMNLEYLFLYFNKLTGPIPKPIF  284

Query  599  -AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
                L SLD+S N L+G IP+      NL  L L  N
Sbjct  285  NLKKLVSLDLSDNSLSGEIPELFSQLQNLEILHLFSN  321


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (52%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L +L  +   SN L G IP +L   + L  LDLS N+LTGKI     +   L  L L  N
Sbjct  334  LPHLQVLQLWSNRLSGEIPRDLGKYNNLTVLDLSTNNLTGKIPENLCASGRLFKLILFSN  393

Query  566  MLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GEIP  + +  SL+ + +  N L+G +  +      + +LD+S N+L
Sbjct  394  SLEGEIPKSLSLCKSLQRVRLQKNRLSGELSPEFTTLPVVYFLDISSNNL  443



>ref|XP_006286985.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
 gb|EOA19883.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
Length=1006

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            ++R+ LL LK+  G P SL  QWN+TSSPCDWP I+C + G+VT I+       G+ P +
Sbjct  25   NDRSTLLNLKRVLGDPTSL-RQWNNTSSPCDWPLITCTA-GNVTEINFQNQNFTGTVPTT  82

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMK-TLRS  547
              IC   NL  ++ S N   G  P  L +C+KL+ LDLS N   G + G+   +   L  
Sbjct  83   --ICDFPNLQFLDLSYNLFSGEFPTVLYNCTKLKYLDLSQNYFNGSLPGDINRLSPELEH  140

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L  N   G+IP  +   S L+ L++  ++ +G+ P +IG+   L  L L++N
Sbjct  141  LDLAANSFAGDIPKSLGRISKLKVLNLYMSEYDGTFPSEIGDLSELEELRLALN  194


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = +2

Query  323  RISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANL-SSCSKLETLDLSINDL  499
            R++L++       P      +L  L  +  S  +L G I A +  + + L  +DLS+N+L
Sbjct  190  RLALNDKFTPAKLPTE--FGKLKKLKYMWLSEMNLIGEISAVVFENMTDLIHVDLSVNNL  247

Query  500  TGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYN  679
            TG+I  + F +K L  L L  N   GEIP  + A ++  LD+S+N+L GSIP  IGN   
Sbjct  248  TGRIPDDLFGLKNLTELYLYANHFTGEIPKSISAVNMVKLDLSANNLTGSIPVSIGNLKK  307

Query  680  LSYLDLSMNSL  712
            L  L+L  N L
Sbjct  308  LEVLNLFYNEL  318


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (55%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++RI +      G  P    I   ++LV  N  +N   G IP  L+S S L ++ L+ ND
Sbjct  450  MSRIEIDNNQFSGEIPRK--IGTWSSLVEFNARNNRFSGEIPKELTSLSNLISVFLNEND  507

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNF  673
            L+G++  E  S K+L +L+L  N L G+IP  + +   L +LD+S N  +G IP +IG+ 
Sbjct  508  LSGELPDEIISWKSLVTLSLSKNKLSGKIPRGLGLLPRLINLDLSENQFSGEIPPEIGSL  567

Query  674  YNLSYLDLSMNSL  712
              L+ LDLS N  
Sbjct  568  -ELTILDLSSNRF  579


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            N+V ++ S+N+L G+IP ++ +  KLE L+L  N+LTG+I      +  L+ L +  N L
Sbjct  283  NMVKLDLSANNLTGSIPVSIGNLKKLEVLNLFYNELTGEIPPVIGKLPELKELMIFTNKL  342

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             GEIP  +   S LE  +VS N L G +P+++ N
Sbjct  343  TGEIPADIGFNSKLERFEVSQNQLTGKLPENLCN  376


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 61/111 (55%), Gaps = 4/111 (4%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L NL  +   +N   G IP ++S+ + ++ LDLS N+LTG I     ++K L  LNL  N
Sbjct  258  LKNLTELYLYANHFTGEIPKSISAVNMVK-LDLSANNLTGSIPVSIGNLKKLEVLNLFYN  316

Query  566  MLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GEIP P++     L+ L + +N L G IP DIG    L   ++S N L
Sbjct  317  ELTGEIP-PVIGKLPELKELMIFTNKLTGEIPADIGFNSKLERFEVSQNQL  366


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P    +  L+NL+S+  + N L G +P  + S   L TL LS N L+GKI      +
Sbjct  486  GEIPKE--LTSLSNLISVFLNENDLSGELPDEIISWKSLVTLSLSKNKLSGKIPRGLGLL  543

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
              L +L+L  N   GEIP  + +  L  LD+SSN   G IP  + N  Y  S+L+
Sbjct  544  PRLINLDLSENQFSGEIPPEIGSLELTILDLSSNRFIGEIPYQLDNLAYERSFLN  598



>emb|CAH65841.1| OSIGBa0137A06.2 [Oryza sativa Indica Group]
Length=977

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 90/175 (51%), Gaps = 23/175 (13%)
 Frame = +2

Query  257  WNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSF--------PASAIICQLNNLV----  400
            WN  SS C W G+ CN  G V+ + +  + + G             +I  Q N  +    
Sbjct  7    WNQGSSVCSWAGVRCNRQGRVSVLDVQSLNLAGQISPDIGNLSALQSIYLQKNRFIGNIP  66

Query  401  ----------SINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
                      ++N SSN   G+IP+ L++C+ L TLDLS N +TG I   F S++ L+ L
Sbjct  67   DQLGRLSLLETLNGSSNHFSGSIPSGLTNCTHLVTLDLSANSITGMIPISFHSLQNLKML  126

Query  551  NLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L  N L G IP  +   S L +LD S+N + G IP ++G+  +L Y DLS+N+L
Sbjct  127  KLGQNQLTGAIPPSLGNMSLLTTLDASTNTIAGEIPKELGHLRHLQYFDLSINNL  181


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 83/152 (55%), Gaps = 16/152 (11%)
 Frame = +2

Query  293  ISCNS-NGSV--TRISLSEM---------IMGGSFPASAIICQLNNLVSINFSSNSLWGT  436
            +SCN+ NGS+  T  SL+ +          + G  P    I +L N+V+I+ S N L G+
Sbjct  420  LSCNNLNGSIPDTVFSLTSLSSILNMSYNALTGVIPEG--IGRLGNIVAIDLSYNLLDGS  477

Query  437  IPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLE  613
            IP ++  C  +++L +  N ++G I  E  ++K L+ L+L  N L G IP  +    +L+
Sbjct  478  IPTSIGKCQSIQSLSMCGNAISGVIPREIKNLKGLQILDLSNNRLVGGIPEGLEKLQALQ  537

Query  614  SLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
             L++S NDL G +P   G F N S +D+  N+
Sbjct  538  KLNLSFNDLKGLVPSG-GIFKNSSAVDIHGNA  568


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS-LNLRG  562
            L  L  ++ S N L G+IP  L   S + +LDLS N+L G I    FS+ +L S LN+  
Sbjct  388  LTALTMLDISKNRLAGSIPKELGHLSHILSLDLSCNNLNGSIPDTVFSLTSLSSILNMSY  447

Query  563  NMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G IP  +    ++ ++D+S N L+GSIP  IG   ++  L +  N++
Sbjct  448  NALTGVIPEGIGRLGNIVAIDLSYNLLDGSIPTSIGKCQSIQSLSMCGNAI  498


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 72/143 (50%), Gaps = 6/143 (4%)
 Frame = +2

Query  293  ISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLE  472
            IS +S  ++  + L +  + G+ P S  +  ++ L +++ S+N++ G IP  L     L+
Sbjct  115  ISFHSLQNLKMLKLGQNQLTGAIPPS--LGNMSLLTTLDASTNTIAGEIPKELGHLRHLQ  172

Query  473  TLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLD---VSSNDLN  643
              DLSIN+LTG +  + +++  L    +  N L GEIP   ++  L  L    V  N L 
Sbjct  173  YFDLSINNLTGTVPRQLYNISNLAFFAVAMNKLHGEIPND-ISLGLPKLHIFIVCYNKLT  231

Query  644  GSIPDDIGNFYNLSYLDLSMNSL  712
            G IP  + N   +  + +S N L
Sbjct  232  GHIPPSLHNITKIHSIRISHNFL  254


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 55/101 (54%), Gaps = 4/101 (4%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSK-LETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM  595
            N + G IP ++ + S  LE L +  N +TG I      +  L  LN+  N+L GEIP   
Sbjct  302  NQIVGKIPDSIGNLSSSLENLYIGGNRITGHIPPMIGQLTRLTLLNMTDNLLDGEIPLE-  360

Query  596  VAY--SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            ++Y   L +L +S N+L+G IP   GN   L+ LD+S N L
Sbjct  361  ISYLKDLNALGLSGNNLSGPIPTQFGNLTALTMLDISKNRL  401



>ref|XP_010684496.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010684551.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=975

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 101/172 (59%), Gaps = 6/172 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCN-SNGSVTRISLSEMIMGGSFPAS  370
            E+ +LL  K H   P +  + W S++SPC++ G+SC+    +V+RI L    + G    S
Sbjct  30   EKTVLLEFKSHLKDPSNYLKSWTSSNSPCNFIGVSCDPKTRTVSRILLENASLSGEISPS  89

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
              +C+L +L ++  +SNS+ G IP  L+ C  L+ L+ +IN L GKI  +F  +++L  L
Sbjct  90   --LCKLQSLEALVVTSNSISGNIPLQLNQCRNLKVLNFTINRLVGKIP-DFSGLRSLEVL  146

Query  551  NLRGNMLFGEIPTPMV-AYSLESLDVSSNDL-NGSIPDDIGNFYNLSYLDLS  700
            +L GN L GE PT +     L SL + +N    G IP+++GN  NL++L LS
Sbjct  147  DLSGNFLTGEFPTWIGNLRGLISLGLGNNFFTEGKIPENLGNLKNLTWLFLS  198


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 73/137 (53%), Gaps = 4/137 (3%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
            S+ +++++ L   +  G  PA   I +L  L  +  S+NS  G +P  L    +L +L L
Sbjct  428  SSAAMSQLILENNMFSGVLPAE--IGKLTQLERLYLSNNSFSGVVPPQLGDLKQLSSLQL  485

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDD  661
              N LTG I  E      L   NL GN+L G IPT +   + L SL++SSN L GSIP +
Sbjct  486  QGNFLTGSIPQELSECTRLADFNLAGNLLDGRIPTTLAEMASLNSLNLSSNRLKGSIPSN  545

Query  662  IGNFYNLSYLDLSMNSL  712
            +G    LS +DLS N L
Sbjct  546  LGKL-KLSLVDLSDNEL  561


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 57/110 (52%), Gaps = 1/110 (1%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGN  565
            L NL  +  S+    G IP ++    +L+T+DLS N L+G ++     +K L  + L  N
Sbjct  189  LKNLTWLFLSNCKRVGEIPESIFDLKELDTIDLSRNRLSGLLSKSISELKKLTKIELFAN  248

Query  566  MLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GEIP+ +   + L+  D+S+N   G +P ++ N  NL+   L  N  
Sbjct  249  NLTGEIPSELANLTLLQEFDISANHFYGKLPPEMVNLKNLTVFQLYENEF  298


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 1/116 (1%)
 Frame = +2

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S  I +L  L  I   +N+L G IP+ L++ + L+  D+S N   GK+  E  ++K L  
Sbjct  231  SKSISELKKLTKIELFANNLTGEIPSELANLTLLQEFDISANHFYGKLPPEMVNLKNLTV  290

Query  548  LNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              L  N   GE+P      ++L    +  N  +G  P + G F  L  +D+S N+ 
Sbjct  291  FQLYENEFTGELPEGFGDLHNLIGFSIYRNSFSGKFPANFGRFSPLISIDISENNF  346


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 57/133 (43%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T   L E    G  P       L+NL+  +   NS  G  PAN    S L ++D+S N+
Sbjct  288  LTVFQLYENEFTGELPEG--FGDLHNLIGFSIYRNSFSGKFPANFGRFSPLISIDISENN  345

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
             TG         ++L+ L    N   GE P       SL    ++ N L+G +PD I   
Sbjct  346  FTGTFPSYLCESRSLKFLLALDNGFSGEFPASYADCKSLVRFRINQNRLSGQLPDGIWAM  405

Query  674  YNLSYLDLSMNSL  712
             N+  LDLS N  
Sbjct  406  PNVDILDLSDNEF  418



>ref|XP_010673884.1| PREDICTED: receptor-like protein kinase [Beta vulgaris subsp. 
vulgaris]
Length=1117

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 103/177 (58%), Gaps = 6/177 (3%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSN-GSVTRISL  334
            +S S      D +A++ +L + W  P S+   WNS+  +PC W G+ C+    +V  ++L
Sbjct  20   FSSSCDALNSDGKALISLLSK-WVVPKSVKNSWNSSQNTPCSWKGVICDKKTQNVVSLNL  78

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
            S   + G       I QL NL +++ SSN++   IP  +S+CS LE LDLS+N+LTG+I 
Sbjct  79   SNFGISGHLGPE--IGQLGNLQTLDLSSNTISSFIPVEISNCSLLEMLDLSVNNLTGEIP  136

Query  515  GEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNL  682
                ++++L+ LN  GN   G+IP+ +    +++ + ++SN L GSIP +IGN   L
Sbjct  137  KNLGNLQSLQVLNFYGNSFVGKIPSSLFRIPNIQDVFLNSNQLTGSIPSNIGNATKL  193


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (59%), Gaps = 3/107 (3%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L++++ S NSL G+IPA+  S + L  LDL  N LTG I      ++ L+ L+L GN+L 
Sbjct  577  LLTLDLSFNSLNGSIPASFGSLTALSFLDLRENHLTGGIPSYVSELRMLQELHLGGNLLE  636

Query  575  GEIPTPMVAYS---LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            G IP+ +       L +L++S+N L   +P D+    +L ++DLS N
Sbjct  637  GPIPSSITLSENLILNALNLSNNRLTAHLPPDLQRLASLRWIDLSHN  683


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 72/139 (52%), Gaps = 11/139 (8%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSIN---FSSNSLWGTIPANLSSCSKLETLDL  484
            S+T I+L+   + GS P      +L NL  I+    S N+L G++P  L +  KL TLDL
Sbjct  528  SLTWINLTMNNLSGSLPP-----ELGNLTEIHAVFMSRNNLEGSLPMELGNWQKLLTLDL  582

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDD  661
            S N L G I   F S+  L  L+LR N L G IP+ +     L+ L +  N L G IP  
Sbjct  583  SFNSLNGSIPASFGSLTALSFLDLRENHLTGGIPSYVSELRMLQELHLGGNLLEGPIPSS  642

Query  662  IGNFYN--LSYLDLSMNSL  712
            I    N  L+ L+LS N L
Sbjct  643  ITLSENLILNALNLSNNRL  661


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 71/135 (53%), Gaps = 5/135 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+TR+ L    + G FP    I ++ +L  I   +NSL G +PA ++    L  L LS N
Sbjct  361  SLTRLQLHNNRLTGEFPVG--IWKIRSLELILIYNNSLSGELPAEITELKNLRNLSLSDN  418

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS--LESLDVSSNDLNGSIPDDIG  667
              +G +  +     +L  +++  N   GEIP P + +S  L+ LD+  N L+GSIP ++G
Sbjct  419  QFSGILPRDLGINSSLVMIDVTNNKFTGEIP-PHLCFSKRLQDLDMGHNMLSGSIPPNVG  477

Query  668  NFYNLSYLDLSMNSL  712
            +  +L  L    N+L
Sbjct  478  SCSSLIRLRFEHNNL  492


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  PA   I +L NL +++ S N   G +P +L   S L  +D++ N  TG+I     
Sbjct  396  LSGELPAE--ITELKNLRNLSLSDNQFSGILPRDLGINSSLVMIDVTNNKFTGEIPPHLC  453

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
              K L+ L++  NML G IP P V    SL  L    N+L G IP +    ++LS++DLS
Sbjct  454  FSKRLQDLDMGHNMLSGSIP-PNVGSCSSLIRLRFEHNNLTGVIP-EFEKDHSLSFIDLS  511

Query  701  MNSL  712
             N +
Sbjct  512  ENKI  515


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 70/130 (54%), Gaps = 4/130 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + +   ++ GS P +   C  ++L+ + F  N+L G IP        L  +DLS N + G
Sbjct  461  LDMGHNMLSGSIPPNVGSC--SSLIRLRFEHNNLTGVIPE-FEKDHSLSFIDLSENKIHG  517

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            K+     + ++L  +NL  N L G +P  +   + + ++ +S N+L GS+P ++GN+  L
Sbjct  518  KLPLSLANCQSLTWINLTMNNLSGSLPPELGNLTEIHAVFMSRNNLEGSLPMELGNWQKL  577

Query  683  SYLDLSMNSL  712
              LDLS NSL
Sbjct  578  LTLDLSFNSL  587



>ref|XP_011626753.1| PREDICTED: receptor-like protein kinase HSL1 [Amborella trichopoda]
Length=1014

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 94/164 (57%), Gaps = 7/164 (4%)
 Frame = +2

Query  182  YGEDERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSEMIMGGS  358
            +G++++ ILL +K+ WG P  L   WNSTS   C+W GI+C+SN S+  ISLS   +   
Sbjct  35   HGQEDQ-ILLKIKRQWGNPPPLL-SWNSTSGHHCNWFGITCDSN-SIRGISLSNQNITEK  91

Query  359  FPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKT  538
             P S  IC L NL  ++ S N + G  P  L +CS LE LDLS N   G I  E + +  
Sbjct  92   IPDS--ICDLKNLTHLDVSYNYITGEFPEVLFNCSHLEFLDLSQNYFVGPIPSEIYRISE  149

Query  539  LRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIG  667
            L+ LN+  N  FG+IP+ +   S LE+L +  N  N SI  +IG
Sbjct  150  LKQLNMSSNNFFGDIPSGIGRISGLENLYLHYNQFNSSISPEIG  193


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +2

Query  359  FPASAIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
            F ++ I+ ++  L  + F     N+L G IP    + +++  LDL  N L+GKI     S
Sbjct  208  FSSANILPEIGRLKKLTFLWMRGNNLVGEIPDFFGNLTEVRQLDLCGNRLSGKIPVSLMS  267

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            +K L  L L  N L G IP P+ A  L ++D+S N L+G+IP+DIGN  NL+   L  N 
Sbjct  268  LKKLEFLYLYYNNLSGIIPRPIQALGLINMDLSINQLSGTIPEDIGNLKNLTNFALYRNK  327

Query  710  L  712
            L
Sbjct  328  L  328


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 61/109 (56%), Gaps = 1/109 (1%)
 Frame = +2

Query  389  NNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNM  568
              L  +   +N   G IP+ +SS   L     S N  +G++  E  +++ L +L L  N 
Sbjct  458  KRLTRLEVQNNRFTGNIPSGISSSVNLTVFKGSNNQFSGQLPAEITALRKLETLLLDRNK  517

Query  569  LFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L GE+P  + ++ SL  LD+S N+L G+IP+ +G+  +L+ LDL+ N L
Sbjct  518  LSGELPAKIESWESLARLDMSYNELEGTIPESLGSLPSLNSLDLTNNKL  566


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 77/160 (48%), Gaps = 8/160 (5%)
 Frame = +2

Query  233  YPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINF  412
            Y   LFE   +   P D        +  +  + +SE  + G+ P S  +C    L +I  
Sbjct  343  YDVKLFENKLTGVLPPDL-----GKDSPLYNLEVSENSLSGNLPES--LCASGYLDAIVV  395

Query  413  SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
             SN   G +P +LS+C  L ++ + +N  +G+I  + +S++ +  + L  N  FG+IP  
Sbjct  396  FSNIFSGALPESLSNCRNLRSMQVHLNKFSGEIPAKIWSLEFMEVMMLGNNSFFGQIPA-  454

Query  593  MVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            ++A  L  L+V +N   G+IP  I +  NL+    S N  
Sbjct  455  ILAKRLTRLEVQNNRFTGNIPSGISSSVNLTVFKGSNNQF  494


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 62/122 (51%), Gaps = 4/122 (3%)
 Frame = +2

Query  290  GISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKL  469
            GIS + N +V + S ++    G  PA   I  L  L ++    N L G +PA + S   L
Sbjct  477  GISSSVNLTVFKGSNNQF--SGQLPAE--ITALRKLETLLLDRNKLSGELPAKIESWESL  532

Query  470  ETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGS  649
              LD+S N+L G I     S+ +L SL+L  N L GEI   +    L  L++S N+L G 
Sbjct  533  ARLDMSYNELEGTIPESLGSLPSLNSLDLTNNKLSGEISPEIGKLRLSFLNLSGNNLAGK  592

Query  650  IP  655
            IP
Sbjct  593  IP  594


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             V ++ L    + G  P S  +  L  L  +    N+L G IP  + +   L  +DLSIN
Sbjct  246  EVRQLDLCGNRLSGKIPVS--LMSLKKLEFLYLYYNNLSGIIPRPIQALG-LINMDLSIN  302

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
             L+G I  +  ++K L +  L  N L GEIP  +    SL  + +  N L G +P D+G 
Sbjct  303  QLSGTIPEDIGNLKNLTNFALYRNKLTGEIPLGLAQIPSLYDVKLFENKLTGVLPPDLGK  362

Query  671  FYNLSYLDLSMNSL  712
               L  L++S NSL
Sbjct  363  DSPLYNLEVSENSL  376



>ref|XP_009352556.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1023

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 97/187 (52%), Gaps = 14/187 (7%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW----NSTSSPCDWPGISCNSNGSVTRIS  331
            SQSL      E+A+LL LK +   P      W    ++ SS C WP ISC +N SVT++ 
Sbjct  33   SQSLQ---HQEQAVLLKLKSYLNSP-PFLSHWILSKSNASSHCSWPEISC-TNYSVTKLF  87

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L    +  + P  + IC L NL  I+ S N L G  P  +  CSKLE LDLS N   G I
Sbjct  88   LDNKNI--TLPVPSFICDLKNLTVIDLSYNYLTGAFPKAVYKCSKLEYLDLSQNYFVGPI  145

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSS--NDLNGSIPDDIGNFYNLS  685
              +  S+  L+ L L GN   G+IP P +    E  ++    N  NGS+P +IGN  NL 
Sbjct  146  PDDIDSLPRLQQLILAGNNFSGDIP-PAIGLLQELENLQLYMNQFNGSVPPEIGNLSNLK  204

Query  686  YLDLSMN  706
             LD+S N
Sbjct  205  DLDMSFN  211


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +2

Query  425  LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY  604
            L G +   L     LE LDL+IN L+G+I    FS+K L  + L  N L G++P  + + 
Sbjct  239  LIGELHGTLGEMEALEQLDLAINSLSGEIPSGLFSLKNLNIIYLFKNGLSGKVPRVIESL  298

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +L  LD+S+N+L G+IP++ GN   L+ L L  N
Sbjct  299  NLSILDLSNNNLTGTIPEEYGNLTKLTELALYFN  332


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 63/121 (52%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P S  I +L NL+     +N+L G +P      SKLE  ++ +N LTGK+       
Sbjct  336  GEVPKS--IARLPNLIHFKIFNNNLSGILPPEFGRHSKLEAFEVCVNRLTGKLPDNLCYW  393

Query  533  KTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L +L    N L GE+P+ +    SL+++ V  N L+G+IP  +    NL+ + +S NS
Sbjct  394  GKLETLIAYENHLSGELPSSLGNCSSLKTVKVHDNLLSGNIPSGMWTAPNLTSVLISNNS  453

Query  710  L  712
            L
Sbjct  454  L  454


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = +2

Query  416  SNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM  595
             N L G +P+++ S   L +L+ S N LTG I  +   +  L  L+L  N L GEIP  +
Sbjct  521  QNQLTGFLPSDIVSWESLTSLNFSRNQLTGTIPEKLGLLPRLTELDLSANQLSGEIPDQL  580

Query  596  VAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
                +  L++SSN L G IP +  N  Y  S+LD
Sbjct  581  GHLKINQLNLSSNHLYGKIPTEFENAAYEGSFLD  614



>ref|XP_006415653.1| hypothetical protein EUTSA_v10006677mg [Eutrema salsugineum]
 gb|ESQ34006.1| hypothetical protein EUTSA_v10006677mg [Eutrema salsugineum]
Length=970

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 97/174 (56%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSN-GSVTRISLSEMIMGGSFPA  367
            E  IL  +K     P S    WNS   SPC W GISC  +  SVT + LS   + G FP+
Sbjct  23   EGFILQQVKLSLDDPDSSLSSWNSRDLSPCRWSGISCAGDFSSVTSVDLSGFNLAGPFPS  82

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            +  IC+L+NL  ++  +NS+  T+P ++ +C  L TLDLS N LTG+I      +  L S
Sbjct  83   A--ICRLSNLSYLSLYNNSINSTLPLDIGACKSLRTLDLSQNLLTGEIPHTLADLPILTS  140

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN   G+IP     +  LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  141  LDLTGNNFSGDIPASFGRFENLEVLALVYNLLDGTIPPFLGNISSLKMLNLSYN  194


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 67/122 (55%), Gaps = 2/122 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L+ LV ++ + N L G IP +L   + +  ++L  N LTG+I
Sbjct  216  LTECHLIGQIPDS--LGRLSRLVDLDLALNDLVGPIPRSLGGLTSVVQIELYNNSLTGEI  273

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G IP  +    LESL++  N+L G IP  I +  NL  L
Sbjct  274  PPELGNLKSLRLLDASMNQLTGSIPDELCRVPLESLNLYENNLEGEIPPSIASSPNLYEL  333

Query  692  DL  697
             +
Sbjct  334  RI  335


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 78/160 (49%), Gaps = 18/160 (11%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMI---MGGSFPASAIICQLNN  394
            WG P   L E  N++ S     G   NS G  + +SL  +      GS P    I  LNN
Sbjct  421  WGLPHVYLLELINNSFS-----GEISNSIGGASNLSLLILTNNQFTGSLPEE--IGSLNN  473

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  ++ S N L G++P +L +  +L+      N  +G+I  E  S+  L  L+L GN+  
Sbjct  474  LNELSASGNKLSGSLPDSLMNLGELD------NQFSGRIPDEIGSLSVLNYLDLSGNLFS  527

Query  575  GEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYL  691
            G+IP  + +  L  L++S+N L G +P  +    Y  S+L
Sbjct  528  GKIPVSLQSLKLNQLNLSTNRLTGDLPPSLAKEMYKNSFL  567


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 63/131 (48%), Gaps = 7/131 (5%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+TR+ L+     G  P       L ++  +   +NS  G I  ++   S L  L L+ N
Sbjct  401  SLTRVRLAYNRFSGQVPTG--FWGLPHVYLLELINNSFSGEISNSIGGASNLSLLILTNN  458

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
              TG +  E  S+  L  L+  GN L G +P      SL +L    N  +G IPD+IG+ 
Sbjct  459  QFTGSLPEEIGSLNNLNELSASGNKLSGSLPD-----SLMNLGELDNQFSGRIPDEIGSL  513

Query  674  YNLSYLDLSMN  706
              L+YLDLS N
Sbjct  514  SVLNYLDLSGN  524


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 62/130 (48%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + +SE    G  PA   +C    L  +    NS  G IP +L  C  L  + L+ N  +G
Sbjct  357  LDVSENEFSGELPAD--LCGKGELEELLIIHNSFSGAIPESLGDCRSLTRVRLAYNRFSG  414

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            ++   F+ +  +  L L  N   GEI   +   S L  L +++N   GS+P++IG+  NL
Sbjct  415  QVPTGFWGLPHVYLLELINNSFSGEISNSIGGASNLSLLILTNNQFTGSLPEEIGSLNNL  474

Query  683  SYLDLSMNSL  712
            + L  S N L
Sbjct  475  NELSASGNKL  484



>ref|XP_006415654.1| hypothetical protein EUTSA_v10006677mg [Eutrema salsugineum]
 gb|ESQ34007.1| hypothetical protein EUTSA_v10006677mg [Eutrema salsugineum]
Length=1000

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 97/174 (56%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTS-SPCDWPGISCNSN-GSVTRISLSEMIMGGSFPA  367
            E  IL  +K     P S    WNS   SPC W GISC  +  SVT + LS   + G FP+
Sbjct  23   EGFILQQVKLSLDDPDSSLSSWNSRDLSPCRWSGISCAGDFSSVTSVDLSGFNLAGPFPS  82

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            +  IC+L+NL  ++  +NS+  T+P ++ +C  L TLDLS N LTG+I      +  L S
Sbjct  83   A--ICRLSNLSYLSLYNNSINSTLPLDIGACKSLRTLDLSQNLLTGEIPHTLADLPILTS  140

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN   G+IP     +  LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  141  LDLTGNNFSGDIPASFGRFENLEVLALVYNLLDGTIPPFLGNISSLKMLNLSYN  194


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 67/122 (55%), Gaps = 2/122 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L+ LV ++ + N L G IP +L   + +  ++L  N LTG+I
Sbjct  216  LTECHLIGQIPDS--LGRLSRLVDLDLALNDLVGPIPRSLGGLTSVVQIELYNNSLTGEI  273

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G IP  +    LESL++  N+L G IP  I +  NL  L
Sbjct  274  PPELGNLKSLRLLDASMNQLTGSIPDELCRVPLESLNLYENNLEGEIPPSIASSPNLYEL  333

Query  692  DL  697
             +
Sbjct  334  RI  335


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 84/167 (50%), Gaps = 13/167 (8%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMI---MGGSFPASAIICQLNN  394
            WG P   L E  N++ S     G   NS G  + +SL  +      GS P    I  LNN
Sbjct  421  WGLPHVYLLELINNSFS-----GEISNSIGGASNLSLLILTNNQFTGSLPEE--IGSLNN  473

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  ++ S N L G++P +L +  +L TLDL  N  +G+++ +  S K L  LNL  N   
Sbjct  474  LNELSASGNKLSGSLPDSLMNLGELGTLDLHGNRFSGELSPKIKSWKKLNELNLADNQFS  533

Query  575  GEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            G IP  + + S L  LD+S N  +G IP  + +   L+ L+LS N L
Sbjct  534  GRIPDEIGSLSVLNYLDLSGNLFSGKIPVSLQSL-KLNQLNLSTNRL  579


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 3/126 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  +S S   + GS P S  +  L  L +++   N   G +   + S  KL  L+L+ N 
Sbjct  474  LNELSASGNKLSGSLPDS--LMNLGELGTLDLHGNRFSGELSPKIKSWKKLNELNLADNQ  531

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-F  673
             +G+I  E  S+  L  L+L GN+  G+IP  + +  L  L++S+N L G +P  +    
Sbjct  532  FSGRIPDEIGSLSVLNYLDLSGNLFSGKIPVSLQSLKLNQLNLSTNRLTGDLPPSLAKEM  591

Query  674  YNLSYL  691
            Y  S+L
Sbjct  592  YKNSFL  597



>gb|ADE76066.1| unknown [Picea sitchensis]
Length=287

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 89/161 (55%), Gaps = 4/161 (2%)
 Frame = +2

Query  236  PFSLFEQWNSTSS-PCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINF  412
            P ++   WNS+   PC W G+SC+ + +V  + L+  ++ G+   S  I  L  L ++  
Sbjct  41   PPNIIRSWNSSDKYPCHWEGVSCHRDHTVNVLDLTGQLISGTL--SPAIGGLRKLRALYL  98

Query  413  SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
            SSN+L  TIP  L +C++LE LDLS N+L G I  E   +  L  L+L  N L G IP  
Sbjct  99   SSNTLSATIPRELGNCTELEYLDLSENNLHGHIPLEVGRLTKLSYLSLYSNFLTGTIPPS  158

Query  593  MVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +     LE + ++ N+L G IP ++GN   LS L L+ N L
Sbjct  159  IFGLPLLEEIYLNQNNLTGEIPSNVGNLTKLSSLWLAENKL  199



>ref|XP_006442130.1| hypothetical protein CICLE_v10024208mg [Citrus clementina]
 gb|ESR55370.1| hypothetical protein CICLE_v10024208mg [Citrus clementina]
Length=1566

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 83/151 (55%), Gaps = 16/151 (11%)
 Frame = +2

Query  263  STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIP  442
            S  SPC W GISCN  G V +ISL  + + G+               +N S N++ G IP
Sbjct  62   SKISPCAWSGISCNDAGRVIKISLPGVGLKGT---------------LNVSMNNITGGIP  106

Query  443  ANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESL  619
              + + S+L+ LDLS+N + G+I  E   + +L  L LRGN L G +PT + +   LE L
Sbjct  107  REIRNMSQLQVLDLSLNHIVGEIPKELGKLNSLSKLILRGNQLTGRLPTEIGSLIELEYL  166

Query  620  DVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            D S+N LN S+P+ +GN   L YL LS N  
Sbjct  167  DFSANRLNNSVPEILGNLLKLHYLGLSNNQF  197


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +2

Query  392   NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
              L ++N S N++ G IP  + + S+L+ LDLS+N + G+I  E   + +L  L LRGN L
Sbjct  1080  KLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQL  1139

Query  572   FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              G +PT + +   LE LD S+N  N S+P+ +GN   L YL LS N  
Sbjct  1140  TGRLPTEIGSLIELEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQF  1187


 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 83/163 (51%), Gaps = 7/163 (4%)
 Frame = +2

Query  242  SLFEQW-----NSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSI  406
            SL   W     N +S    W GI+CN  G V  I+L+   + G+    +      +L  +
Sbjct  691  SLLSSWINDATNVSSKISAWSGINCNDAGRVININLTNTGLSGTLHDFSF-SSFPHLAYL  749

Query  407  NFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIP  586
            +   N L+G IP  + + SKL+ L L  N+ +G+I  E   +  L+ L L  N L G IP
Sbjct  750  DLRLNELFGIIPPQIGNLSKLQLLSLHANNFSGRIPSEICLLTHLKVLFLHSNNLNGPIP  809

Query  587  TPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              +    +L  L + +N L+GSIP +IGN  +L  LDLS+N L
Sbjct  810  PSLGNLNNLVKLFLLNNSLSGSIPPNIGNLRSLLELDLSINQL  852


 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 71/147 (48%), Gaps = 27/147 (18%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P S  +  LNNLV +   +NSL G+IP N+ +   L  LDLSIN L+G I     
Sbjct  804  LNGPIPPS--LGNLNNLVKLFLLNNSLSGSIPPNIGNLRSLLELDLSINQLSGSIPPSVG  861

Query  527  SMKTLRSLNLRGNMLFGEIP----------------TPMVAY---------SLESLDVSS  631
            ++ ++  L L GN  +G IP                  ++ Y          L  L +S 
Sbjct  862  NLSSMTRLYLYGNSFYGSIPPNVGNLKSLSDLQLNDNQLIGYIPRSFSNLTGLSILRLSK  921

Query  632  NDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N+L GSIPD+IG   +LS LDLS N  
Sbjct  922  NELFGSIPDEIGKIRSLSILDLSQNQF  948


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = +2

Query  392   NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
             NL  ++ S N+ +G I +N     KL TL++S+N++TG I  E  +   L++L+L  N +
Sbjct  1056  NLTFMDLSRNNFYGEISSNWGKYPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNHI  1115

Query  572   FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              GEIP  +    SL  L +  N L G +P +IG+   L YLD S N  
Sbjct  1116  VGEIPKELGKLNSLTKLILRGNQLTGRLPTEIGSLIELEYLDFSANRF  1163


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 69/133 (52%), Gaps = 3/133 (2%)
 Frame = +2

Query  317   VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
             +T + L E    G  P +  IC+   L   + S N   GTIP +L +C+ L  + L+ N+
Sbjct  985   LTMLVLDENHFTGYLPHN--ICRGGALQYFSVSENHFQGTIPESLRNCTSLIRVRLNGNN  1042

Query  497   LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
              TG I+        L  ++L  N  +GEI +    Y  L +L+VS N++ G IP +IGN 
Sbjct  1043  FTGNISEALGIYPNLTFMDLSRNNFYGEISSNWGKYPKLGTLNVSMNNITGGIPREIGNS  1102

Query  674   YNLSYLDLSMNSL  712
               L  LDLS+N +
Sbjct  1103  SQLQALDLSLNHI  1115


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 69/134 (51%), Gaps = 3/134 (2%)
 Frame = +2

Query  314   SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             S+T++ L    + G  P    I  L  L  ++FS+N    ++P  L +  KL  L LS N
Sbjct  1128  SLTKLILRGNQLTGRLPTE--IGSLIELEYLDFSANRFNNSVPEILGNLLKLHYLGLSNN  1185

Query  494   DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
                 ++  E   +  L  L+   N+  GEIP  + +  SLE L++S N+L+GSIP+    
Sbjct  1186  QFVQELPKELEKLVQLSELDASHNLFGGEIPFQICSLKSLEKLNLSHNNLSGSIPNCFDG  1245

Query  671   FYNLSYLDLSMNSL  712
              + LS +D+S N L
Sbjct  1246  MHGLSVIDISDNQL  1259



>ref|XP_002278863.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=990

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 97/174 (56%), Gaps = 6/174 (3%)
 Frame = +2

Query  188  EDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            +DER+ILL +KQ  G P    + WNS+SSPCDWP I C  N +VT ISL    +    PA
Sbjct  32   DDERSILLDVKQQLGNP-PSLQSWNSSSSPCDWPEIKCTDN-TVTAISLHNKAISEKIPA  89

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            +  IC L NL+ ++ S+N + G  P N+ +CSKLE L L  N   G I  +   +  LR 
Sbjct  90   T--ICDLKNLIVLDLSNNDIPGEFP-NILNCSKLEYLRLLQNFFAGPIPADIDRLSRLRY  146

Query  548  LNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L  N   G+IP  +     L  L +  N+ NG+ P +IGN  NL  L ++ N
Sbjct  147  LDLTANFFSGDIPAAIGQLRELFYLFLVENEFNGTWPTEIGNLANLEQLAMAYN  200


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 1/125 (1%)
 Frame = +2

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
            M+ G SF  +        L  +  S+N   G IP  +SS   +  L+ S N L+GKI  E
Sbjct  437  MLAGNSFSGTLPSKLARYLSRVEISNNKFSGPIPTEISSWMNIAVLNASNNMLSGKIPVE  496

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
            F S+  +  L L GN   GE+P+ ++++ SL  L++S N L+G IP  +G+  NL+YLDL
Sbjct  497  FTSLWNISVLLLDGNQFSGELPSEIISWKSLNDLNLSRNKLSGPIPKALGSLPNLNYLDL  556

Query  698  SMNSL  712
            S N  
Sbjct  557  SENQF  561


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 79/163 (48%), Gaps = 12/163 (7%)
 Frame = +2

Query  233  YPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINF  412
            Y F +  ++N T     WP       G++  +    M     F  SA+  +   L  + +
Sbjct  170  YLFLVENEFNGT-----WP----TEIGNLANLEQLAMAYNDKFMPSALPKEFGALKKLKY  220

Query  413  ---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
               +  +L G IP + ++ S LE LDLS+N L G I G   ++K L +L L  N L G I
Sbjct  221  LWMTDANLIGGIPESFNNLSSLEHLDLSLNKLEGTIPGGMLTLKNLTNLYLFNNRLSGRI  280

Query  584  PTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + A +L+ +D+S N L G IP   G   NL+ L+L  N L
Sbjct  281  PLSIEALNLKEIDLSKNYLTGPIPTGFGKLQNLTGLNLFWNQL  323


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 65/133 (49%), Gaps = 3/133 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  I LS+  + G  P      +L NL  +N   N L G IP N+S    LET  +  N 
Sbjct  289  LKEIDLSKNYLTGPIPTG--FGKLQNLTGLNLFWNQLAGEIPTNISLIPTLETFKVFSNQ  346

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNF  673
            L+G +   F     L+S  +  N L GE+P  + A  +L  +  S+N+L+G +P  +GN 
Sbjct  347  LSGVLPPAFGLHSELKSFEVSENKLSGELPQHLCARGALLGVVASNNNLSGEVPKSLGNC  406

Query  674  YNLSYLDLSMNSL  712
             +L  + LS N  
Sbjct  407  TSLLTIQLSNNRF  419


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 62/130 (48%), Gaps = 5/130 (4%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  ++ S  ++ G  P       L N+  +    N   G +P+ + S   L  L+LS N 
Sbjct  479  IAVLNASNNMLSGKIPVE--FTSLWNISVLLLDGNQFSGELPSEIISWKSLNDLNLSRNK  536

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFY  676
            L+G I     S+  L  L+L  N   G+IP+ +    L  LD+SSN L+G +P +   F 
Sbjct  537  LSGPIPKALGSLPNLNYLDLSENQFLGQIPSELGHLKLTILDLSSNQLSGMVPIE---FQ  593

Query  677  NLSYLDLSMN  706
            N +Y D  +N
Sbjct  594  NGAYQDSFLN  603



>ref|XP_007203222.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
 gb|EMJ04421.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
Length=1018

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 99/187 (53%), Gaps = 12/187 (6%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW---NSTSSPCDW-PGISCNSNGSVTRIS  331
            SQSL    + E+A+LL +K +   P      W    S +S C W P I+C +N SVT +S
Sbjct  30   SQSLQ---DQEQAVLLKIKSYLQSP-PFLSHWIPSTSNTSHCSWQPEITC-TNNSVTGLS  84

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L    +  + P    IC L NL  I+ S N+  G  P    +CSKL+ L+LS N   GKI
Sbjct  85   LVHTNI--TLPVPPFICDLKNLTLIDLSYNNFAGEFPKAFYNCSKLQYLNLSQNSFDGKI  142

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
              +  S+  L+ L+L  N   G+IP  +     L +L +  N+ NGS+P +IGN  NL +
Sbjct  143  PDDIDSLHRLQYLDLSANYFSGDIPAAIGRLQELRNLQLYMNNFNGSVPPEIGNLSNLKH  202

Query  689  LDLSMNS  709
            L LS N+
Sbjct  203  LSLSFNT  209


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 0/108 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L NL ++    ++L G +P  L   + LE LDL+ N L G I    F +K L  + L  
Sbjct  222  KLKNLKTLYIRGSNLIGELPGTLGEMAALEELDLATNSLNGTIPSVLFLLKKLSIIYLYN  281

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            N L G +P  + A +L  +D+S+N L G IP D GN   L++L L +N
Sbjct  282  NSLSGYVPQVVEALNLTVIDISTNHLTGPIPQDYGNLTKLTWLALFLN  329


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 67/134 (50%), Gaps = 5/134 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+TR+ + +    G+ P         NL   +  +N   GTIP  L++   L TL L  N
Sbjct  462  SLTRLEIRDNRFSGNIPTGMSSW---NLKVFDAGNNLFNGTIPQELTALPSLITLSLDQN  518

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             LTG +  E  S K+L  LN   N L G IP  + +   L +LD+S N L+G IP  +G+
Sbjct  519  QLTGFLPSEIMSWKSLNFLNFSRNKLSGPIPAGLGLLPVLTALDLSENQLSGQIPAQLGH  578

Query  671  FYNLSYLDLSMNSL  712
               LS  +LS N L
Sbjct  579  L-KLSNFNLSSNHL  591


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 4/134 (3%)
 Frame = +2

Query  311  GSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
            G ++ +   E  + G  P+S   C   +L  +    N L G IP+ + +   L+ + +S 
Sbjct  391  GKLSTLVAYENNLTGELPSSLGNC--TSLTEVKVYDNGLSGNIPSGMWTAPNLDQVMMSN  448

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
            N LTG++  +    ++L  L +R N   G IPT M +++L+  D  +N  NG+IP ++  
Sbjct  449  NSLTGELPEKI--SRSLTRLEIRDNRFSGNIPTGMSSWNLKVFDAGNNLFNGTIPQELTA  506

Query  671  FYNLSYLDLSMNSL  712
              +L  L L  N L
Sbjct  507  LPSLITLSLDQNQL  520


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  344  IMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF  523
            +  G+ P    +  L +L++++   N L G +P+ + S   L  L+ S N L+G I    
Sbjct  495  LFNGTIPQE--LTALPSLITLSLDQNQLTGFLPSEIMSWKSLNFLNFSRNKLSGPIPAGL  552

Query  524  FSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-FYNLSYLD  694
              +  L +L+L  N L G+IP  +    L + ++SSN L+G IP +  N  Y+ S+LD
Sbjct  553  GLLPVLTALDLSENQLSGQIPAQLGHLKLSNFNLSSNHLSGKIPIEFENPAYDGSFLD  610


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 71/138 (51%), Gaps = 6/138 (4%)
 Frame = +2

Query  311  GSVTRISLSEMIM---GGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLD  481
            G++T+++   + +    G+ PAS  I +L NL       N+L GT+P +    S+LE  +
Sbjct  316  GNLTKLTWLALFLNGFSGAVPAS--IGRLPNLKQFRVFINNLSGTLPPDFGRYSELEGFE  373

Query  482  LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPD  658
            +S N LTGK+         L +L    N L GE+P+ +    SL  + V  N L+G+IP 
Sbjct  374  VSGNRLTGKLPDHLCYRGKLSTLVAYENNLTGELPSSLGNCTSLTEVKVYDNGLSGNIPS  433

Query  659  DIGNFYNLSYLDLSMNSL  712
             +    NL  + +S NSL
Sbjct  434  GMWTAPNLDQVMMSNNSL  451



>sp|P93194.2|RPK1_IPONI RecName: Full=Receptor-like protein kinase; Flags: Precursor 
[Ipomoea nil]
 gb|AAB36558.2| receptor-like protein kinase INRPK1 [Ipomoea nil]
Length=1109

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 92/167 (55%), Gaps = 5/167 (3%)
 Frame = +2

Query  200  AILLILKQHW-GYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            A LL L +HW   P  + + WN S S+PC W G+ C+    V  ++LS   + G F    
Sbjct  29   AALLSLTRHWTSIPSDITQSWNASDSTPCSWLGVECDRRQFVDTLNLSSYGISGEFGPE-  87

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             I  L +L  +  S N  +G+IP+ L +CS LE +DLS N  TG I     +++ LR+L+
Sbjct  88   -ISHLKHLKKVVLSGNGFFGSIPSQLGNCSLLEHIDLSSNSFTGNIPDTLGALQNLRNLS  146

Query  554  LRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
            L  N L G  P  +++   LE++  + N LNGSIP +IGN   L+ L
Sbjct  147  LFFNSLIGPFPESLLSIPHLETVYFTGNGLNGSIPSNIGNMSELTTL  193


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 73/156 (47%), Gaps = 26/156 (17%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            VT I LS   + GS P    +  L  L  +N S N L G +P+ LS+C KL  LD S N 
Sbjct  525  VTAIYLSSNQLSGSIPPE--LGSLVKLEHLNLSHNILKGILPSELSNCHKLSELDASHNL  582

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT-----------------------PMVA-Y  604
            L G I     S+  L  L+L  N   G IPT                       P+ A  
Sbjct  583  LNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNLLAGDIPPVGALQ  642

Query  605  SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +L SL++SSN LNG +P D+G    L  LD+S N+L
Sbjct  643  ALRSLNLSSNKLNGQLPIDLGKLKMLEELDVSHNNL  678


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 66/132 (50%), Gaps = 4/132 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  + L +  + G  P    + +L  LVS+    N   G IP +L + S LE LDL+ N
Sbjct  381  SLQSLQLYQNNLSGELPVD--MTELKQLVSLALYENHFTGVIPQDLGANSSLEVLDLTRN  438

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
              TG I     S K L+ L L  N L G +P+ +   S LE L +  N+L G +PD +  
Sbjct  439  MFTGHIPPNLCSQKKLKRLLLGYNYLEGSVPSDLGGCSTLERLILEENNLRGGLPDFVEK  498

Query  671  FYNLSYLDLSMN  706
              NL + DLS N
Sbjct  499  -QNLLFFDLSGN  509


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 63/145 (43%), Gaps = 27/145 (19%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT----------  502
            G+ P +  +  L NLV ++  +NSL G IP +  SC +++T+ LS N  T          
Sbjct  226  GTLPVT--LNNLENLVYLDVRNNSLVGAIPLDFVSCKQIDTISLSNNQFTGGLPPGLGNC  283

Query  503  --------------GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSND  637
                          G I   F  +  L +L L GN   G IP  +    S+  L +  N 
Sbjct  284  TSLREFGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQ  343

Query  638  LNGSIPDDIGNFYNLSYLDLSMNSL  712
            L G IP ++G    L YL L  N+L
Sbjct  344  LEGEIPGELGMLSQLQYLHLYTNNL  368


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P S  I ++ +L S+    N+L G +P +++   +L +L L  N  TG I  +  
Sbjct  368  LSGEVPLS--IWKIQSLQSLQLYQNNLSGELPVDMTELKQLVSLALYENHFTGVIPQDLG  425

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            +  +L  L+L  NM  G IP  + +   L+ L +  N L GS+P D+G    L  L L  
Sbjct  426  ANSSLEVLDLTRNMFTGHIPPNLCSQKKLKRLLLGYNYLEGSVPSDLGGCSTLERLILEE  485

Query  704  NSL  712
            N+L
Sbjct  486  NNL  488



>gb|EAY81072.1| hypothetical protein OsI_36252 [Oryza sativa Indica Group]
Length=250

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 93/175 (53%), Gaps = 4/175 (2%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            E  IL   +  W  PF++ + W+ T  +PC W  ++CN+N SV R+ L   + G S P  
Sbjct  28   EGDILYAQRLAWKDPFNVLQSWDPTLVNPCTWFHVTCNNNNSVVRVDLG--LAGLSGPLI  85

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
              +  L+ L       N L G+IPA L + S L +LDL  N LTG I     ++ TLR+L
Sbjct  86   PQLGGLSYLQYFELYGNELNGSIPAALGNLSSLVSLDLQGNLLTGAIPDSLGAISTLRNL  145

Query  551  NLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L GN L G IP  + +  SL  L++  N L+G+IP  +G    L  L L+ NSL
Sbjct  146  RLYGNNLTGTIPQSLGSLTSLVKLELQKNSLSGTIPASLGKIKTLEILRLNKNSL  200



>ref|XP_010923812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 isoform X3 [Elaeis guineensis]
Length=1104

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 85/154 (55%), Gaps = 5/154 (3%)
 Frame = +2

Query  257  WNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWG  433
            WNS+ SSPC W GI C     VT I L ++ + GS  AS  IC L  L   N S N + G
Sbjct  49   WNSSDSSPCHWNGIGC-IKFEVTSIVLHDLKLQGSLSAS--ICHLRFLTVFNVSKNKISG  105

Query  434  TIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-L  610
            +IP +L+SC  LE LDLS N+  G+I  E   +  LR L L  N L GEIP+ +   + L
Sbjct  106  SIPTDLASCGNLEVLDLSTNEFHGEIPPELCGLSLLRKLFLSENYLHGEIPSSIGNLTWL  165

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L + SN+L G IP  I    NL  +   +N+L
Sbjct  166  QELVIYSNNLTGKIPPSIRLMKNLRIIRAGLNNL  199


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  I+L++    G  P    I +L+ L  +   +N L GTIP  L +C     +DLS N
Sbjct  260  SLEMIALNDNAFTGGVPKE--IGRLSMLKRLYLYTNQLDGTIPRELGNCESALEIDLSEN  317

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I  E   ++TLR L+L  N+L G IP+ +   S L+ +D+S N+L G+IP +  N
Sbjct  318  RLTGIIPRELGRIQTLRLLHLFENLLQGSIPSELGQLSLLKRIDLSINNLTGTIPLEFQN  377

Query  671  FYNLSYLDLSMNSL  712
              +L Y  L  N+L
Sbjct  378  LSSLEYFQLFDNNL  391


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 71/134 (53%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LS+    G  P    I +L +LVS N SSN L G IP  L+ C+KL+ +DLS N 
Sbjct  501  LERLFLSDNYFIGHIPPE--IGELADLVSFNISSNQLSGAIPRELAKCTKLQRVDLSRNW  558

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
             TG +  +  S+  L  L L  N L G IP+ +   S L  L +  N+ +G IP ++G  
Sbjct  559  FTGFVPKDLGSLVNLEQLKLSDNHLNGTIPSSLGRLSRLTELQMGGNNFSGHIPTELGQL  618

Query  674  YNLSY-LDLSMNSL  712
              L   L++S N L
Sbjct  619  TTLQIALNISYNVL  632


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    + ++  L  ++   N L G+IP+ L   S L+ +DLSIN
Sbjct  308  SALEIDLSENRLTGIIPRE--LGRIQTLRLLHLFENLLQGSIPSELGQLSLLKRIDLSIN  365

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
            +LTG I  EF ++ +L    L  N L G IP  + + S L  LD+S N L GSIP  +  
Sbjct  366  NLTGTIPLEFQNLSSLEYFQLFDNNLEGVIPPLLGSNSNLSVLDLSDNKLTGSIPAYLCK  425

Query  671  FYNLSYLDLSMNSL  712
            +  L +L L  N L
Sbjct  426  YQKLIFLSLGSNML  439


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 53/106 (50%), Gaps = 1/106 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  ++ S N L G+IPA L    KL  L L  N L+G I     + K L  L L GN+L
Sbjct  404  NLSVLDLSDNKLTGSIPAYLCKYQKLIFLSLGSNMLSGNIPHGVKTCKPLVQLRLGGNLL  463

Query  572  FGEIPTPMVAYSLESL-DVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             G +P  +      S  D+S N  +G IP +IG   NL  L LS N
Sbjct  464  TGSLPVALSGLLNLSSLDMSQNRFSGPIPPEIGKLKNLERLFLSDN  509



>ref|XP_010923813.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 isoform X4 [Elaeis guineensis]
Length=1103

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 85/154 (55%), Gaps = 5/154 (3%)
 Frame = +2

Query  257  WNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWG  433
            WNS+ SSPC W GI C     VT I L ++ + GS  AS  IC L  L   N S N + G
Sbjct  49   WNSSDSSPCHWNGIGC-IKFEVTSIVLHDLKLQGSLSAS--ICHLRFLTVFNVSKNKISG  105

Query  434  TIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-L  610
            +IP +L+SC  LE LDLS N+  G+I  E   +  LR L L  N L GEIP+ +   + L
Sbjct  106  SIPTDLASCGNLEVLDLSTNEFHGEIPPELCGLSLLRKLFLSENYLHGEIPSSIGNLTWL  165

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L + SN+L G IP  I    NL  +   +N+L
Sbjct  166  QELVIYSNNLTGKIPPSIRLMKNLRIIRAGLNNL  199


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  I+L++    G  P    I +L+ L  +   +N L GTIP  L +C     +DLS N
Sbjct  260  SLEMIALNDNAFTGGVPKE--IGRLSMLKRLYLYTNQLDGTIPRELGNCESALEIDLSEN  317

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I  E   ++TLR L+L  N+L G IP+ +   S L+ +D+S N+L G+IP +  N
Sbjct  318  RLTGIIPRELGRIQTLRLLHLFENLLQGSIPSELGQLSLLKRIDLSINNLTGTIPLEFQN  377

Query  671  FYNLSYLDLSMNSL  712
              +L Y  L  N+L
Sbjct  378  LSSLEYFQLFDNNL  391


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 71/134 (53%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LS+    G  P    I +L +LVS N SSN L G IP  L+ C+KL+ +DLS N 
Sbjct  501  LERLFLSDNYFIGHIPPE--IGELADLVSFNISSNQLSGAIPRELAKCTKLQRVDLSRNW  558

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
             TG +  +  S+  L  L L  N L G IP+ +   S L  L +  N+ +G IP ++G  
Sbjct  559  FTGFVPKDLGSLVNLEQLKLSDNHLNGTIPSSLGRLSRLTELQMGGNNFSGHIPTELGQL  618

Query  674  YNLSY-LDLSMNSL  712
              L   L++S N L
Sbjct  619  TTLQIALNISYNVL  632


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    + ++  L  ++   N L G+IP+ L   S L+ +DLSIN
Sbjct  308  SALEIDLSENRLTGIIPRE--LGRIQTLRLLHLFENLLQGSIPSELGQLSLLKRIDLSIN  365

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
            +LTG I  EF ++ +L    L  N L G IP  + + S L  LD+S N L GSIP  +  
Sbjct  366  NLTGTIPLEFQNLSSLEYFQLFDNNLEGVIPPLLGSNSNLSVLDLSDNKLTGSIPAYLCK  425

Query  671  FYNLSYLDLSMNSL  712
            +  L +L L  N L
Sbjct  426  YQKLIFLSLGSNML  439


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 53/106 (50%), Gaps = 1/106 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  ++ S N L G+IPA L    KL  L L  N L+G I     + K L  L L GN+L
Sbjct  404  NLSVLDLSDNKLTGSIPAYLCKYQKLIFLSLGSNMLSGNIPHGVKTCKPLVQLRLGGNLL  463

Query  572  FGEIPTPMVAYSLESL-DVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             G +P  +      S  D+S N  +G IP +IG   NL  L LS N
Sbjct  464  TGSLPVALSGLLNLSSLDMSQNRFSGPIPPEIGKLKNLERLFLSDN  509



>ref|XP_011029916.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Populus euphratica]
Length=1049

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 98/183 (54%), Gaps = 28/183 (15%)
 Frame = +2

Query  242  SLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSN  421
            SL   W +  +PC+W GI+C+  G++T++SL +  + G+         LN L+ +N  +N
Sbjct  70   SLLSSW-AGDNPCNWEGITCDKTGNITKLSLQDCSLRGTLHGLQFSSFLN-LIELNLRNN  127

Query  422  SLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA  601
            SL+GTIP+++S+ SKL  LDLS N ++G I  E  S+ +L   +L  N++ G IP+  + 
Sbjct  128  SLYGTIPSHISNLSKLIVLDLSQNQISGSIPSEIGSLTSLELFSLMKNLINGSIPSNSIG  187

Query  602  --------------------------YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
                                       SL  L++SSN+L G+IP  IGN  NL YLDL  
Sbjct  188  NLSNLVHLHLNDNELSGAIPQELGRMKSLVLLNLSSNNLTGAIPSSIGNLSNLVYLDLLK  247

Query  704  NSL  712
            N L
Sbjct  248  NKL  250


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (56%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T+++L+   + GS P    + +L+NL+ +NFS N   GT+P  + +   L++LDLS N 
Sbjct  528  ITKLNLAANYLSGSIPKQ--LGELSNLLFLNFSKNKFTGTVPPEMGNLRSLQSLDLSWNY  585

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            L G I  +    K L +LN+  NM+ G IPT      SL ++D+S NDL G  P +I  F
Sbjct  586  LQGYIPPQLGQFKHLETLNISHNMMSGSIPTTFADLLSLVTVDISYNDLEGPAP-EIKAF  644

Query  674  YNLSYLDLSMNSL  712
                Y  +  N+L
Sbjct  645  SEAPYEAIRNNNL  657


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  ++LS   + G+ P+S  I  L+NLV ++   N L G++P  +     L TL L  N
Sbjct  215  SLVLLNLSSNNLTGAIPSS--IGNLSNLVYLDLLKNKLSGSVPEEVGMLENLRTLQLGGN  272

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIG  667
             L G I     +M++L  L+LR N L G IP  M  +  SL  +D++ N+L G+IP  +G
Sbjct  273  SLDGTIHTSIGNMRSLTVLDLRENYLTGTIPASMGNLTRSLTFIDLAFNNLTGTIPSSLG  332

Query  668  NFYNLSYLDLSMNSL  712
            N  +LS+L L  N+L
Sbjct  333  NLRSLSFLYLPSNNL  347


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 79/134 (59%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  + L++  + G+ P    + ++ +LV +N SSN+L G IP+++ + S L  LDL  N 
Sbjct  192  LVHLHLNDNELSGAIPQE--LGRMKSLVLLNLSSNNLTGAIPSSIGNLSNLVYLDLLKNK  249

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            L+G +  E   ++ LR+L L GN L G I T +    SL  LD+  N L G+IP  +GN 
Sbjct  250  LSGSVPEEVGMLENLRTLQLGGNSLDGTIHTSIGNMRSLTVLDLRENYLTGTIPASMGNL  309

Query  674  -YNLSYLDLSMNSL  712
              +L+++DL+ N+L
Sbjct  310  TRSLTFIDLAFNNL  323


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 65/134 (49%), Gaps = 24/134 (18%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI-----------------  511
            Q  +L+++  S+N + G IPA L   ++L+ +DLS N L G+I                 
Sbjct  453  QFQSLMTLRVSNNRISGEIPAELEKATQLQAIDLSSNHLVGEIPKELGKLKLLELTLNNN  512

Query  512  --AGEFFSMKT----LRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
              +G+  S+      +  LNL  N L G IP  +   S L  L+ S N   G++P ++GN
Sbjct  513  NLSGDVTSVIATIPYITKLNLAANYLSGSIPKQLGELSNLLFLNFSKNKFTGTVPPEMGN  572

Query  671  FYNLSYLDLSMNSL  712
              +L  LDLS N L
Sbjct  573  LRSLQSLDLSWNYL  586


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 1/99 (1%)
 Frame = +2

Query  419  NSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV  598
            N   G IP +L SC+ L  L +  N L+G I+ +      +  +NL  N  +GE+     
Sbjct  393  NDFTGPIPKSLRSCTSLVRLRIERNQLSGNISNDLGVYPNMTYINLSDNEFYGELSWKWE  452

Query  599  AY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             + SL +L VS+N ++G IP ++     L  +DLS N L
Sbjct  453  QFQSLMTLRVSNNRISGEIPAELEKATQLQAIDLSSNHL  491



>ref|XP_008362962.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Malus domestica]
Length=1018

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 101/185 (55%), Gaps = 15/185 (8%)
 Frame = +2

Query  164  SQSLTTYGEDERAILLILKQHWGYPFSLFEQW----NSTSSPCDWPGISCNSNGSVTRIS  331
            SQSL    + E+A+LL LK +   P SL   W    ++TSS C WP ISC +N SVT + 
Sbjct  30   SQSLQ---DQEQAVLLKLKSYLXSPPSL-SHWIPSNSNTSSHCSWPEISC-TNNSVTGLL  84

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L  + +  + P    IC L NL  ++ + N L G  P +L  CSKLE LDLS N   G I
Sbjct  85   LVNLNI--TLPVPPFICDLTNLTLVDLNXNYLXGEFPKSLYKCSKLEYLDLSQNYFVGPI  142

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYNLS  685
              +  S+  L+ L L GN  F  IP P +     LE+L +  N  NGS+P +IGN  NL 
Sbjct  143  PDDIDSLPRLKQLILAGNN-FSNIP-PAIGRLQELENLQLWMNQFNGSVPPEIGNLSNLK  200

Query  686  YLDLS  700
             L++S
Sbjct  201  DLNMS  205


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +L  L ++    ++L G +P  L     LE +DL+IN L+G+I    F++K L  + L  
Sbjct  221  KLKKLSNLWIRQSNLIGELPETLGEMEALEVIDLAINXLSGRIPNXLFTLKNLSIVYLFK  280

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            N L GE+P  + +++L  LD+S N L+G+IP++ GN   L+ L L +N
Sbjct  281  NTLSGEVPQVIESWNLSILDISENTLSGTIPEEYGNLTKLTZLALFLN  328


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  ++ S N+L GTIP    + +KL  L L +ND +G+I      +  LR   +  N  
Sbjct  295  NLSILDISENTLSGTIPEEYGNLTKLTZLALFLNDFSGEIPKSIGRLPNLRDFKIFNNNF  354

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI  664
             G +P  +  YS LE+  V  N L G +PDD+
Sbjct  355  SGTLPPELGKYSKLEAFQVXVNRLTGKLPDDL  386


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 67/134 (50%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
             +T ++L      G  P S  I +L NL      +N+  GT+P  L   SKLE   + +N
Sbjct  319  KLTZLALFLNDFSGEIPKS--IGRLPNLRDFKIFNNNFSGTLPPELGKYSKLEAFQVXVN  376

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
             LTGK+  +      L  +   GN L GE+P+ +    SL+ + V  N L+G+IP  +  
Sbjct  377  RLTGKLPDDLCYWGKLDDVIAYGNXLSGELPSSLGNCSSLKXVKVQDNMLSGNIPSGMWT  436

Query  671  FYNLSYLDLSMNSL  712
              NL+ + +S NSL
Sbjct  437  APNLTTVLVSNNSL  450


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            ++R+ + +    G+ P    +     L   +  +N L G +P  L++ S L TL L  N 
Sbjct  462  LSRLEMRDNXXSGNIPTG--VSSWTGLKVFDAGNNHLSGAVPRELTALSSLMTLSLDQNQ  519

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNF  673
            LTG +  +  S ++L SLN   N L G IP    +   L  LD+S+N L+G IPD +G  
Sbjct  520  LTGSLPSDIVSWESLASLNFSRNQLSGTIPEKLGLLPGLTGLDLSANQLSGEIPDQLGRL  579

Query  674  YNLSYLDLSMNSL  712
              L+  +LS N L
Sbjct  580  -KLNQFNLSSNXL  591


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 63/117 (54%), Gaps = 3/117 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P    +  L++L++++   N L G++P+++ S   L +L+ S N L+G I  +  
Sbjct  496  LSGAVPRE--LTALSSLMTLSLDQNQLTGSLPSDIVSWESLASLNFSRNQLSGTIPEKLG  553

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
             +  L  L+L  N L GEIP  +    L   ++SSN L G IP +  N  Y  S+LD
Sbjct  554  LLPGLTGLDLSANQLSGEIPDQLGRLKLNQFNLSSNXLXGXIPXEFENXAYEGSFLD  610



>ref|XP_010923809.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 isoform X2 [Elaeis guineensis]
 ref|XP_010923810.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 isoform X2 [Elaeis guineensis]
Length=1113

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 85/154 (55%), Gaps = 5/154 (3%)
 Frame = +2

Query  257  WNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWG  433
            WNS+ SSPC W GI C     VT I L ++ + GS  AS  IC L  L   N S N + G
Sbjct  49   WNSSDSSPCHWNGIGC-IKFEVTSIVLHDLKLQGSLSAS--ICHLRFLTVFNVSKNKISG  105

Query  434  TIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-L  610
            +IP +L+SC  LE LDLS N+  G+I  E   +  LR L L  N L GEIP+ +   + L
Sbjct  106  SIPTDLASCGNLEVLDLSTNEFHGEIPPELCGLSLLRKLFLSENYLHGEIPSSIGNLTWL  165

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L + SN+L G IP  I    NL  +   +N+L
Sbjct  166  QELVIYSNNLTGKIPPSIRLMKNLRIIRAGLNNL  199


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  I+L++    G  P    I +L+ L  +   +N L GTIP  L +C     +DLS N
Sbjct  260  SLEMIALNDNAFTGGVPKE--IGRLSMLKRLYLYTNQLDGTIPRELGNCESALEIDLSEN  317

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I  E   ++TLR L+L  N+L G IP+ +   S L+ +D+S N+L G+IP +  N
Sbjct  318  RLTGIIPRELGRIQTLRLLHLFENLLQGSIPSELGQLSLLKRIDLSINNLTGTIPLEFQN  377

Query  671  FYNLSYLDLSMNSL  712
              +L Y  L  N+L
Sbjct  378  LSSLEYFQLFDNNL  391


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 71/134 (53%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LS+    G  P    I +L +LVS N SSN L G IP  L+ C+KL+ +DLS N 
Sbjct  501  LERLFLSDNYFIGHIPPE--IGELADLVSFNISSNQLSGAIPRELAKCTKLQRVDLSRNW  558

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
             TG +  +  S+  L  L L  N L G IP+ +   S L  L +  N+ +G IP ++G  
Sbjct  559  FTGFVPKDLGSLVNLEQLKLSDNHLNGTIPSSLGRLSRLTELQMGGNNFSGHIPTELGQL  618

Query  674  YNLSY-LDLSMNSL  712
              L   L++S N L
Sbjct  619  TTLQIALNISYNVL  632


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    + ++  L  ++   N L G+IP+ L   S L+ +DLSIN
Sbjct  308  SALEIDLSENRLTGIIPRE--LGRIQTLRLLHLFENLLQGSIPSELGQLSLLKRIDLSIN  365

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
            +LTG I  EF ++ +L    L  N L G IP  + + S L  LD+S N L GSIP  +  
Sbjct  366  NLTGTIPLEFQNLSSLEYFQLFDNNLEGVIPPLLGSNSNLSVLDLSDNKLTGSIPAYLCK  425

Query  671  FYNLSYLDLSMNSL  712
            +  L +L L  N L
Sbjct  426  YQKLIFLSLGSNML  439


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 53/106 (50%), Gaps = 1/106 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  ++ S N L G+IPA L    KL  L L  N L+G I     + K L  L L GN+L
Sbjct  404  NLSVLDLSDNKLTGSIPAYLCKYQKLIFLSLGSNMLSGNIPHGVKTCKPLVQLRLGGNLL  463

Query  572  FGEIPTPMVAYSLESL-DVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             G +P  +      S  D+S N  +G IP +IG   NL  L LS N
Sbjct  464  TGSLPVALSGLLNLSSLDMSQNRFSGPIPPEIGKLKNLERLFLSDN  509



>pdb|4MN8|B Chain B, Crystal Structure Of Flg22 In Complex With The Fls2 
And Bak1 Ectodomains
Length=226

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 88/163 (54%), Gaps = 4/163 (2%)
 Frame = +2

Query  173  LTTYGEDERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCNSNGSVTRISLSEMIM  349
            L   G  E   L  LK     P  + + W++T  +PC W  ++CNS+ SVTR+ L    +
Sbjct  21   LRVSGNAEGDALSALKNSLADPNKVLQSWDATLVTPCTWFHVTCNSDNSVTRVDLGNANL  80

Query  350  GGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
             G       + QL NL  +   SN++ GTIP  L + ++L +LDL +N+L+G I      
Sbjct  81   SGQLVMQ--LGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGR  138

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIP  655
            +K LR L L  N L GEIP  + A  +L+ LD+S+N L G IP
Sbjct  139  LKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTGDIP  181



>ref|XP_006388198.1| hypothetical protein POPTR_0290s00240g, partial [Populus trichocarpa]
 gb|ERP47112.1| hypothetical protein POPTR_0290s00240g, partial [Populus trichocarpa]
Length=577

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 96/174 (55%), Gaps = 4/174 (2%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASA  373
            E+ ILL LKQ  G P    + WNS+SSPC+W G++C  +GSV+ + L +  +  + PA+ 
Sbjct  36   EKTILLKLKQQLGNP-PSIQSWNSSSSPCNWTGVTCGGDGSVSELHLGDKNITETIPAT-  93

Query  374  IICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
             +C L NL  +  + N + G  P  L SC+KL+ LDLS N   G I  +   +  LR +N
Sbjct  94   -VCDLKNLTFLEMNFNHIPGGFPKVLYSCTKLQHLDLSQNFFFGPIPDDIDKLSGLRYIN  152

Query  554  LRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            L  N   G IP  M   + L++L +  N  NG++P +I    NL  L L++N  
Sbjct  153  LGANNFTGNIPPQMANLTGLQTLFLYQNQFNGTLPKEISKLSNLEELGLAINEF  206


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  +     +L G IP +L++ S LE LDL+ NDL GKI    FS+K L  L L  
Sbjct  217  QLKKLRYLWMRLANLIGEIPESLTNLSSLEHLDLAENDLEGKIPDGLFSLKNLTYLYLFQ  276

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIG  667
            N L GEIP  +   +L  +D++ N LNGSIP+D G
Sbjct  277  NKLSGEIPQRVETLNLVEIDLAMNQLNGSIPEDFG  311


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLT-GKIAGEFFSMKTLRSLN  553
            +  L  L ++    N   GT+P  +S  S LE L L+IN+     I  EF  +K LR L 
Sbjct  166  MANLTGLQTLFLYQNQFNGTLPKEISKLSNLEELGLAINEFVPSSIPVEFGQLKKLRYLW  225

Query  554  LRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            +R   L GEIP  +    SLE LD++ NDL G IPD + +  NL+YL L  N L
Sbjct  226  MRLANLIGEIPESLTNLSSLEHLDLAENDLEGKIPDGLFSLKNLTYLYLFQNKL  279


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  +   +N   G IP  +SS   L     S N L+G+I  E  S+  L +L L GN  
Sbjct  457  NLSKLELGNNRFSGPIPPGISSWVNLVDFKASNNLLSGEIPVEITSLPHLSNLLLDGNQF  516

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             G++P+ ++++ SL SL++S N L+G IP +IG+  +L YLDLS N
Sbjct  517  SGQLPSKIISWKSLTSLNLSRNALSGQIPKEIGSLPDLLYLDLSQN  562


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 1/89 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NLV    S+N L G IP  ++S   L  L L  N  +G++  +  S K+L SLNL  N L
Sbjct  481  NLVDFKASNNLLSGEIPVEITSLPHLSNLLLDGNQFSGQLPSKIISWKSLTSLNLSRNAL  540

Query  572  FGEIPTPMVAY-SLESLDVSSNDLNGSIP  655
             G+IP  + +   L  LD+S N  +G IP
Sbjct  541  SGQIPKEIGSLPDLLYLDLSQNHFSGEIP  569



>ref|XP_010923807.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 isoform X1 [Elaeis guineensis]
 ref|XP_010923808.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 isoform X1 [Elaeis guineensis]
Length=1115

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 85/154 (55%), Gaps = 5/154 (3%)
 Frame = +2

Query  257  WNST-SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWG  433
            WNS+ SSPC W GI C     VT I L ++ + GS  AS  IC L  L   N S N + G
Sbjct  49   WNSSDSSPCHWNGIGC-IKFEVTSIVLHDLKLQGSLSAS--ICHLRFLTVFNVSKNKISG  105

Query  434  TIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-L  610
            +IP +L+SC  LE LDLS N+  G+I  E   +  LR L L  N L GEIP+ +   + L
Sbjct  106  SIPTDLASCGNLEVLDLSTNEFHGEIPPELCGLSLLRKLFLSENYLHGEIPSSIGNLTWL  165

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            + L + SN+L G IP  I    NL  +   +N+L
Sbjct  166  QELVIYSNNLTGKIPPSIRLMKNLRIIRAGLNNL  199


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  I+L++    G  P    I +L+ L  +   +N L GTIP  L +C     +DLS N
Sbjct  260  SLEMIALNDNAFTGGVPKE--IGRLSMLKRLYLYTNQLDGTIPRELGNCESALEIDLSEN  317

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
             LTG I  E   ++TLR L+L  N+L G IP+ +   S L+ +D+S N+L G+IP +  N
Sbjct  318  RLTGIIPRELGRIQTLRLLHLFENLLQGSIPSELGQLSLLKRIDLSINNLTGTIPLEFQN  377

Query  671  FYNLSYLDLSMNSL  712
              +L Y  L  N+L
Sbjct  378  LSSLEYFQLFDNNL  391


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 71/134 (53%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ LS+    G  P    I +L +LVS N SSN L G IP  L+ C+KL+ +DLS N 
Sbjct  501  LERLFLSDNYFIGHIPPE--IGELADLVSFNISSNQLSGAIPRELAKCTKLQRVDLSRNW  558

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNF  673
             TG +  +  S+  L  L L  N L G IP+ +   S L  L +  N+ +G IP ++G  
Sbjct  559  FTGFVPKDLGSLVNLEQLKLSDNHLNGTIPSSLGRLSRLTELQMGGNNFSGHIPTELGQL  618

Query  674  YNLSY-LDLSMNSL  712
              L   L++S N L
Sbjct  619  TTLQIALNISYNVL  632


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    + ++  L  ++   N L G+IP+ L   S L+ +DLSIN
Sbjct  308  SALEIDLSENRLTGIIPRE--LGRIQTLRLLHLFENLLQGSIPSELGQLSLLKRIDLSIN  365

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
            +LTG I  EF ++ +L    L  N L G IP  + + S L  LD+S N L GSIP  +  
Sbjct  366  NLTGTIPLEFQNLSSLEYFQLFDNNLEGVIPPLLGSNSNLSVLDLSDNKLTGSIPAYLCK  425

Query  671  FYNLSYLDLSMNSL  712
            +  L +L L  N L
Sbjct  426  YQKLIFLSLGSNML  439


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 53/106 (50%), Gaps = 1/106 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            NL  ++ S N L G+IPA L    KL  L L  N L+G I     + K L  L L GN+L
Sbjct  404  NLSVLDLSDNKLTGSIPAYLCKYQKLIFLSLGSNMLSGNIPHGVKTCKPLVQLRLGGNLL  463

Query  572  FGEIPTPMVAYSLESL-DVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
             G +P  +      S  D+S N  +G IP +IG   NL  L LS N
Sbjct  464  TGSLPVALSGLLNLSSLDMSQNRFSGPIPPEIGKLKNLERLFLSDN  509



>ref|XP_010105912.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC06731.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=953

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 92/154 (60%), Gaps = 2/154 (1%)
 Frame = +2

Query  254  QWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWG  433
            + +  ++PC+W GISCN+  SVT I+LS   + G+      +  L NL   N S+N ++ 
Sbjct  57   KLHPKTAPCNWFGISCNTAKSVTSINLSNSSLQGTLHQFPFLS-LPNLTYFNLSNNKIFS  115

Query  434  TIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSL  610
            TIP  +S+ SKL  LDLS N+++GKI  E  ++K L++L L  N   G  P+ +    SL
Sbjct  116  TIPPQISTLSKLTYLDLSYNNMSGKIPPEIVNLKNLKALYLVENQFNGPFPSEIGNMTSL  175

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              +D+  N  +GSIP  +G+  +L++L LS NSL
Sbjct  176  LKVDLEKNQFSGSIPPSLGDLRSLNFLGLSYNSL  209


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 62/112 (55%), Gaps = 2/112 (2%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            Q  NL ++  + N L G IP  +   S+L  LDLS N L G I  E   + +L +L L  
Sbjct  363  QCTNLKALQLAGNDLSGEIPLEIGFTSQLRKLDLSSNHLVGVIPKELRFLTSLLNLTLGN  422

Query  563  NMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDI-GNFYNLSYLDLSMNSL  712
            N LFG IP  + + + L  LD+SSN LNGSI   +  N  +++YL+LS N  
Sbjct  423  NKLFGGIPMELGSLTMLNYLDLSSNRLNGSISRVLWNNLLDVNYLNLSNNRF  474


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 62/128 (48%), Gaps = 3/128 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L E    G FP+   I  + +L+ ++   N   G+IP +L     L  L LS N L+G I
Sbjct  156  LVENQFNGPFPSE--IGNMTSLLKVDLEKNQFSGSIPPSLGDLRSLNFLGLSYNSLSGPI  213

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSY  688
              E   + +L  L L  N L G +PT +   + L+ L +  N  +GS+P  IGN  NL+ 
Sbjct  214  PEELGKLNSLEVLELSVNKLNGTVPTSLGELTNLKVLCLRENKFSGSVPQGIGNLANLTV  273

Query  689  LDLSMNSL  712
            L L  N  
Sbjct  274  LQLDTNRF  281


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 59/111 (53%), Gaps = 4/111 (4%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L++ +   N  +G IP +L +C+ L  + L  N LTG ++ +F     L  ++L  
Sbjct  294  QLKKLIAYD---NDFFGPIPKSLRNCTSLLRVRLEGNRLTGNVSEDFGVYPNLEYIDLSH  350

Query  563  NMLFGEIPTP-MVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N   GEI        +L++L ++ NDL+G IP +IG    L  LDLS N L
Sbjct  351  NKFHGEISRSWQQCTNLKALQLAGNDLSGEIPLEIGFTSQLRKLDLSSNHL  401


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 65/135 (48%), Gaps = 26/135 (19%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEF--------------  523
            L +L+++   +N L+G IP  L S + L  LDLS N L G I+                 
Sbjct  412  LTSLLNLTLGNNKLFGGIPMELGSLTMLNYLDLSSNRLNGSISRVLWNNLLDVNYLNLSN  471

Query  524  --FSMK---------TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIG  667
              FS +          L  L+L  N+L GEIP  M    SLE+L++S N L+GSIP    
Sbjct  472  NRFSQEIPLRLGNLVRLSQLDLSYNLLSGEIPWQMSKMQSLETLNLSHNRLSGSIPPSFA  531

Query  668  NFYNLSYLDLSMNSL  712
            N   L ++D+S N L
Sbjct  532  NMLGLLHIDISYNQL  546


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 57/121 (47%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G  P S   C   +L+ +    N L G +  +      LE +DLS N   G+I+  +   
Sbjct  307  GPIPKSLRNC--TSLLRVRLEGNRLTGNVSEDFGVYPNLEYIDLSHNKFHGEISRSWQQC  364

Query  533  KTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              L++L L GN L GEIP  +     L  LD+SSN L G IP ++    +L  L L  N 
Sbjct  365  TNLKALQLAGNDLSGEIPLEIGFTSQLRKLDLSSNHLVGVIPKELRFLTSLLNLTLGNNK  424

Query  710  L  712
            L
Sbjct  425  L  425


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 4/94 (4%)
 Frame = +2

Query  389  NNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLR  559
            NNL+ +N+   S+N     IP  L +  +L  LDLS N L+G+I  +   M++L +LNL 
Sbjct  459  NNLLDVNYLNLSNNRFSQEIPLRLGNLVRLSQLDLSYNLLSGEIPWQMSKMQSLETLNLS  518

Query  560  GNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPD  658
             N L G IP        L  +D+S N L+G +P+
Sbjct  519  HNRLSGSIPPSFANMLGLLHIDISYNQLDGPVPN  552


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 72/185 (39%), Gaps = 57/185 (31%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDL  484
            S+ ++ L +    GS P S     L +L S+NF   S NSL G IP  L   + LE L+L
Sbjct  174  SLLKVDLEKNQFSGSIPPS-----LGDLRSLNFLGLSYNSLSGPIPEELGKLNSLEVLEL  228

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIP--------------------------  586
            S+N L G +      +  L+ L LR N   G +P                          
Sbjct  229  SVNKLNGTVPTSLGELTNLKVLCLRENKFSGSVPQGIGNLANLTVLQLDTNRFTGYLPQN  288

Query  587  -------TPMVAY----------------SLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
                     ++AY                SL  + +  N L G++ +D G + NL Y+DL
Sbjct  289  VCGSGQLKKLIAYDNDFFGPIPKSLRNCTSLLRVRLEGNRLTGNVSEDFGVYPNLEYIDL  348

Query  698  SMNSL  712
            S N  
Sbjct  349  SHNKF  353



>gb|KCW85317.1| hypothetical protein EUGRSUZ_B02157, partial [Eucalyptus grandis]
Length=977

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 100/209 (48%), Gaps = 37/209 (18%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWNSTSS-------PCDWPGISCNSNGSVTRISLSEMIM  349
            DE + LL +K     P    + W + S         C+W G+SCNS G V +++LS M +
Sbjct  8    DELSTLLSIKSSLTDPLDCLKDWKAPSGTPEGGAIQCNWTGVSCNSKGFVEKLNLSNMNL  67

Query  350  GGS---------------------------FPASAIICQLNNLVSINFSSNSLWGTIPAN  448
             GS                           FP    + ++  LV +N SSN+  G +P +
Sbjct  68   SGSVSDQIQELHSLSHINFIDVSQNNFVGSFPVG--LGRVRGLVKVNASSNNFAGPLPED  125

Query  449  LSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDV  625
            L S + LE+LDL  N   G I   F +++ L+ L L GN L G IP  +    SLE++ +
Sbjct  126  LGSATALESLDLRGNFFEGSIPTSFKNLQNLKYLGLSGNNLTGPIPGELGQLSSLETIIM  185

Query  626  SSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              ND  G IP + GN  NL YLDL++ +L
Sbjct  186  GYNDFEGGIPPEFGNLTNLRYLDLAVGTL  214


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 65/121 (54%), Gaps = 3/121 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            GS P S     L NL  +  S N+L G IP  L   S LET+ +  ND  G I  EF ++
Sbjct  144  GSIPTS--FKNLQNLKYLGLSGNNLTGPIPGELGQLSSLETIIMGYNDFEGGIPPEFGNL  201

Query  533  KTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
              LR L+L    L G+IP  + +   L ++ + SN+  G IP +IGN  +L +LDLS N 
Sbjct  202  TNLRYLDLAVGTLGGQIPAALGSLRKLTTMYLFSNNFEGKIPPEIGNISSLIFLDLSDNK  261

Query  710  L  712
            +
Sbjct  262  I  262


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 68/134 (51%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S++ + LS   +  S P+S  I  ++ L S   S N+L G IP     C  L  LDLS N
Sbjct  419  SLSFVDLSYNHLDSSVPSS--IFSISKLQSFIASDNNLRGNIPDQFQDCPSLSVLDLSNN  476

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
              +G I     S K L  LNLR N L G IP  +    +L  LD+S+N L G IP+ IG+
Sbjct  477  RFSGNIPVSIASCKKLVKLNLRNNRLTGGIPRAISTMPTLAILDLSNNSLAGQIPEVIGS  536

Query  671  FYNLSYLDLSMNSL  712
               L   ++S N L
Sbjct  537  SPTLETFNVSYNKL  550


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 71/130 (55%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + L+   +GG  PA+  +  L  L ++   SN+  G IP  + + S L  LDLS N +TG
Sbjct  207  LDLAVGTLGGQIPAA--LGSLRKLTTMYLFSNNFEGKIPPEIGNISSLIFLDLSDNKITG  264

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            +I  E  ++K L+  NL  N L G IP  +   + L+ L++  N L G++P ++G    L
Sbjct  265  EIPVELENLKNLQLFNLMCNQLSGSIPQGLGELTNLQVLELWKNSLKGTLPSNLGKNSPL  324

Query  683  SYLDLSMNSL  712
             +LD+S N L
Sbjct  325  QWLDVSSNLL  334


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 69/134 (51%), Gaps = 8/134 (6%)
 Frame = +2

Query  329  SLSEMIMG-----GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            SL  +IMG     G  P       L NL  ++ +  +L G IPA L S  KL T+ L  N
Sbjct  179  SLETIIMGYNDFEGGIPPE--FGNLTNLRYLDLAVGTLGGQIPAALGSLRKLTTMYLFSN  236

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGN  670
            +  GKI  E  ++ +L  L+L  N + GEIP  +    +L+  ++  N L+GSIP  +G 
Sbjct  237  NFEGKIPPEIGNISSLIFLDLSDNKITGEIPVELENLKNLQLFNLMCNQLSGSIPQGLGE  296

Query  671  FYNLSYLDLSMNSL  712
              NL  L+L  NSL
Sbjct  297  LTNLQVLELWKNSL  310


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + GS P    + +L NL  +    NSL GT+P+NL   S L+ LD+S N L+G+I     
Sbjct  286  LSGSIPQG--LGELTNLQVLELWKNSLKGTLPSNLGKNSPLQWLDVSSNLLSGEIPEGLC  343

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            +   L  L L  N   G IP  + +  SL  + +  N L+G+IP  +GN  NL  L+L+ 
Sbjct  344  NSGNLTKLILFNNSFSGPIPMGLSSCASLIRVRIQQNILSGTIPVGLGNLPNLQRLELAY  403

Query  704  NSL  712
            N+ 
Sbjct  404  NNF  406


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 47/92 (51%), Gaps = 2/92 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S++ + LS     G+ P S   C+   LV +N  +N L G IP  +S+   L  LDLS N
Sbjct  467  SLSVLDLSNNRFSGNIPVSIASCK--KLVKLNLRNNRLTGGIPRAISTMPTLAILDLSNN  524

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPT  589
             L G+I     S  TL + N+  N L G IP+
Sbjct  525  SLAGQIPEVIGSSPTLETFNVSYNKLVGSIPS  556



>ref|XP_006427729.1| hypothetical protein CICLE_v10024756mg [Citrus clementina]
 gb|ESR40969.1| hypothetical protein CICLE_v10024756mg [Citrus clementina]
Length=1109

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 97/173 (56%), Gaps = 6/173 (3%)
 Frame = +2

Query  206  LLILKQHW-GYPFSLFEQWN-STSSPCDWPGISCNSNG-SVTRISLSEMIMGGSFPASAI  376
            LL L +HW   P  +   WN S S+PC W GI C+ +  +V   +LS   + G       
Sbjct  33   LLSLMRHWTSVPPLIISSWNNSDSTPCQWVGIECDDDAHNVVSFNLSSYGVSGQLGPE--  90

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I  L+ L +I+ SSN+  G IP  L +CS LE LDLS N  TG I   F +++ L+SLNL
Sbjct  91   IGHLSKLQTIDLSSNNFSGNIPQKLGNCSALEYLDLSTNGFTGDIPDNFENLQNLQSLNL  150

Query  557  RGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GN+L GEIP  +     L+ + +++N L+GSIP ++G+   +  L L  N L
Sbjct  151  YGNLLDGEIPESLFRILGLQYVFLNNNSLSGSIPRNVGDLKEVEALWLFSNRL  203


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 64/129 (50%), Gaps = 2/129 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            ISL      G  P S  I   ++L+ ++F +NS  G IP NL    +L  L++  N   G
Sbjct  412  ISLYNNQFSGVIPQSLGIN--SSLMQLDFINNSFTGEIPPNLCFGKQLRVLNMGQNQFHG  469

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLS  685
             I     S  TL  + L+ N L G +P       L  LDVS N+++G+IP  IGN  NL+
Sbjct  470  PIPSLLGSCPTLWRVILKQNQLTGALPEFSKNPVLSHLDVSRNNISGAIPSSIGNSINLT  529

Query  686  YLDLSMNSL  712
             +D S N  
Sbjct  530  SIDFSSNKF  538


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 69/158 (44%), Gaps = 28/158 (18%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T I  S     G  P    +  L +LV++N S N + G++P+ LS C  LE  D+S N 
Sbjct  528  LTSIDFSSNKFSGLMPQE--LGNLVSLVTLNISLNHVEGSLPSQLSKCKNLEVFDVSFNL  585

Query  497  LTGKIAGEFFSMKTLRSLNLR------------------------GNMLFGEIPTPMVAY  604
            L G I     S K+L  L L                         GN L GEIP  + A 
Sbjct  586  LNGSIPSSLRSWKSLSILKLSENHFTGGIPTFISELEKLLELQLGGNQLGGEIPPSIGAL  645

Query  605  SLES--LDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
               S  L++S N L G IP D+     L  LD+S N+L
Sbjct  646  QDLSYALNLSKNGLTGRIPSDLEKLSKLEQLDISSNNL  683


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (51%), Gaps = 3/128 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  +  L NLV ++   N+L G I      C  L  LDLS N  +G I
Sbjct  222  LNENKLMGFLPES--LNNLENLVYLDVGDNNLEGRINFGSEKCKNLTFLDLSYNRFSGGI  279

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
            +    +  +L  L++ G+ L G IP+   +   L SLD+S N L+G IP ++G    L+ 
Sbjct  280  SPNLGNCSSLTHLDIVGSKLTGSIPSSFGLLARLSSLDLSENQLSGKIPPELGKCKYLTV  339

Query  689  LDLSMNSL  712
            L L  N L
Sbjct  340  LHLYANQL  347


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 56/111 (50%), Gaps = 1/111 (1%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            +  NL  ++ S N   G I  NL +CS L  LD+  + LTG I   F  +  L SL+L  
Sbjct  261  KCKNLTFLDLSYNRFSGGISPNLGNCSSLTHLDIVGSKLTGSIPSSFGLLARLSSLDLSE  320

Query  563  NMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L G+IP  +     L  L + +N L G IP ++G   NL  L+L  N L
Sbjct  321  NQLSGKIPPELGKCKYLTVLHLYANQLEGEIPGELGQLSNLQDLELFDNRL  371


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 1/107 (1%)
 Frame = +2

Query  395  LVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLF  574
            L  ++   + L G+IP++    ++L +LDLS N L+GKI  E    K L  L+L  N L 
Sbjct  289  LTHLDIVGSKLTGSIPSSFGLLARLSSLDLSENQLSGKIPPELGKCKYLTVLHLYANQLE  348

Query  575  GEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            GEIP  +   S L+ L++  N L G  P  I    +L YL +  N+L
Sbjct  349  GEIPGELGQLSNLQDLELFDNRLTGEFPVSIWRIASLEYLLVYNNNL  395


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 72/162 (44%), Gaps = 28/162 (17%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNS--------------------  424
             N  ++ + +S   + G+ P+S  I    NL SI+FSSN                     
Sbjct  500  KNPVLSHLDVSRNNISGAIPSS--IGNSINLTSIDFSSNKFSGLMPQELGNLVSLVTLNI  557

Query  425  ----LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
                + G++P+ LS C  LE  D+S N L G I     S K+L  L L  N   G IPT 
Sbjct  558  SLNHVEGSLPSQLSKCKNLEVFDVSFNLLNGSIPSSLRSWKSLSILKLSENHFTGGIPTF  617

Query  593  M-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY-LDLSMNSL  712
            +     L  L +  N L G IP  IG   +LSY L+LS N L
Sbjct  618  ISELEKLLELQLGGNQLGGEIPPSIGALQDLSYALNLSKNGL  659



>ref|XP_002318300.2| hypothetical protein POPTR_0012s14920g [Populus trichocarpa]
 gb|EEE96520.2| hypothetical protein POPTR_0012s14920g [Populus trichocarpa]
Length=1051

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 98/183 (54%), Gaps = 28/183 (15%)
 Frame = +2

Query  242  SLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSN  421
            SL   W +  +PC+W GI+C+  G++T++SL +  + G+         LN L+ +N  +N
Sbjct  72   SLLSSW-AGDNPCNWEGITCDKTGNITKLSLQDCSLRGTLHGLQFSSFLN-LIELNLRNN  129

Query  422  SLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA  601
            SL+GTIP+++S+ SKL  LDLS N ++G I  E  S+ +L   +L  N++ G IP+  + 
Sbjct  130  SLYGTIPSHISNLSKLIVLDLSQNQISGSIPSEIGSLTSLELFSLMKNLINGSIPSNSIG  189

Query  602  --------------------------YSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
                                       SL  L++SSN+L G+IP  IGN  NL YLDL  
Sbjct  190  NLSNLVYLYLNDNDLSGAIPQEVGRMKSLVLLNLSSNNLTGAIPSSIGNLSNLVYLDLLK  249

Query  704  NSL  712
            N L
Sbjct  250  NKL  252


 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (56%), Gaps = 4/133 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +T+++L+   + GS P    + +L+NL+ +NFS N   G +P  + +   L++LDLS N 
Sbjct  530  ITKLNLAANYLSGSIPKQ--LGELSNLLFLNFSKNKFTGNVPPEMGNLRSLQSLDLSWNY  587

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF  673
            L G I  +    K L +LN+  NM+ G IPT      SL ++D+S NDL G +P DI  F
Sbjct  588  LQGYIPPQLGQFKHLETLNISHNMMSGSIPTTFADLLSLVTVDISCNDLEGPVP-DIKAF  646

Query  674  YNLSYLDLSMNSL  712
                Y  +  N+L
Sbjct  647  SEAPYEAIRNNNL  659


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  ++LS   + G+ P+S  I  L+NLV ++   N L G++P  +     L TL L  N
Sbjct  217  SLVLLNLSSNNLTGAIPSS--IGNLSNLVYLDLLKNKLSGSVPEEVGMLENLRTLQLGGN  274

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIG  667
             L G I     +M++L  L+LR N L G IP  M  +  SL  +D++ N+L G+IP  +G
Sbjct  275  SLDGTIHTSIGNMRSLTVLDLRENYLTGTIPASMGNLTRSLTFIDLAFNNLTGTIPSSLG  334

Query  668  NFYNLSYLDLSMNSL  712
            N  +LS+L L  N+L
Sbjct  335  NLRSLSFLYLPSNNL  349


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 74/124 (60%), Gaps = 4/124 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G+ P    + ++ +LV +N SSN+L G IP+++ + S L  LDL  N L+G +  E  
Sbjct  204  LSGAIPQE--VGRMKSLVLLNLSSNNLTGAIPSSIGNLSNLVYLDLLKNKLSGSVPEEVG  261

Query  527  SMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLDLS  700
             ++ LR+L L GN L G I T +    SL  LD+  N L G+IP  +GN   +L+++DL+
Sbjct  262  MLENLRTLQLGGNSLDGTIHTSIGNMRSLTVLDLRENYLTGTIPASMGNLTRSLTFIDLA  321

Query  701  MNSL  712
             N+L
Sbjct  322  FNNL  325


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 65/134 (49%), Gaps = 24/134 (18%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI-----------------  511
            Q  +L+++  S+N + G IPA L   ++L+ +DLS N L G+I                 
Sbjct  455  QFQSLMTLRVSNNRISGEIPAELGKATRLQAIDLSSNHLVGEIPKELGKLKLLELTLNNN  514

Query  512  --AGEFFSMKT----LRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGN  670
              +G+  S+      +  LNL  N L G IP  +   S L  L+ S N   G++P ++GN
Sbjct  515  NLSGDVTSVIATIPYITKLNLAANYLSGSIPKQLGELSNLLFLNFSKNKFTGNVPPEMGN  574

Query  671  FYNLSYLDLSMNSL  712
              +L  LDLS N L
Sbjct  575  LRSLQSLDLSWNYL  588


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 57/113 (50%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            IC+   L  +    N   G IP +L +C+ L  L +  N L+G I+ +      +  +NL
Sbjct  381  ICRGGLLSLLCVMDNDFTGPIPKSLRNCTSLVRLRIERNQLSGNISNDLVVYPNMTYINL  440

Query  557  RGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N  +GE+      + SL +L VS+N ++G IP ++G    L  +DLS N L
Sbjct  441  SDNEFYGELSWKWEQFQSLMTLRVSNNRISGEIPAELGKATRLQAIDLSSNHL  493



>ref|XP_011074643.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Sesamum indicum]
Length=1129

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 97/172 (56%), Gaps = 7/172 (4%)
 Frame = +2

Query  206  LLILKQHWGYPFSLFEQWNST--SSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAII  379
            LL  KQ+   P    + WN++  ++PCDW GI C S G V+ + L  + +GG    S  +
Sbjct  32   LLSFKQNIFDPRGAMDGWNASTPAAPCDWRGILC-SAGRVSELHLPRLQLGGRL--SEQL  88

Query  380  CQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF-SMKTLRSLNL  556
              L  L +++  SN+L G+IP  LS C+ L T+ L  N  TG+I+  FF ++  L+  NL
Sbjct  89   GDLRQLRALSLHSNNLNGSIPQALSRCTLLRTVYLQYNSFTGEISPSFFYNLTNLQVFNL  148

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N++ GEIP  + A  L+ LD+SSN  +G IP +    + L  +DLS N L
Sbjct  149  GHNLISGEIPDELPA-RLQVLDLSSNSFSGKIPVNFSASHQLQVIDLSFNHL  199


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 76/158 (48%), Gaps = 27/158 (17%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPA----------------  445
            S+  ++L E ++ G+ P       L+NL  +N SSN+  G IPA                
Sbjct  530  SLQVVALQENLLSGNVPEG--FSSLSNLQYLNLSSNAFSGQIPATYGFLRSLSVLSLSHN  587

Query  446  --------NLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-  598
                     LS+CS LE L+L  ND TG+I   F  +  L+ L+L  N L GEIP  +  
Sbjct  588  HISGSIPVELSNCSGLEGLELRENDFTGEIPAGFSHLSHLQRLDLGQNNLTGEIPESLSN  647

Query  599  AYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              SL  L + SN L+G IPD +     L  LD+S N+L
Sbjct  648  CSSLIVLLLDSNHLSGHIPDALSKLSMLMELDVSSNNL  685


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + GS P     C  + L  +    N   G IPA  S  S L+ LDL  N+LTG+I     
Sbjct  589  ISGSIPVELSNC--SGLEGLELRENDFTGEIPAGFSHLSHLQRLDLGQNNLTGEIPESLS  646

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            +  +L  L L  N L G IP  +   S L  LDVSSN+L G+IP ++     L +L+LS 
Sbjct  647  NCSSLIVLLLDSNHLSGHIPDALSKLSMLMELDVSSNNLTGAIPANLSLISTLQHLNLSG  706

Query  704  NSL  712
            N+L
Sbjct  707  NNL  709


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I +   L  +N S     G IP+++ +  +L+TLD+S  +L+G++  E F + +L+ + L
Sbjct  477  IGKFKGLEVLNMSGCGFSGAIPSSVGNLLRLKTLDMSKQNLSGELPVELFGLPSLQVVAL  536

Query  557  RGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIG  667
            + N+L G +P    + S L+ L++SSN  +G IP   G
Sbjct  537  QENLLSGNVPEGFSSLSNLQYLNLSSNAFSGQIPATYG  574


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 62/112 (55%), Gaps = 4/112 (4%)
 Frame = +2

Query  383  QLNNLVSI---NFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLN  553
            ++ NLVS+      +NSL G IP N++ C  L  LD+  N  +G I      MK L  L 
Sbjct  356  RIGNLVSLEEFRARNNSLSGGIPDNVTKCVSLRVLDIGKNRFSGLIPEFIGEMKGLAMLF  415

Query  554  LRGNMLFGEIP-TPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L GN+  G IP +    Y LE LD+S N LNG++P ++    NLS L+LS N
Sbjct  416  LGGNLFTGRIPESLSDLYLLELLDLSDNMLNGTVPLELMRLSNLSTLNLSNN  467


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 2/95 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + R+ L +  + G  P S   C  ++L+ +   SN L G IP  LS  S L  LD+S N+
Sbjct  627  LQRLDLGQNNLTGEIPESLSNC--SSLIVLLLDSNHLSGHIPDALSKLSMLMELDVSSNN  684

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA  601
            LTG I      + TL+ LNL GN L G IP  + +
Sbjct  685  LTGAIPANLSLISTLQHLNLSGNNLEGRIPEALAS  719



>ref|XP_002324453.1| hypothetical protein POPTR_0018s09510g [Populus trichocarpa]
 gb|EEF03018.1| hypothetical protein POPTR_0018s09510g [Populus trichocarpa]
Length=982

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 93/173 (54%), Gaps = 6/173 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPAS  370
            ++A+LL +KQHW  P SL EQW  S SS C WPG+ C  N  +T++ L    + G+ P  
Sbjct  28   DQAVLLRMKQHWQNPLSL-EQWTPSNSSHCTWPGVVCTDN-YITQLILDNKNISGTIPP-  84

Query  371  AIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSL  550
              +  L NL  +NFS+N++ G  P  + + SKLE LDLS N + G I  +   +  L  L
Sbjct  85   -FLSDLKNLTFLNFSNNNIIGKFPVAVHNLSKLEILDLSQNYIVGTIPDDIDCLARLSYL  143

Query  551  NLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            NL  N   G IP  +     L +L +  N  +G+ P +IGN   L  L ++ N
Sbjct  144  NLCVNNFTGSIPAAIGRIPELRTLYLHDNLFDGTFPPEIGNLSKLEELYMAHN  196


 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = +2

Query  383  QLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRG  562
            QL  L  +  S  +L G IP  +     LE LDLS N LTG I G  F +  LR L L  
Sbjct  209  QLKKLKMLWISGANLIGEIPQMIGEMVALEHLDLSSNKLTGNIPGSLFMLMNLRVLWLYK  268

Query  563  NMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            N L GEIP  + A +L S+D+S N+L G+IP D G    LS L L  N L
Sbjct  269  NKLSGEIPRAVEALNLTSVDLSENNLTGTIPVDFGKLDKLSGLSLFSNQL  318


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 71/134 (53%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            ++  + LS   + G+ P S  +  L NL  +    N L G IP  + + + L ++DLS N
Sbjct  236  ALEHLDLSSNKLTGNIPGSLFM--LMNLRVLWLYKNKLSGEIPRAVEALN-LTSVDLSEN  292

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGN  670
            +LTG I  +F  +  L  L+L  N L GEIP  +    +L+   + SN+L+GSIP D+G 
Sbjct  293  NLTGTIPVDFGKLDKLSGLSLFSNQLSGEIPEGIGRLPALKDFKLFSNNLSGSIPPDLGR  352

Query  671  FYNLSYLDLSMNSL  712
            +  L   ++  N L
Sbjct  353  YSALERFEVCSNRL  366


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSM  532
            G+ P   +I  L NL  +    N L G +P N+ S   L  L+LS N L+G+I  +F  +
Sbjct  486  GTIPLE-LITALPNLTVLLLDKNHLTGALPPNIISWKSLNILNLSQNQLSGQIPEKFGFL  544

Query  533  KTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSYLD  694
              L  L+L  N   G+IP  + +  L  L++SSN+L G IP +  N  Y  S+L+
Sbjct  545  TNLVKLDLSDNQFSGKIPPQLGSLRLVFLNLSSNNLTGQIPTENENVAYATSFLN  599



>ref|XP_008389971.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=835

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 89/149 (60%), Gaps = 5/149 (3%)
 Frame = +2

Query  278  CDWPGISCNSNGSVTRISLS-EMIMG--GSFPASAIICQLNNLVSINFSSNSLWGTIPAN  448
            C+WPGI+CN+ GS+T ISL  +  +G  G+F      C   N+V +   ++ L G+IP+ 
Sbjct  101  CEWPGITCNTAGSITEISLPPDFQLGDDGNFGKFNFSC-FPNIVRLRLRASGLKGSIPSE  159

Query  449  LSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDV  625
            + + SKL+ LDLS N +TG I    +++K L  L L  N L   IP  +    SL+SL +
Sbjct  160  IGTLSKLKHLDLSYNQITGYIPSSLWNLKNLVXLQLSANRLTXPIPATIGRLTSLKSLSL  219

Query  626  SSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              N +NGSIP ++G+  NL +LD S NSL
Sbjct  220  EWNQINGSIPFELGDLNNLEHLDFSANSL  248


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 70/120 (58%), Gaps = 3/120 (3%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+  +SL    + GS P    +  LNNL  ++FS+NSL G+IP +LS   KL+ L+LS+N
Sbjct  213  SLKSLSLEWNQINGSIPFE--LGDLNNLEHLDFSANSLTGSIPPSLSHLXKLKALNLSMN  270

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGE-IPTPMVAYSLESLDVSSNDLNGSIPDDIGN  670
             ++G I  E   +  L+ L L  N + G  IP     ++L  LD+SSN   GSIP D+GN
Sbjct  271  KISGVIPHELSQLTQLQYLVLSSNQISGNIIPEIGSLFNLFVLDLSSNSXIGSIPTDLGN  330


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 1/117 (1%)
 Frame = +2

Query  362  PASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTL  541
            P  A I +L +L S++   N + G+IP  L   + LE LD S N LTG I      +  L
Sbjct  203  PIPATIGRLTSLKSLSLEWNQINGSIPFELGDLNNLEHLDFSANSLTGSIPPSLSHLXKL  262

Query  542  RSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            ++LNL  N + G IP  +   + L+ L +SSN ++G+I  +IG+ +NL  LDLS NS
Sbjct  263  KALNLSMNKISGVIPHELSQLTQLQYLVLSSNQISGNIIPEIGSLFNLFVLDLSSNS  319


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 69/128 (54%), Gaps = 5/128 (4%)
 Frame = +2

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
            S  I G   P    I  L NL  ++ SSNS  G+IP +L +CS L+ L LS N LTG I 
Sbjct  293  SNQISGNIIPE---IGSLFNLFVLDLSSNSXIGSIPTDLGNCSXLQLLXLSRNFLTGSIP  349

Query  515  GEFFSMKTLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIGNFYNLSY  688
                 +  L S++L  N L G++P+ +  +  SLE LD+  N L G+IP      + +  
Sbjct  350  ARIGYLSALTSIDLSHNSLRGKVPSELGSLRNSLEYLDLXHNKLTGTIPPSFNLLHRVRQ  409

Query  689  LDLSMNSL  712
            L+LS NSL
Sbjct  410  LNLSYNSL  417


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 59/113 (52%), Gaps = 7/113 (6%)
 Frame = +2

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCS-KLETLDLSINDLTGKI  511
            S   + GS PA   I  L+ L SI+ S NSL G +P+ L S    LE LDL  N LTG I
Sbjct  340  SRNFLTGSIPAR--IGYLSALTSIDLSHNSLRGKVPSELGSLRNSLEYLDLXHNKLTGTI  397

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIG  667
               F  +  +R LNL  N L G IPT + + +  ++    +NDL G   D IG
Sbjct  398  PPSFNLLHRVRQLNLSYNSLKGHIPTDLQLLFPPDAFVGGNNDLCG---DPIG  447


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            + QL  L  +  SSN + G I   + S   L  LDLS N   G I  +  +   L+ L L
Sbjct  280  LSQLTQLQYLVLSSNQISGNIIPEIGSLFNLFVLDLSSNSXIGSIPTDLGNCSXLQLLXL  339

Query  557  RGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIGNFYN-LSYLDLSMNSL  712
              N L G IP   + Y  +L S+D+S N L G +P ++G+  N L YLDL  N L
Sbjct  340  SRNFLTGSIPA-RIGYLSALTSIDLSHNSLRGKVPSELGSLRNSLEYLDLXHNKL  393



>ref|XP_009387280.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=1528

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 86/163 (53%), Gaps = 10/163 (6%)
 Frame = +2

Query  248  FEQWNSTSSPCDWPGISCN------SNGSVTRISLSEMIMGGSFPASAI-ICQLNNLVSI  406
               WN  SSPC+W G++CN          +T ISL  M + G  P  A+    L +L+ +
Sbjct  390  LRSWNLNSSPCNWTGVTCNYPVTAIGRSVITEISLPRMGLAG--PLDALDFSALGSLLRL  447

Query  407  NFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIP  586
            N S N L G IP  +S+ S+L +LDL+ N  T +I     SMK LR L+L  N + G IP
Sbjct  448  NLSYNQLGGAIPPTISALSRLVSLDLTSNQFTSRIPVRMGSMKELRFLSLSQNQMVGAIP  507

Query  587  TPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
              +    SL SL +  N   G IP ++G  + L YLD+ +N L
Sbjct  508  PSLSNLTSLVSLHLEDNKFMGVIPKELGRLHELMYLDIGVNRL  550


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 81/184 (44%), Gaps = 24/184 (13%)
 Frame = +2

Query  224   HWGYPFSLFEQWNSTSSPCDWP----------------GISCNSNGSVTRIS---LSEMI  346
             H  Y    F Q + T SP DW                 G+     G +T++    LS   
Sbjct  899   HLSYMDLSFNQLSGTLSP-DWARWHNLTFFRISNNNITGVIPTEFGQLTKLGELDLSSNY  957

Query  347   MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
             + G  P S     L  L +++  +N L G +P  +   S LE LDLS N+L G+I  +  
Sbjct  958   LQGEIPKS--FGSLTLLYNLSLGNNQLVGHVPLEIGMLSNLELLDLSSNNLAGRIPDQLG  1015

Query  527   SMKTLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
             +   LRSL L  N   G IP  +  + Y  ++ D+S N L G IP  +G    L  L+LS
Sbjct  1016  NCMKLRSLKLNNNNFSGTIPLAIGNLVYLQDTFDISQNSLTGEIPSQLGKLVMLQSLNLS  1075

Query  701   MNSL  712
              NS 
Sbjct  1076  HNSF  1079


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            +SLS+  M G+ P S  +  L +LVS++   N   G IP  L    +L  LD+ +N L+G
Sbjct  495  LSLSQNQMVGAIPPS--LSNLTSLVSLHLEDNKFMGVIPKELGRLHELMYLDIGVNRLSG  552

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPDDIGNFYNL  682
             I     ++  L  L+L  N L G IP  +    +L  L ++ N+L G +    GN   L
Sbjct  553  SIPSSLENLTKLYHLDLYQNRLTGVIPRELKNLVNLVYLSIADNNLTGGVISSFGNLTKL  612

Query  683  SYLDLSMNSL  712
             +  L  N L
Sbjct  613  QFFWLRRNKL  622


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 67/146 (46%), Gaps = 7/146 (5%)
 Frame = +2

Query  290  GISCNSNGSVTRIS---LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSC  460
            G+     G +T++    LS   + G  P S     L  L +++  +N L G +P      
Sbjct  184  GVIPTEFGQLTKLQDLDLSSNYLQGEIPKS--FGSLTLLYNLSLGNNQLVGHVPPEFGML  241

Query  461  SKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM--VAYSLESLDVSSN  634
            S LE LDLS N+L G+I  +      LRSL L  N   G IP  +  + Y   + D+S N
Sbjct  242  SNLELLDLSSNNLAGRIPDQLGKCTKLRSLKLNNNNFSGTIPLAIGNLVYLQVTFDISQN  301

Query  635  DLNGSIPDDIGNFYNLSYLDLSMNSL  712
             L G IP  +     L  L+LS N L
Sbjct  302  SLTGEIPFQLSKSVMLQSLNLSHNYL  327


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 26/120 (22%)
 Frame = +2

Query  377   ICQLNNLVSINFSSNSLWGTIPANLSSCSKL-------------------------ETLD  481
             I  L+NL  ++ SSN+L G IP  L +C KL                         +T D
Sbjct  990   IGMLSNLELLDLSSNNLAGRIPDQLGNCMKLRSLKLNNNNFSGTIPLAIGNLVYLQDTFD  1049

Query  482   LSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPD  658
             +S N LTG+I  +   +  L+SLNL  N   G +P+ +    SL ++DVS N+L+G +PD
Sbjct  1050  ISQNSLTGEIPSQLGKLVMLQSLNLSHNSFSGHLPSSLTYMTSLSTVDVSYNELDGPVPD  1109


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 58/117 (50%), Gaps = 26/117 (22%)
 Frame = +2

Query  386  LNNLVSINFSSNSLWGTIPANLSSCSKLE-------------------------TLDLSI  490
            L+NL  ++ SSN+L G IP  L  C+KL                          T D+S 
Sbjct  241  LSNLELLDLSSNNLAGRIPDQLGKCTKLRSLKLNNNNFSGTIPLAIGNLVYLQVTFDISQ  300

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLNGSIPD  658
            N LTG+I  +      L+SLNL  N L G +P+ +    SL ++DVS N+L+G +PD
Sbjct  301  NSLTGEIPFQLSKSVMLQSLNLSHNYLSGHLPSSLTYMTSLSTVDVSYNELDGPVPD  357


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
            +L  ++ S N L GT+  +      L  L +S N++TG I  EF  +  L+ L+L  N L
Sbjct  147  HLYYMDLSFNHLSGTLSPDWVRWHNLTRLRISNNNITGVIPTEFGQLTKLQDLDLSSNYL  206

Query  572  FGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             GEIP    + + L +L + +N L G +P + G   NL  LDLS N+L
Sbjct  207  QGEIPKSFGSLTLLYNLSLGNNQLVGHVPPEFGMLSNLELLDLSSNNL  254



>ref|XP_003548595.1| PREDICTED: receptor-like protein kinase 5-like [Glycine max]
Length=1011

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 97/186 (52%), Gaps = 7/186 (4%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNS--TSSPCDWPGISCNSNGSVTRISL  334
            +  S T   + E A+L+ +K+H   P S    W +  T+S C WP I+C S+ SVT ++L
Sbjct  19   HVHSQTQLQDQEHAVLMNIKRHLKNP-SFLSHWTTSNTASHCTWPEITCTSDYSVTGLTL  77

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
                +  + P    +C L NL  +NFS N + G  P  L  CSKL  LDL +ND +G I 
Sbjct  78   VNSNITQTLPP--FMCDLKNLTLVNFSRNFIPGEFPTFLYKCSKLVYLDLEMNDFSGTIP  135

Query  515  GEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIP-DDIGNFYNLSY  688
             +  ++  L+ LNL      G+IP  +     L+ L +     NG+ P + I N ++L +
Sbjct  136  DDIDNLVNLQHLNLGSTSFSGDIPASIGRLKELKMLQLHYCLFNGTFPYESIANLFDLEF  195

Query  689  LDLSMN  706
            LD+S N
Sbjct  196  LDMSSN  201


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +2

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S+ + +L  L   +  S++L+G IP  +     LE LDLS ++LTG I    F +K L +
Sbjct  210  SSSLTRLKKLKFFHMYSSNLFGEIPETIGEMVALENLDLSRSNLTGHIPRGLFMLKNLST  269

Query  548  LNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
            L L  N L GEIP  + A +L  +D++ N+L G IP D G  
Sbjct  270  LYLFQNKLSGEIPGVVEASNLTEIDLAENNLEGKIPHDFGKL  311


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 3/124 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S++R+ +S     G  P    +    N+V    S N+L G++P  L+S  KL TL L  N
Sbjct  454  SISRLEISHNRFFGRIPTG--VSSWTNVVVFKASENNLNGSVPKGLTSLPKLTTLLLDHN  511

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             LTG +  +  S ++L +LNL  N L G IP  + +   L  LD+S N  +G +P  +  
Sbjct  512  QLTGPLPSDIISWQSLVTLNLSQNKLSGHIPDSIGLLPVLSVLDLSENQFSGEVPSKLPR  571

Query  671  FYNL  682
              NL
Sbjct  572  ITNL  575



>ref|XP_009397713.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 [Musa acuminata subsp. malaccensis]
Length=1100

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 87/154 (56%), Gaps = 5/154 (3%)
 Frame = +2

Query  257  WNSTS-SPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWG  433
            WNS+  +PCDW GI C  +  VT I+L ++ + GS  AS  ICQL+ L S N SSN + G
Sbjct  46   WNSSDPTPCDWNGIICR-DSEVTSINLYKLGLQGSLSAS--ICQLHYLTSFNVSSNMISG  102

Query  434  TIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-L  610
             IP   + C  LE LDLS N L G+I  E  ++ +LR L L  N L+GEI + +   + L
Sbjct  103  PIPKEFAQCRSLEVLDLSTNTLHGEIPQELCALSSLRQLFLSENCLYGEISSSIGNLTML  162

Query  611  ESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            E L + SN+L G IP  I    +L  +    N L
Sbjct  163  EELVIYSNNLTGMIPPSIKMLKSLRIIRAGRNDL  196


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 75/136 (55%), Gaps = 6/136 (4%)
 Frame = +2

Query  314  SVTRISLSE-MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSI  490
            S+ R+ LS+   MG   P    I QL +LVS N SSN L G IP  L++C KL+ LDLS 
Sbjct  497  SLERLLLSDNYFMGQITPE---IGQLTSLVSFNISSNQLSGGIPHELANCKKLQRLDLSR  553

Query  491  NDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPDDIG  667
            N  +G I  E  ++  L  L L  N L G IP  +   Y L  L +  N+L+G IP ++G
Sbjct  554  NHFSGTIPEEIGNLVNLELLLLSDNHLNGTIPDGLGGLYRLTELQMGGNNLSGCIPGELG  613

Query  668  NFYNLSY-LDLSMNSL  712
            +   L   L+LS N+L
Sbjct  614  HLTALQIALNLSYNAL  629


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 68/135 (50%), Gaps = 5/135 (4%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S   I LSE  + G  P    + ++  L  +    N L G+IP  L   S L  +DLSIN
Sbjct  305  SAIEIDLSENRLTGVIPKE--LGRIQTLRLLYLFENLLQGSIPRELGQLSLLRKIDLSIN  362

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY--SLESLDVSSNDLNGSIPDDIG  667
            +LTG I  EF ++ +L +  L  N L G IP P++    +L  LD+S N L GSIP  + 
Sbjct  363  NLTGTIPLEFQNLTSLENFLLFDNNLEGFIP-PLLGTNSNLSVLDLSDNKLTGSIPCQLC  421

Query  668  NFYNLSYLDLSMNSL  712
             +  L  L L  N L
Sbjct  422  KYQKLIILSLGANRL  436


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = +2

Query  416  SNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM  595
            +N L GTIP +L +C     +DLS N LTG I  E   ++TLR L L  N+L G IP  +
Sbjct  289  TNRLDGTIPKDLGNCQSAIEIDLSENRLTGVIPKELGRIQTLRLLYLFENLLQGSIPREL  348

Query  596  VAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
               S L  +D+S N+L G+IP +  N  +L    L  N+L
Sbjct  349  GQLSLLRKIDLSINNLTGTIPLEFQNLTSLENFLLFDNNL  388


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSI-NF--SSNSLWGTIPANLSSCSKLETLDLS  487
            + +I LS   + G+ P      +  NL S+ NF    N+L G IP  L + S L  LDLS
Sbjct  354  LRKIDLSINNLTGTIPL-----EFQNLTSLENFLLFDNNLEGFIPPLLGTNSNLSVLDLS  408

Query  488  INDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDI  664
             N LTG I  +    + L  L+L  N LFG IP  +    SL  L +  N L GS+P ++
Sbjct  409  DNKLTGSIPCQLCKYQKLIILSLGANRLFGNIPHGVKTCMSLIQLRLGGNLLTGSLPVEL  468

Query  665  GNFYNLSYLDLSMN  706
                NL+ L+++ N
Sbjct  469  SGLLNLTSLEMNQN  482


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNL----VSINFSSNSLWGTIPANLSSCSKLETLDLSINDL  499
            L+E+ MGG+  +  I  +L +L    +++N S N+L G IPA+L +   LETL L+ N L
Sbjct  594  LTELQMGGNNLSGCIPGELGHLTALQIALNLSYNALSGEIPADLGNLQMLETLYLNNNQL  653

Query  500  TGKIAGEFFSMKTLRSLNLRGNMLFGEIP-TPM  595
             G++   F  + +L   NL  N LFG +P TP+
Sbjct  654  DGEVPPSFSKLSSLLVCNLSYNYLFGSLPGTPI  686



>ref|XP_009780758.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Nicotiana sylvestris]
Length=248

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 100/189 (53%), Gaps = 5/189 (3%)
 Frame = +2

Query  155  PNYSQSLTTYGEDERAILLILKQHWGYPFSLF-EQWNSTSSPCDWPGISCNS-NGSVTRI  328
            P+ + + T    D+ A+L    Q    PF L  E W+ST   C W G++C S +  V  +
Sbjct  17   PSLAITHTNITTDQLALLSFKSQIILDPFHLLDESWSSTIPVCHWVGVTCGSRHHRVKSL  76

Query  329  SLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGK  508
            ++S M + G  P       L  L S++ SSN+ +G +P  ++   +L  + L  N+ +G+
Sbjct  77   NISNMDLTGRIPPD--FGNLTFLDSLDLSSNNFYGNLPQEMARLHRLRFVRLGFNNFSGE  134

Query  509  IAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLS  685
            +   F  ++ L+ L LR N   G IP+     S L++LD+  N L G IP +IGN  NLS
Sbjct  135  VPSWFGVLQQLQVLTLRNNCFNGFIPSLFSNISKLQTLDLKFNSLEGQIPKEIGNLENLS  194

Query  686  YLDLSMNSL  712
            +L+L +N L
Sbjct  195  FLNLGVNKL  203



>gb|KHN16977.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1011

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 97/186 (52%), Gaps = 7/186 (4%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNS--TSSPCDWPGISCNSNGSVTRISL  334
            +  S T   + E A+L+ +K+H   P S    W +  T+S C WP I+C S+ SVT ++L
Sbjct  19   HVHSQTQLQDQEHAVLMNIKRHLKNP-SFLSHWTTSNTASHCTWPEITCTSDYSVTGLTL  77

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
                +  + P    +C L NL  +NFS N + G  P  L  CSKL  LDL +ND +G I 
Sbjct  78   VNSNITQTLPP--FMCDLKNLTLVNFSRNFIPGEFPTFLYKCSKLVYLDLEMNDFSGTIP  135

Query  515  GEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIP-DDIGNFYNLSY  688
             +  ++  L+ LNL      G+IP  +     L+ L +     NG+ P + I N ++L +
Sbjct  136  DDIDNLVNLQHLNLGSTSFSGDIPASIGRLKELKMLQLHYCLFNGTFPYESIANLFDLEF  195

Query  689  LDLSMN  706
            LD+S N
Sbjct  196  LDMSSN  201


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +2

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
            S+ + +L  L   +  S++L+G IP  +     LE LDLS ++LTG I    F +K L +
Sbjct  210  SSSLTRLKKLKFFHMYSSNLFGEIPETIGEMVALENLDLSRSNLTGHIPRGLFMLKNLST  269

Query  548  LNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
            L L  N L GEIP  + A +L  +D++ N+L G IP D G  
Sbjct  270  LYLFQNKLSGEIPGVVEASNLTEIDLAENNLEGKIPHDFGKL  311


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 3/124 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S++R+ +S     G  P    +    N+V    S N L G++P  L+S  KL TL L  N
Sbjct  454  SISRLEISHNRFFGRIPTG--VSSWTNVVVFKASENDLNGSVPKGLTSLPKLTTLLLDHN  511

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             LTG +  +  S ++L +LNL  N L G IP  + +   L  LD+S N  +G +P  +  
Sbjct  512  QLTGPLPSDIISWQSLVTLNLSQNKLSGHIPDSIGLLPVLGVLDLSENQFSGEVPSKLPR  571

Query  671  FYNL  682
              NL
Sbjct  572  ITNL  575



>gb|KFK44719.1| hypothetical protein AALP_AA1G294100 [Arabis alpina]
Length=1000

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 103/174 (59%), Gaps = 5/174 (3%)
 Frame = +2

Query  194  ERAILLILKQHWGYPFSLFEQWNST-SSPCDWPGISCNSN-GSVTRISLSEMIMGGSFPA  367
            E  IL  +K     P S    WNS  +SPC W GISC  +  SVT I LS+  + G FP+
Sbjct  23   EGIILQQVKSSLDDPDSSLISWNSNDASPCHWSGISCAGDFSSVTSIDLSDSNLSGPFPS  82

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              +IC+L+NL  ++  +NS+  T+P N+S+CS L+TLDLS N LTG+I     ++ TL +
Sbjct  83   --LICRLSNLSYLSLYNNSINSTLPLNISACSSLQTLDLSQNLLTGEIPHTLANLPTLTT  140

Query  548  LNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            L+L GN   GEIP     +  LE L +  N L+G+IP  +GN   L  L+LS N
Sbjct  141  LDLTGNNFSGEIPMSFGTFENLEVLSLVYNLLDGTIPPILGNITTLKMLNLSYN  194


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  + +L+ LV ++ + N L GTIP++L   + +  ++L  N LTG+I
Sbjct  216  LTECNLVGKIPDS--LGRLSKLVDLDLALNDLTGTIPSSLGGLASVVQIELYNNSLTGEI  273

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G+IP  +    LESL++  N+L G +P  I    NL  L
Sbjct  274  PPELGNLKSLRLLDASMNQLTGKIPEELCGVDLESLNLYENNLEGEVPASIALSPNLYEL  333

Query  692  DLSMNSL  712
             +  N L
Sbjct  334  RIFGNRL  340


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 81/164 (49%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      I   SN S+  +S +E    G+ P    I  LNNL  
Sbjct  421  WGLPHVYLLELVNNSFSGEISKSIGGASNLSLLILSNNEFT--GALPEE--IGSLNNLNQ  476

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N   G++P +L +  +L TLDL  N  +G++     S K L  LNL  N   G I
Sbjct  477  LSASGNKFSGSLPDSLMNLGELGTLDLHGNGFSGELTPRIKSWKKLNELNLADNRFSGRI  536

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  + N   L+ L+LS N L
Sbjct  537  PNEIGSLSVLNYLDLSGNLFSGEIPVSLQNL-KLNQLNLSNNRL  579


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 63/126 (50%), Gaps = 3/126 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S     GS P S  +  L  L +++   N   G +   + S  KL  L+L+ N 
Sbjct  474  LNQLSASGNKFSGSLPDS--LMNLGELGTLDLHGNGFSGELTPRIKSWKKLNELNLADNR  531

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGN-F  673
             +G+I  E  S+  L  L+L GN+  GEIP  +    L  L++S+N L+G +P  +    
Sbjct  532  FSGRIPNEIGSLSVLNYLDLSGNLFSGEIPVSLQNLKLNQLNLSNNRLSGDLPPSLAKEM  591

Query  674  YNLSYL  691
            Y  S+L
Sbjct  592  YKNSFL  597


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 4/131 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLW-GTIPANLSSCSKLETLDLSINDLT  502
            +SL   ++ G+ P   I+  +  L  +N S N    G IP  L + + L+ + L+  +L 
Sbjct  165  LSLVYNLLDGTIPP--ILGNITTLKMLNLSYNPFKPGRIPPELGNLTNLQVMWLTECNLV  222

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYN  679
            GKI      +  L  L+L  N L G IP+ +    S+  +++ +N L G IP ++GN  +
Sbjct  223  GKIPDSLGRLSKLVDLDLALNDLTGTIPSSLGGLASVVQIELYNNSLTGEIPPELGNLKS  282

Query  680  LSYLDLSMNSL  712
            L  LD SMN L
Sbjct  283  LRLLDASMNQL  293



>emb|CDP08192.1| unnamed protein product [Coffea canephora]
Length=635

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 97/176 (55%), Gaps = 8/176 (5%)
 Frame = +2

Query  191  DERAILLILKQHWGYPFSLFEQWN-STSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPA  367
            +E+ ILL +KQ +G P SL E W  S+SSPCDW  ISC SNG+V  ISL    +  + P 
Sbjct  13   EEQRILLKIKQIFGNPPSL-ESWKPSSSSPCDWLEISC-SNGTVIYISLGRKNISTTLPR  70

Query  368  SAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRS  547
              IIC L NL  I+ S N + G  P  L SC KL  LDLS N+  G I  +   +  LR 
Sbjct  71   --IICDLPNLQGIDLSDNHIPGNFPDFLCSCKKLNRLDLSWNNFLGPIPDDIQCLSGLRY  128

Query  548  LNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            LNL G+  F  IP  +     L SL ++ N L  +IP  + N  NL  LDLS N L
Sbjct  129  LNL-GHNNFYSIPKGIGQLQELTSLAINGNRLR-TIPFIVVNLTNLEALDLSDNRL  182


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 2/105 (2%)
 Frame = +2

Query  377  ICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNL  556
            I QL  L S+  + N L  TIP  + + + LE LDLS N L G I G F  +  L++L L
Sbjct  143  IGQLQELTSLAINGNRL-RTIPFIVVNLTNLEALDLSDNRLAGSIPGGFNKLHNLQTLLL  201

Query  557  RGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF-YNLSY  688
              N   G +P+ +V  +L+ LD+SSN L G +PD+     Y LS+
Sbjct  202  GSNQFSGSLPSGIVNPNLKVLDLSSNRLFGVVPDEYEKADYTLSF  246



>gb|EYU34379.1| hypothetical protein MIMGU_mgv1a020113mg [Erythranthe guttata]
Length=1013

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 93/160 (58%), Gaps = 6/160 (4%)
 Frame = +2

Query  236  PFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFS  415
            P S ++Q N   SPC+W G+SC     VT + LS + M GS   S  +  L++L S++  
Sbjct  68   PLSTWDQQNL--SPCNWSGVSCTEQ-RVTGLDLSGLRMAGSI--SPYLGNLSSLRSLHLQ  122

Query  416  SNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM  595
            +N L G IP  +S C  L TL+L  N + G+I  E   +  L+ LNL GN L GEIP+ +
Sbjct  123  NNQLTGKIPLTISGCRDLMTLELMQNRIWGRIPHEISQLMQLQILNLAGNQLSGEIPSSL  182

Query  596  VAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
                SL  L++ +N+L GSIP D+    NL  LDL++N+L
Sbjct  183  TNISSLVDLNLRTNNLGGSIPSDLWRLSNLKLLDLTINNL  222


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 74/134 (55%), Gaps = 4/134 (3%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLET-LDLSIN  493
            + +I LS     GS P +     L NL+SI+ S N L G+IP  + +  KL   L+LS N
Sbjct  434  LIKIDLSRNKFVGSVPNT--FTNLQNLISIDLSDNMLNGSIPIEILNLPKLSVFLNLSRN  491

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGN  670
             LTG I  E  S++ +  +N+  NML G IP+ +    SLE L  + N L+G IPD +G+
Sbjct  492  QLTGSIPVEIGSLENIVVINICDNMLSGCIPSSIGRCKSLEHLSFARNMLSGPIPDTLGS  551

Query  671  FYNLSYLDLSMNSL  712
               L  LDLS N L
Sbjct  552  VRGLETLDLSANQL  565


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 82/144 (57%), Gaps = 10/144 (7%)
 Frame = +2

Query  302  NSNGSVTRISLSEMIMGG-----SFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSK  466
            NS G+++++ L+++ MGG     + P+S  I +L  L  +N S  S+ G IPA +   ++
Sbjct  353  NSIGNLSKV-LTKLYMGGNDIHGTIPSS--IGELRALDLLNMSYCSISGEIPAEIGLLNE  409

Query  467  LETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMV-AYSLESLDVSSNDLN  643
            L  L L+ N L+GKI     +++ L  ++L  N   G +P       +L S+D+S N LN
Sbjct  410  LRVLGLAGNKLSGKIPNSLGNLQHLIKIDLSRNKFVGSVPNTFTNLQNLISIDLSDNMLN  469

Query  644  GSIPDDIGNFYNLS-YLDLSMNSL  712
            GSIP +I N   LS +L+LS N L
Sbjct  470  GSIPIEILNLPKLSVFLNLSRNQL  493


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 71/123 (58%), Gaps = 6/123 (5%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  P+S  +  +++LV +N  +N+L G+IP++L   S L+ LDL+IN+L+G++    +
Sbjct  174  LSGEIPSS--LTNISSLVDLNLRTNNLGGSIPSDLWRLSNLKLLDLTINNLSGRVPLSLY  231

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLES---LDVSSNDLNGSIPDDIGNFYNLSYLDL  697
            +M  L  + L  N  +GE+P P +  +L +   L+   N   G+IP  + N  N+  + +
Sbjct  232  NMSALVYVALASNNFWGELP-PDIGITLPNLLGLNFCFNRFTGTIPSSLHNLTNIQTIQM  290

Query  698  SMN  706
            + N
Sbjct  291  ARN  293


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = +2

Query  347  MGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFF  526
            + G  PA   I  LN L  +  + N L G IP +L +   L  +DLS N   G +   F 
Sbjct  396  ISGEIPAE--IGLLNELRVLGLAGNKLSGKIPNSLGNLQHLIKIDLSRNKFVGSVPNTFT  453

Query  527  SMKTLRSLNLRGNMLFGEIPTPMVAYSLES--LDVSSNDLNGSIPDDIGNFYNLSYLDLS  700
            +++ L S++L  NML G IP  ++     S  L++S N L GSIP +IG+  N+  +++ 
Sbjct  454  NLQNLISIDLSDNMLNGSIPIEILNLPKLSVFLNLSRNQLTGSIPVEIGSLENIVVINIC  513

Query  701  MNSL  712
             N L
Sbjct  514  DNML  517



>ref|XP_007152971.1| hypothetical protein PHAVU_004G175700g [Phaseolus vulgaris]
 gb|ESW24965.1| hypothetical protein PHAVU_004G175700g [Phaseolus vulgaris]
Length=1011

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 93/178 (52%), Gaps = 4/178 (2%)
 Frame = +2

Query  161  YSQSLTTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSE  340
            +S S +   + E A+LL +KQ+   P  L     S SS C WP I C +NGSVT +++  
Sbjct  26   HSHSHSLLYDQEHAVLLKIKQYLQNPPFLHHWIPSNSSHCTWPEIRC-TNGSVTSLTMYN  84

Query  341  MIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGE  520
              +  + P    +C L +L  I+F  N + G  P +L +CSKLE LDLS N   G+I  +
Sbjct  85   TNITQTLPP--FLCDLKSLTHIDFQLNFIPGEFPTSLYNCSKLEYLDLSQNTFVGRIPDD  142

Query  521  FFSMKTLRSLNLRGNMLFGEIPTPM-VAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
               + +L  L+L GN   G+IP  +     L SL +     NGS P +IGN  NL  L
Sbjct  143  IHHLASLSFLSLGGNNFSGDIPASIGRLKQLRSLYLHQCLFNGSFPAEIGNLSNLELL  200


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 70/125 (56%), Gaps = 2/125 (2%)
 Frame = +2

Query  338  EMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAG  517
             M+     P+S  + QLN L   +   ++L G IP  +     LE LDLS N L+G+I  
Sbjct  206  HMLPPTKLPSS--LTQLNKLKVFHMFESNLVGEIPETIGHMVALENLDLSKNGLSGQIPN  263

Query  518  EFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDL  697
              F +K L  + +  N L G+IP  + A++L  LD+S N+L G IPDD+G    L+YL L
Sbjct  264  GLFMLKNLSIVYIYKNRLSGDIPGVVEAFNLTELDLSENNLTGKIPDDLGKLSKLTYLCL  323

Query  698  SMNSL  712
            SMN L
Sbjct  324  SMNQL  328


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (50%), Gaps = 2/113 (2%)
 Frame = +2

Query  335  SEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIA  514
            S  +  GS P    +  L +L  +    N   G +P+++ S   L  LDL+ N L+G+I 
Sbjct  490  SHNLFNGSIPLE--LTSLPHLTILLLDHNQFTGPLPSDIVSWKSLINLDLNHNQLSGEIP  547

Query  515  GEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNF  673
                 +  L  L+L  N + G+IP  +    L ++++SSN+L G IP +  N 
Sbjct  548  LAIAQLSALNILDLSENRISGQIPLQLALMRLTNINLSSNNLVGRIPSEFENL  600



>ref|XP_002981339.1| hypothetical protein SELMODRAFT_114392 [Selaginella moellendorffii]
 gb|EFJ17527.1| hypothetical protein SELMODRAFT_114392 [Selaginella moellendorffii]
Length=1220

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 88/162 (54%), Gaps = 11/162 (7%)
 Frame = +2

Query  257  WNSTSSPC---DWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSL  427
            W   SSPC    W GISC S G++  ISLS + + G   A+  +  L  L  ++ S+N+L
Sbjct  42   WIIGSSPCGAKKWTGISCASTGAIVAISLSGLELQGPISAATALLGLPVLEELDLSNNAL  101

Query  428  WGTIPANLSSCSKLETLDLSIN--------DLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
             G IP  L    K++ LDLS N         L G I    FS+  LR L+L  N+L G I
Sbjct  102  SGEIPPQLWQLPKIKRLDLSHNLLQGASFDRLFGHIPPSIFSLAALRQLDLSSNLLSGTI  161

Query  584  PTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNS  709
            P   ++ SL+ LD+++N L G IP  IG+  NL+ L L +NS
Sbjct  162  PASNLSRSLQILDLANNSLTGEIPPSIGDLSNLTELSLGLNS  203


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 75/154 (49%), Gaps = 24/154 (16%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            +  + LS  ++ G  P    I  L NL +++ SSN L G IP  L   SKL+ L+L  N 
Sbjct  615  LVELDLSNNLLQGRIPPE--ISLLANLTTLDLSSNMLQGRIPWQLGENSKLQGLNLGFNR  672

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA-YSLESLDVSSNDLNGSIPD-----  658
            LTG+I  E  +++ L  LN+ GN L G IP  +     L  LD S N L GS+PD     
Sbjct  673  LTGQIPPELGNLERLVKLNISGNALTGSIPDHLGQLLGLSHLDASGNGLTGSLPDSFSGL  732

Query  659  ----------------DIGNFYNLSYLDLSMNSL  712
                            +IG    LSYLDLS+N L
Sbjct  733  VSIVGLKNSLTGEIPSEIGGILQLSYLDLSVNKL  766


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTG  505
            + LS   + G  P+   I Q + LV ++ S+N L G IP  +S  + L TLDLS N L G
Sbjct  594  LDLSHNSLTGPIPSG--IGQCSVLVELDLSNNLLQGRIPPEISLLANLTTLDLSSNMLQG  651

Query  506  KIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNL  682
            +I  +      L+ LNL  N L G+IP  +     L  L++S N L GSIPD +G    L
Sbjct  652  RIPWQLGENSKLQGLNLGFNRLTGQIPPELGNLERLVKLNISGNALTGSIPDHLGQLLGL  711

Query  683  SYLDLSMNSL  712
            S+LD S N L
Sbjct  712  SHLDASGNGL  721


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = +2

Query  314  SVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIN  493
            S+ ++ LS   +    P S  I  L+ + SI+ +S  L G+IPA+L  CS LE L+L+ N
Sbjct  240  SLRKLDLSNNPLQSPIPDS--IGDLSRIQSISIASAQLNGSIPASLGRCSSLELLNLAFN  297

Query  494  DLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSL-ESLDVSSNDLNGSIPDDIGN  670
             L+G +  +  +++ + + ++ GN L G IP  +  + L +S+ +S+N  +GSIP ++G 
Sbjct  298  QLSGPLPDDLAALEKIITFSVVGNSLSGPIPRWIGQWQLADSILLSTNSFSGSIPPELGQ  357

Query  671  FYNLSYLDLSMNSL  712
               ++ L L  N L
Sbjct  358  CRAVTDLGLDNNQL  371


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 71/139 (51%), Gaps = 5/139 (4%)
 Frame = +2

Query  299  CNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETL  478
            C++ G +++++L    + GS  A   + +  NL  ++ + N L G IP   S   KL  L
Sbjct  380  CDA-GLLSQLTLDHNTLTGSL-AGGTLRRCGNLTQLDVTGNRLTGEIPRYFSDLPKLVIL  437

Query  479  DLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVA--YSLESLDVSSNDLNGSI  652
            D+S N   G I  E +    L  +    N+L G + +P+V    +L+ L +  N L+G +
Sbjct  438  DISTNFFVGSIPDELWHATQLMEIYASDNLLEGGL-SPLVGGMENLQHLYLDRNRLSGPL  496

Query  653  PDDIGNFYNLSYLDLSMNS  709
            P ++G   +L+ L L+ N+
Sbjct  497  PSELGLLKSLTVLSLAGNA  515


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 47/104 (45%), Gaps = 2/104 (2%)
 Frame = +2

Query  401  SINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGE  580
            SI  S+NS  G+IP  L  C  +  L L  N LTG I  E      L  L L  N L G 
Sbjct  339  SILLSTNSFSGSIPPELGQCRAVTDLGLDNNQLTGSIPPELCDAGLLSQLTLDHNTLTGS  398

Query  581  IP--TPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
            +   T     +L  LDV+ N L G IP    +   L  LD+S N
Sbjct  399  LAGGTLRRCGNLTQLDVTGNRLTGEIPRYFSDLPKLVILDISTN  442


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 6/122 (5%)
 Frame = +2

Query  353  GSFPASAIICQLNNLVSINFSSNS-LWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
            G  P S  I  L+NL  ++   NS L G+IP ++   SKLE L  +   LTG I      
Sbjct  182  GEIPPS--IGDLSNLTELSLGLNSALLGSIPPSIGKLSKLEILYAANCKLTGPIPRSL--  237

Query  530  MKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
              +LR L+L  N L   IP  +   S ++S+ ++S  LNGSIP  +G   +L  L+L+ N
Sbjct  238  PPSLRKLDLSNNPLQSPIPDSIGDLSRIQSISIASAQLNGSIPASLGRCSSLELLNLAFN  297

Query  707  SL  712
             L
Sbjct  298  QL  299


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = +2

Query  392  NLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNML  571
             L+ I  S N L G +   +     L+ L L  N L+G +  E   +K+L  L+L GN  
Sbjct  457  QLMEIYASDNLLEGGLSPLVGGMENLQHLYLDRNRLSGPLPSELGLLKSLTVLSLAGNAF  516

Query  572  FGEIPTPMVAYS--LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
             G IP  +   +  L +LD+  N L G+IP +IG    L  L LS N L
Sbjct  517  DGVIPREIFGGTTGLTTLDLGGNRLGGAIPPEIGKLVGLDCLVLSHNRL  565



>ref|XP_010911190.1| PREDICTED: receptor-like protein kinase HSL1, partial [Elaeis 
guineensis]
Length=482

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 104/188 (55%), Gaps = 9/188 (5%)
 Frame = +2

Query  161  YSQ--SLTTYGEDERAILLILKQHWGYPFSLFEQWNSTS--SPCDWPGISCNSNGSVTRI  328
            YSQ  S TT  + E+ ILL +K+ WG P S    WN ++  S C+W GI C+++GS+T I
Sbjct  19   YSQAASQTTTADGEKQILLRIKKDWGNP-SALSSWNDSTFTSHCNWTGIGCSADGSITNI  77

Query  329  SLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGK  508
            +L    +    PA+  IC L +L  ++ S N +    P +L +CS L+ LDLS N   G 
Sbjct  78   TLVNQNISQPIPAT--ICDLRSLSILDLSYNYITTPFPKSLYNCSNLQYLDLSQNYFIGV  135

Query  509  IAGEFFSMK-TLRSLNLRGNMLFGEIPTPMVAY-SLESLDVSSNDLNGSIPDDIGNFYNL  682
            I  + + +   L +L L  N L G+IP  +    ++E L +++N  N S P ++GN  NL
Sbjct  136  IPSDIYRLSPRLTTLILSANNLTGDIPRSIGRLPAIEYLALNNNHFNVSFPAELGNLSNL  195

Query  683  SYLDLSMN  706
              L L+ N
Sbjct  196  QTLLLAYN  203


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = +2

Query  359  FPASAIICQLNNLVSINF---SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFS  529
            F  ++I     NL  + F   +  +L G IP  +   +++  LDLS N L+G I    ++
Sbjct  205  FVPTSIPSTFRNLTQLGFLWMAQTNLKGEIPEFIGELTQMYQLDLSENSLSGSIPTGIWN  264

Query  530  MKTLRSLNLRGNMLFGEIPT--PMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSM  703
            +K L+ L L  N L G+I     + A  LE LDVS N L+GSIP++ G    LS L +  
Sbjct  265  LKKLQYLYLFKNNLTGDIKINGSIGALELEKLDVSINQLSGSIPEEFGKLPKLSILLMYY  324

Query  704  NSL  712
            N L
Sbjct  325  NRL  327



>ref|XP_010538183.1| PREDICTED: receptor-like protein kinase HSL1 [Tarenaya hassleriana]
Length=992

 Score = 99.0 bits (245),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 91/159 (57%), Gaps = 5/159 (3%)
 Frame = +2

Query  236  PFSLFEQWNSTS-SPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINF  412
            P S    WN    SPC W G+SC   GSVT + LS+  + G FP+  +IC+L NL  ++F
Sbjct  35   PDSSLSSWNPNDVSPCRWYGVSCGV-GSVTSVDLSDANLAGPFPS--VICRLPNLSFLSF  91

Query  413  SSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTP  592
             +NS+   +P ++++C  LE LDLS N  TGK+      +  L+ L+L GN   G+IP  
Sbjct  92   FNNSIASNLPIDVAACKSLEHLDLSQNLFTGKLPYTLADLPNLKYLDLTGNNFSGDIPAS  151

Query  593  MVAY-SLESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMN  706
               +  LE L +  N L+G+IP  +GN  +L  L+LS N
Sbjct  152  FGGFQKLEVLSLVYNLLDGTIPPFLGNISSLRMLNLSYN  190


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 2/127 (2%)
 Frame = +2

Query  332  LSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKI  511
            L+E  + G  P S  +  L  L  ++ + N L G IP++L   +++  ++L  N L+GKI
Sbjct  212  LTECNLVGKIPDS--LGGLGRLTDLDLALNKLEGPIPSSLGGLARVVQIELYNNSLSGKI  269

Query  512  AGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIPDDIGNFYNLSYL  691
              E  ++K+LR L+   N L G IP  +    LESL++  N+L G +P  I    NL  L
Sbjct  270  PPELGNLKSLRLLDASMNRLSGSIPDELCRVPLESLNLYENELEGELPSTIALSPNLYEL  329

Query  692  DLSMNSL  712
             +  N L
Sbjct  330  RIFRNRL  336


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 2/113 (2%)
 Frame = +2

Query  317  VTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDLSIND  496
            + ++S S+    GSFP S +  +L  L  ++   N   G +P  + S  KL  L+L+ N 
Sbjct  470  LNQLSASDNKFSGSFPGSMV--KLGGLSILDLHGNQFSGELPRGIESWKKLNELNLANNQ  527

Query  497  LTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYSLESLDVSSNDLNGSIP  655
             +G+I  E  S+  L  L+L  N   GEIP  +    L  L++S+N L+G +P
Sbjct  528  FSGRIPNEIGSLSVLNYLDLSDNRFSGEIPLSLQNLKLNQLNLSNNRLSGEVP  580


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 78/164 (48%), Gaps = 7/164 (4%)
 Frame = +2

Query  227  WGYPFS-LFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGGSFPASAIICQLNNLVS  403
            WG P   L E  N++ S      +S  SN S+  IS +E    GS P    I  L+NL  
Sbjct  417  WGLPHVYLLELVNNSFSGKIAKTVSGASNLSMLIISNNEF--SGSLPEE--IGFLDNLNQ  472

Query  404  INFSSNSLWGTIPANLSSCSKLETLDLSINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEI  583
            ++ S N   G+ P ++     L  LDL  N  +G++     S K L  LNL  N   G I
Sbjct  473  LSASDNKFSGSFPGSMVKLGGLSILDLHGNQFSGELPRGIESWKKLNELNLANNQFSGRI  532

Query  584  PTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYNLSYLDLSMNSL  712
            P  + + S L  LD+S N  +G IP  + N   L+ L+LS N L
Sbjct  533  PNEIGSLSVLNYLDLSDNRFSGEIPLSLQNL-KLNQLNLSNNRL  575


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (53%), Gaps = 4/131 (3%)
 Frame = +2

Query  326  ISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLW-GTIPANLSSCSKLETLDLSINDLT  502
            +SL   ++ G+ P    +  +++L  +N S N    G IP  L + + LE + L+  +L 
Sbjct  161  LSLVYNLLDGTIPP--FLGNISSLRMLNLSYNPFRPGRIPPELGNLTNLEVMWLTECNLV  218

Query  503  GKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDDIGNFYN  679
            GKI      +  L  L+L  N L G IP+ +   + +  +++ +N L+G IP ++GN  +
Sbjct  219  GKIPDSLGGLGRLTDLDLALNKLEGPIPSSLGGLARVVQIELYNNSLSGKIPPELGNLKS  278

Query  680  LSYLDLSMNSL  712
            L  LD SMN L
Sbjct  279  LRLLDASMNRL  289


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 66/137 (48%), Gaps = 3/137 (2%)
 Frame = +2

Query  305  SNGSVTRISLSEMIMGGSFPASAIICQLNNLVSINFSSNSLWGTIPANLSSCSKLETLDL  484
             N  +  + +SE    G  PA+  +C+   L  +    NS  G IP +LS C  L  + L
Sbjct  346  KNSPLKWLDVSENGFSGELPAT--LCENGELEELLIIQNSFSGQIPQSLSDCRSLYRIRL  403

Query  485  SINDLTGKIAGEFFSMKTLRSLNLRGNMLFGEIPTPMVAYS-LESLDVSSNDLNGSIPDD  661
              N L+ ++   F+ +  +  L L  N   G+I   +   S L  L +S+N+ +GS+P++
Sbjct  404  GHNRLSDQVPVAFWGLPHVYLLELVNNSFSGKIAKTVSGASNLSMLIISNNEFSGSLPEE  463

Query  662  IGNFYNLSYLDLSMNSL  712
            IG   NL+ L  S N  
Sbjct  464  IGFLDNLNQLSASDNKF  480



>gb|KCW57971.1| hypothetical protein EUGRSUZ_H00707 [Eucalyptus grandis]
Length=914

 Score = 99.0 bits (245),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 99/180 (55%), Gaps = 3/180 (2%)
 Frame = +2

Query  176  TTYGEDERAILLILKQHWGYPFSLFEQWNSTSSPCDWPGISCNSNGSVTRISLSEMIMGG  355
            T  GE+ RA+L        Y  +L   W     PC W GI C+ +GSV+ ++L++  + G
Sbjct  53   TAKGEEARALLEWKSGLDNYSQALLSSWQG-DDPCIWRGIGCDGSGSVSGLNLTDTGLQG  111

Quer