BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2072

Length=950
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09038.1|  unnamed protein product                                145   5e-37   Coffea canephora [robusta coffee]
ref|XP_009803866.1|  PREDICTED: uncharacterized protein LOC104249190    145   7e-37   Nicotiana sylvestris
ref|XP_004250964.1|  PREDICTED: uncharacterized protein LOC101256552    143   1e-36   Solanum lycopersicum
ref|XP_009620364.1|  PREDICTED: uncharacterized protein LOC104112207    141   1e-35   Nicotiana tomentosiformis
ref|XP_007016455.1|  Uncharacterized protein isoform 1                  132   6e-32   Theobroma cacao [chocolate]
gb|KHG00349.1|  Transcription factor SUM-1                              130   2e-31   Gossypium arboreum [tree cotton]
gb|KJB55899.1|  hypothetical protein B456_009G100200                    129   3e-31   Gossypium raimondii
ref|XP_002284037.1|  PREDICTED: uncharacterized protein LOC100248455    127   2e-30   Vitis vinifera
emb|CAN69364.1|  hypothetical protein VITISV_006045                     126   5e-30   Vitis vinifera
ref|XP_009618413.1|  PREDICTED: uncharacterized protein LOC104110593    125   6e-30   Nicotiana tomentosiformis
ref|XP_011089452.1|  PREDICTED: uncharacterized protein LOC105170399    124   3e-29   Sesamum indicum [beniseed]
gb|KJB06676.1|  hypothetical protein B456_001G109100                    121   2e-28   Gossypium raimondii
ref|XP_008223342.1|  PREDICTED: uncharacterized protein LOC103323...    120   1e-27   Prunus mume [ume]
ref|XP_008223338.1|  PREDICTED: uncharacterized protein LOC103323...    120   1e-27   Prunus mume [ume]
ref|XP_007206561.1|  hypothetical protein PRUPE_ppa019890mg             120   1e-27   Prunus persica
ref|XP_010253216.1|  PREDICTED: uncharacterized protein LOC104594570    120   1e-27   Nelumbo nucifera [Indian lotus]
gb|KJB20112.1|  hypothetical protein B456_003G133600                    118   4e-27   Gossypium raimondii
ref|XP_002299880.1|  hypothetical protein POPTR_0001s24520g             118   5e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009762001.1|  PREDICTED: uncharacterized protein LOC104214083    115   2e-26   Nicotiana sylvestris
ref|XP_012065016.1|  PREDICTED: uncharacterized protein LOC105628243    116   3e-26   Jatropha curcas
ref|XP_011461233.1|  PREDICTED: uncharacterized protein LOC101291...    115   5e-26   Fragaria vesca subsp. vesca
ref|XP_011461235.1|  PREDICTED: uncharacterized protein LOC101291...    115   5e-26   Fragaria vesca subsp. vesca
ref|XP_011000264.1|  PREDICTED: uncharacterized protein LOC105107884    115   6e-26   Populus euphratica
ref|XP_008385139.1|  PREDICTED: uncharacterized protein LOC103447724    114   9e-26   Malus domestica [apple tree]
ref|XP_010252138.1|  PREDICTED: uncharacterized protein LOC104593819    114   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_002314190.1|  hypothetical protein POPTR_0009s03470g             112   8e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006488301.1|  PREDICTED: uncharacterized protein LOC102610518    112   8e-25   Citrus sinensis [Valencia orange]
gb|KDO72890.1|  hypothetical protein CISIN_1g036629mg                   111   1e-24   Citrus sinensis [Valencia orange]
ref|XP_006424802.1|  hypothetical protein CICLE_v10028872mg             111   1e-24   Citrus clementina
ref|XP_009353698.1|  PREDICTED: uncharacterized protein LOC103944942    110   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_004142748.1|  PREDICTED: uncharacterized protein LOC101211670    110   4e-24   Cucumis sativus [cucumbers]
ref|XP_011042738.1|  PREDICTED: uncharacterized protein LOC105138381    109   5e-24   Populus euphratica
ref|XP_008458900.1|  PREDICTED: uncharacterized protein LOC103498168    110   5e-24   Cucumis melo [Oriental melon]
ref|XP_008448398.1|  PREDICTED: uncharacterized protein LOC103490597    108   1e-23   Cucumis melo [Oriental melon]
ref|XP_006378718.1|  hypothetical protein POPTR_0010s21310g             108   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002532293.1|  conserved hypothetical protein                     108   2e-23   Ricinus communis
ref|XP_011090081.1|  PREDICTED: uncharacterized protein LOC105170857    107   2e-23   Sesamum indicum [beniseed]
ref|XP_011027177.1|  PREDICTED: uncharacterized protein LOC105127533    107   3e-23   Populus euphratica
ref|XP_003633292.1|  PREDICTED: uncharacterized protein LOC100249867    106   7e-23   Vitis vinifera
ref|XP_002283778.1|  PREDICTED: uncharacterized protein LOC100253074    106   1e-22   Vitis vinifera
ref|XP_011657164.1|  PREDICTED: uncharacterized protein LOC101220684    105   1e-22   Cucumis sativus [cucumbers]
gb|EYU36263.1|  hypothetical protein MIMGU_mgv1a011694mg                105   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_002311163.2|  hypothetical protein POPTR_0008s05450g             104   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_012089431.1|  PREDICTED: uncharacterized protein LOC105647810    103   4e-22   Jatropha curcas
ref|XP_006436013.1|  hypothetical protein CICLE_v10032119mg             103   1e-21   Citrus clementina
ref|XP_011027862.1|  PREDICTED: uncharacterized protein LOC105128025    101   3e-21   Populus euphratica
ref|XP_009358360.1|  PREDICTED: uncharacterized protein LOC103948985    101   3e-21   Pyrus x bretschneideri [bai li]
ref|XP_008357486.1|  PREDICTED: uncharacterized protein LOC103421235    101   3e-21   Malus domestica [apple tree]
ref|XP_008802763.1|  PREDICTED: uncharacterized protein LOC103716...  96.7    2e-20   Phoenix dactylifera
ref|XP_007139239.1|  hypothetical protein PHAVU_008G012900g           98.2    3e-20   Phaseolus vulgaris [French bean]
ref|XP_008802762.1|  PREDICTED: uncharacterized protein LOC103716...  96.7    1e-19   Phoenix dactylifera
ref|XP_010922359.1|  PREDICTED: uncharacterized protein LOC105045691  96.3    2e-19   Elaeis guineensis
ref|XP_009416133.1|  PREDICTED: uncharacterized protein LOC103996838  95.5    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007220066.1|  hypothetical protein PRUPE_ppa025332mg           95.1    5e-19   Prunus persica
ref|XP_008233609.1|  PREDICTED: uncharacterized protein LOC103332636  94.7    8e-19   Prunus mume [ume]
ref|XP_004307538.1|  PREDICTED: uncharacterized protein LOC101294306  94.4    9e-19   Fragaria vesca subsp. vesca
ref|XP_006603035.1|  PREDICTED: uncharacterized protein LOC102662...  94.0    9e-19   
ref|XP_007009365.1|  Pentatricopeptide repeat-containing protein,...  95.9    1e-18   Theobroma cacao [chocolate]
gb|EYU18959.1|  hypothetical protein MIMGU_mgv1a012478mg              92.8    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_010918393.1|  PREDICTED: uncharacterized protein LOC105042774  92.8    4e-18   Elaeis guineensis
gb|KHN13892.1|  hypothetical protein glysoja_016176                   92.0    4e-18   Glycine soja [wild soybean]
ref|XP_010067398.1|  PREDICTED: uncharacterized protein LOC104454286  91.3    6e-18   Eucalyptus grandis [rose gum]
ref|XP_006574854.1|  PREDICTED: uncharacterized protein LOC100784...  90.1    2e-17   Glycine max [soybeans]
ref|XP_010033140.1|  PREDICTED: uncharacterized protein LOC104422503  89.4    5e-17   Eucalyptus grandis [rose gum]
ref|XP_008776689.1|  PREDICTED: uncharacterized protein LOC103696750  88.2    1e-16   Phoenix dactylifera
ref|XP_006846119.2|  PREDICTED: uncharacterized protein LOC18436028   87.8    3e-16   Amborella trichopoda
gb|ERN07794.1|  hypothetical protein AMTR_s00012p00143310             87.8    3e-16   Amborella trichopoda
ref|XP_004487018.1|  PREDICTED: uncharacterized protein LOC101511700  84.7    2e-15   Cicer arietinum [garbanzo]
ref|XP_004492124.1|  PREDICTED: uncharacterized protein LOC101499955  84.3    2e-15   Cicer arietinum [garbanzo]
gb|AES78094.2|  transmembrane protein, putative                       84.0    2e-15   Medicago truncatula
gb|AFK46332.1|  unknown                                               82.8    3e-15   Lotus japonicus
ref|XP_010108745.1|  hypothetical protein L484_011403                 82.8    1e-14   Morus notabilis
emb|CDP00076.1|  unnamed protein product                              82.0    2e-14   Coffea canephora [robusta coffee]
ref|XP_009357714.1|  PREDICTED: uncharacterized protein LOC103948407  80.9    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_008371593.1|  PREDICTED: uncharacterized protein LOC103434986  80.9    3e-14   Malus domestica [apple tree]
ref|XP_008343543.1|  PREDICTED: uncharacterized protein LOC103406324  79.3    8e-14   Malus domestica [apple tree]
ref|XP_008370730.1|  PREDICTED: uncharacterized protein LOC103434193  79.3    8e-14   Malus domestica [apple tree]
ref|XP_009388620.1|  PREDICTED: uncharacterized protein LOC103975390  79.0    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010669892.1|  PREDICTED: uncharacterized protein LOC104887013  79.3    2e-13   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006345955.1|  PREDICTED: uncharacterized protein LOC102580380  78.6    3e-13   Solanum tuberosum [potatoes]
ref|XP_009625921.1|  PREDICTED: uncharacterized protein LOC104116711  77.0    8e-13   Nicotiana tomentosiformis
ref|XP_009384831.1|  PREDICTED: uncharacterized protein LOC103972270  76.6    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH39417.1|  transmembrane protein, putative                       74.7    4e-12   Medicago truncatula
ref|XP_009381069.1|  PREDICTED: uncharacterized protein LOC103969300  74.7    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004239786.1|  PREDICTED: uncharacterized protein LOC101263027  74.7    5e-12   Solanum lycopersicum
ref|XP_011091461.1|  PREDICTED: uncharacterized protein LOC105171902  73.6    6e-12   Sesamum indicum [beniseed]
gb|EPS57174.1|  hypothetical protein M569_17647                       71.2    4e-11   Genlisea aurea
ref|XP_010685790.1|  PREDICTED: uncharacterized protein LOC104900...  72.4    4e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010520280.1|  PREDICTED: uncharacterized protein LOC104799446  70.9    1e-10   Tarenaya hassleriana [spider flower]
gb|KJB73843.1|  hypothetical protein B456_011G256800                  67.0    9e-10   Gossypium raimondii
gb|KJB73844.1|  hypothetical protein B456_011G256800                  67.0    2e-09   Gossypium raimondii
ref|XP_009769532.1|  PREDICTED: uncharacterized protein LOC104220372  67.4    2e-09   Nicotiana sylvestris
ref|XP_010535505.1|  PREDICTED: uncharacterized protein LOC104810787  66.2    5e-09   Tarenaya hassleriana [spider flower]
ref|XP_010106447.1|  hypothetical protein L484_025204                 65.9    7e-09   Morus notabilis
ref|XP_006280849.1|  hypothetical protein CARUB_v10026835mg           65.5    9e-09   Capsella rubella
gb|KFK27464.1|  hypothetical protein AALP_AA8G386500                  65.5    1e-08   Arabis alpina [alpine rockcress]
ref|XP_006400971.1|  hypothetical protein EUTSA_v10014249mg           64.7    2e-08   Eutrema salsugineum
ref|XP_007150313.1|  hypothetical protein PHAVU_005G143000g           63.2    7e-08   Phaseolus vulgaris [French bean]
ref|XP_003542025.1|  PREDICTED: uncharacterized protein LOC100787251  62.8    9e-08   Glycine max [soybeans]
gb|KHN33394.1|  hypothetical protein glysoja_005436                   61.6    2e-07   Glycine soja [wild soybean]
ref|XP_006597277.1|  PREDICTED: uncharacterized protein LOC102670362  61.6    2e-07   Glycine max [soybeans]
ref|XP_010454903.1|  PREDICTED: uncharacterized protein LOC104736584  61.2    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010483553.1|  PREDICTED: uncharacterized protein LOC104762...  60.8    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010443687.1|  PREDICTED: uncharacterized protein LOC104726517  60.5    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009420089.1|  PREDICTED: uncharacterized protein LOC103999913  59.7    7e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB78845.1|  hypothetical protein B456_013G022600                  57.4    3e-06   Gossypium raimondii
ref|NP_200743.1|  uncharacterized protein                             57.0    6e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62607.1|  unknown                                               56.6    8e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KJB60678.1|  hypothetical protein B456_009G319200                  55.8    1e-05   Gossypium raimondii
ref|XP_009126699.1|  PREDICTED: uncharacterized protein LOC103851582  51.2    6e-04   Brassica rapa



>emb|CDP09038.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 93/126 (74%), Gaps = 9/126 (7%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M SFSGLGIGLSFVFGCI +GLVAELYYLLW ++RI +RE E  +T+  ++I+YLFC KK
Sbjct  1    MGSFSGLGIGLSFVFGCIFLGLVAELYYLLWWKKRINNREIEDHFTNYAAEISYLFCWKK  60

Query  764  SNSVVT-RTSTQALT----TSELNGYSQDLEV-GTGKDSLL--KGFGEDDGVESXLMRLH  919
            SNS  + R  TQ L      SE++G+  DLE+ G GKD  +  KGFGE + VES LMRLH
Sbjct  61   SNSTDSRRNDTQELAASVINSEVSGHENDLELGGNGKDGSMQFKGFGE-ESVESELMRLH  119

Query  920  NLCGPP  937
            NLCGPP
Sbjct  120  NLCGPP  125



>ref|XP_009803866.1| PREDICTED: uncharacterized protein LOC104249190 [Nicotiana sylvestris]
Length=344

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 90/124 (73%), Gaps = 7/124 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRD---RETEGEYTSIGSDIAYLFC  754
            MASFSGLGIGLSFVFGCILMGLVAELYYLLWV++RI      +     +S G+++ +LFC
Sbjct  1    MASFSGLGIGLSFVFGCILMGLVAELYYLLWVKKRIPKSESEDEYSSSSSYGTELFHLFC  60

Query  755  CKKSNSVVTRTSTQ---ALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL  925
             KK NSV   +S +    L   E+NG  QDLE+G  KD LLKG+GE D VES LMRLHNL
Sbjct  61   WKKPNSVSNISSQELNNTLRNQEMNGQDQDLELGNSKDLLLKGYGE-DSVESELMRLHNL  119

Query  926  CGPP  937
            CGPP
Sbjct  120  CGPP  123



>ref|XP_004250964.1| PREDICTED: uncharacterized protein LOC101256552 [Solanum lycopersicum]
Length=276

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 91/128 (71%), Gaps = 14/128 (11%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY------TSIGSDIAY  745
            M+SFSGLGIGLSFVFGCILM LVAELYYLLWVR+RI   ETE +Y      T   +++++
Sbjct  1    MSSFSGLGIGLSFVFGCILMALVAELYYLLWVRKRIPKNETETQYNNNNTTTPCATELSH  60

Query  746  LFCCKKSNSVVTRTSTQALTTSELNGY----SQDLEVGTGKDSLLKGFGEDDGVESXLMR  913
            LFC KK    V   S+Q  + +E+ G+     QDLE+G  KD LLKG+GE D VES LMR
Sbjct  61   LFCWKKPTKNV---SSQQRSNTEMTGHVHDQDQDLELGNSKDLLLKGYGE-DSVESELMR  116

Query  914  LHNLCGPP  937
            LHNLCGPP
Sbjct  117  LHNLCGPP  124



>ref|XP_009620364.1| PREDICTED: uncharacterized protein LOC104112207 [Nicotiana tomentosiformis]
Length=298

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 10/125 (8%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRD---RETEGEYTSIGSDIAYLFC  754
            MASFSGLGIGLSFVFGCILMGLVAELYYLLWV++RI      +     +S G+++ +L C
Sbjct  1    MASFSGLGIGLSFVFGCILMGLVAELYYLLWVKKRIPKSESEDEYSSSSSYGTELFHLLC  60

Query  755  CKKSNSVVTRTSTQALTTS----ELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHN  922
             KK NSV    S+Q L ++    E+NG  QDLE+G  KD LLKG+GE D VES LMRLHN
Sbjct  61   WKKPNSV--NVSSQELNSTLRNPEMNGQDQDLELGNSKDLLLKGYGE-DSVESELMRLHN  117

Query  923  LCGPP  937
            LCGPP
Sbjct  118  LCGPP  122



>ref|XP_007016455.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007016456.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY34074.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY34075.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=311

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M SFSGLGIGLS VFGC+L+ LVAELYYLLW ++RI   E E +Y++   ++ +LFC KK
Sbjct  1    MTSFSGLGIGLSLVFGCLLLALVAELYYLLWWKKRIASSEVEDDYSNYAKELIHLFCWKK  60

Query  764  S---NSVVTRTSTQALTTSE-LNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCG  931
            S   ++  T T+ Q L   +  NG   D E+G+GKD LLKGFGE +GVES LMRLHNL G
Sbjct  61   SAALHATTTTTNNQDLVKDQDTNGVELDPELGSGKDLLLKGFGE-EGVESELMRLHNLAG  119

Query  932  PP  937
            PP
Sbjct  120  PP  121



>gb|KHG00349.1| Transcription factor SUM-1 [Gossypium arboreum]
Length=313

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 83/118 (70%), Gaps = 3/118 (3%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M SFSGLGIGLS VFGC+++ LVAELYYLLW ++RI + E E +YT+   D+  L C KK
Sbjct  15   MKSFSGLGIGLSLVFGCLVLALVAELYYLLWWKKRIANAEVEYDYTNYAKDLVQLLCWKK  74

Query  764  SNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
            S S+    +T   +  + NG   DLE+G+ K  +LKGFGE +GVES LMRLHNL GPP
Sbjct  75   SASL--HATTIPNSNQDSNGVEPDLELGSTKGLMLKGFGE-EGVESELMRLHNLAGPP  129



>gb|KJB55899.1| hypothetical protein B456_009G100200 [Gossypium raimondii]
 gb|KJB55900.1| hypothetical protein B456_009G100200 [Gossypium raimondii]
Length=294

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 3/118 (3%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M SFSGLGIGLS VFGC+++ LVAELYYLLW ++RI + E E +YT+   D+  L C KK
Sbjct  1    MKSFSGLGIGLSLVFGCLVLALVAELYYLLWWKKRIANAEVEYDYTNYAKDLVQLLCWKK  60

Query  764  SNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
            S S+   T   +   S  NG   DLE+G+ K  +LKGFGE +GVES LMRLHNL GPP
Sbjct  61   SASLHATTIPNSSQGS--NGVEPDLELGSTKGLMLKGFGE-EGVESELMRLHNLAGPP  115



>ref|XP_002284037.1| PREDICTED: uncharacterized protein LOC100248455 [Vitis vinifera]
Length=319

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            MASFSGLGI LS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++ Y+FC K+
Sbjct  1    MASFSGLGICLSLVFGCLLLALVAELYYLLWWKKRITNREIEYDYSNCAKELFYIFCWKR  60

Query  764  SNSVVTRTSTQALTTSEL-NGY-SQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
               + + ++ Q      + NG+  QD E+G+GKD LLK FGE +GVES LMRLHNL GPP
Sbjct  61   PAPLSSSSTQQLSVRDPVPNGHDEQDPELGSGKDLLLKAFGE-EGVESELMRLHNLAGPP  119



>emb|CAN69364.1| hypothetical protein VITISV_006045 [Vitis vinifera]
Length=313

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            MASFSGLGI LS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++ Y+FC K+
Sbjct  1    MASFSGLGICLSLVFGCLLLALVAELYYLLWWKKRITNREIEYDYSNXAKELFYIFCWKR  60

Query  764  SNSVVTRTSTQALTTSEL-NGY-SQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
               + + ++ Q      + NG+  QD E+G+GKD LLK F E++GVES LMRLHNL GPP
Sbjct  61   PAPLSSSSTQQLSVRDPVPNGHDEQDPELGSGKDLLLKAF-EEEGVESELMRLHNLAGPP  119



>ref|XP_009618413.1| PREDICTED: uncharacterized protein LOC104110593 [Nicotiana tomentosiformis]
Length=256

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 86/138 (62%), Gaps = 25/138 (18%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            MA+F  LGIGLSF+ GC+LMG VAELYYLLWV++ I  R TE +YT+  ++++ +FC K+
Sbjct  1    MATFGALGIGLSFLLGCMLMGFVAELYYLLWVKKGISKRPTEDQYTTYPTELSSIFCWKR  60

Query  764  SNSVVTRTSTQALTT----SELNGYSQDLEVGTGKDSLLKGFGED---------------  886
            SNS + +  TQ +TT     E+NG  QDLE+GT  D LLKG+GED               
Sbjct  61   SNS-IRQNGTQKVTTIARNQEINGQDQDLELGTNNDLLLKGYGEDDVESSSHQEDYSIKL  119

Query  887  -----DGVESXLMRLHNL  925
                 D  E  LMR+HNL
Sbjct  120  ERYTEDNAELELMRVHNL  137



>ref|XP_011089452.1| PREDICTED: uncharacterized protein LOC105170399 [Sesamum indicum]
Length=289

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 83/125 (66%), Gaps = 16/125 (13%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRI----RDRETEGEYTSIGSDIAYLF  751
            M SFSGLGIGLSFVFGCILMGLV ELYY LW ++R+      RE E        D ++LF
Sbjct  1    MGSFSGLGIGLSFVFGCILMGLVGELYYFLWWKKRVGYTSSTREIE--------DFSFLF  52

Query  752  CCKK--SNSVVTRTSTQALTTSELNGYSQ-DLEVGTGKDSLLKGFGEDDGVESXLMRLHN  922
            C K+  S S  +  STQ LT S  N   Q DLE+G+ KD  LKG+GE  GVE+ LMR+HN
Sbjct  53   CWKRPSSTSFNSAGSTQELTNSVRNPQEQEDLEMGSTKDLELKGYGE-QGVETELMRMHN  111

Query  923  LCGPP  937
            LCGPP
Sbjct  112  LCGPP  116



>gb|KJB06676.1| hypothetical protein B456_001G109100 [Gossypium raimondii]
 gb|KJB06677.1| hypothetical protein B456_001G109100 [Gossypium raimondii]
Length=298

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 80/124 (65%), Gaps = 7/124 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M SFSGL IGLS VFGC+L+ LVAELYYLLW ++RI   + E +Y +   ++  LFC KK
Sbjct  1    MTSFSGLSIGLSLVFGCLLLALVAELYYLLWWKKRIISSQVEDDYNNYAKELVQLFCWKK  60

Query  764  SNSVVTRTSTQA------LTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL  925
            S S+   T+         +   + N    DLE+G+ +  L+KGFGE+D VES LMRLHNL
Sbjct  61   SASLHASTAANNNNNQGLVKNKDSNSVEPDLELGSSRSLLVKGFGEED-VESELMRLHNL  119

Query  926  CGPP  937
             GPP
Sbjct  120  AGPP  123



>ref|XP_008223342.1| PREDICTED: uncharacterized protein LOC103323148 isoform X2 [Prunus 
mume]
Length=303

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M SFSGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++    C KK
Sbjct  1    MTSFSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEEDYSNHAKELFQFSCWKK  60

Query  764  SNSVVTRTSTQALTTSELNGYS---QDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGP  934
             +S+ T +++Q         +S    DLE+G+ KD LLK  GE++   S LMRLHNL GP
Sbjct  61   PSSLQTNSNSQENVREPDANHSSSESDLELGSSKDLLLKLNGEENVEISELMRLHNLAGP  120

Query  935  P  937
            P
Sbjct  121  P  121



>ref|XP_008223338.1| PREDICTED: uncharacterized protein LOC103323148 isoform X1 [Prunus 
mume]
Length=309

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M SFSGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++    C KK
Sbjct  1    MTSFSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEEDYSNHAKELFQFSCWKK  60

Query  764  SNSVVTRTSTQALTTSELNGYS---QDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGP  934
             +S+ T +++Q         +S    DLE+G+ KD LLK  GE++   S LMRLHNL GP
Sbjct  61   PSSLQTNSNSQENVREPDANHSSSESDLELGSSKDLLLKLNGEENVEISELMRLHNLAGP  120

Query  935  P  937
            P
Sbjct  121  P  121



>ref|XP_007206561.1| hypothetical protein PRUPE_ppa019890mg [Prunus persica]
 gb|EMJ07760.1| hypothetical protein PRUPE_ppa019890mg [Prunus persica]
Length=309

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M SFSGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++    C KK
Sbjct  1    MTSFSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEEDYSNHAKELFQFSCWKK  60

Query  764  SNSVVTRTSTQALTTSELNGYS---QDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGP  934
             +S+ T +++Q         +S    DLE+G+ KD LLK  GE++   S LMRLHNL GP
Sbjct  61   PSSLQTNSNSQENVREPDANHSSSESDLELGSSKDLLLKLNGEENVEISELMRLHNLAGP  120

Query  935  P  937
            P
Sbjct  121  P  121



>ref|XP_010253216.1| PREDICTED: uncharacterized protein LOC104594570 [Nelumbo nucifera]
Length=312

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 18/131 (14%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S LGIGLS VFGC+L+ LVAELYYLLW ++R  +RE E +Y++   ++ YLFCCKK
Sbjct  1    MRSLSSLGIGLSLVFGCLLLALVAELYYLLWWKKRTTNREIEDDYSNSVRELFYLFCCKK  60

Query  764  SNSVVTRTSTQALTTSEL-------NGYSQD------LEVGTGKDSLLKGFGEDDGVESX  904
             + +    S+ AL   EL       + ++ +      L  G+ KD LLK FGE DG+E+ 
Sbjct  61   PSLL----SSTALNPQELWTTVRITDAHAHESENQVHLHSGSNKDFLLKSFGE-DGMETE  115

Query  905  LMRLHNLCGPP  937
            LMRLHNL GPP
Sbjct  116  LMRLHNLSGPP  126



>gb|KJB20112.1| hypothetical protein B456_003G133600 [Gossypium raimondii]
Length=303

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR--IRDRETEGEYTSIGSDIAYLFCC  757
            M SFSGLGIGLS VFGC+ + LVAELYYLLW +++  +   + E +Y+    ++ +LFC 
Sbjct  1    MTSFSGLGIGLSLVFGCLFLALVAELYYLLWWKKKRIVSSSQVEDDYSKYAKELIHLFCW  60

Query  758  KKSNSVVTRTSTQALTTSELNGYSQ-DLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGP  934
            KKS+ +   ++   L    +NG  + DLE G+ KD LLKGFGE +GVES LMRLHNL GP
Sbjct  61   KKSSPLHAPSTHGDLG---INGVVEPDLEHGSTKDLLLKGFGE-EGVESELMRLHNLAGP  116

Query  935  P  937
            P
Sbjct  117  P  117



>ref|XP_002299880.1| hypothetical protein POPTR_0001s24520g [Populus trichocarpa]
 gb|EEE84685.1| hypothetical protein POPTR_0001s24520g [Populus trichocarpa]
Length=313

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 80/121 (66%), Gaps = 4/121 (3%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGE---YTSIGSDIAYLFC  754
            M SFSGLG+GLS VFGC L+ LVAEL+YLLW ++R+ +R+ E E    +S   +  +L C
Sbjct  1    MVSFSGLGLGLSLVFGCFLLALVAELFYLLWWKKRVTNRKVEEEDDYSSSYAKEFFHLIC  60

Query  755  CKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGP  934
             KK++S+ +  +   +   E      DLE+GT KD L+K  GE + VES +MRLHNLCGP
Sbjct  61   WKKASSLRSNITQDGVREPEGPRQEPDLELGTNKDLLIKTLGE-ESVESEIMRLHNLCGP  119

Query  935  P  937
            P
Sbjct  120  P  120



>ref|XP_009762001.1| PREDICTED: uncharacterized protein LOC104214083 [Nicotiana sylvestris]
Length=243

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 79/134 (59%), Gaps = 30/134 (22%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            MA+F  LGIGLSF+ GC+LMG VAELYY+LWV++ I  R TE         ++ +FC KK
Sbjct  1    MATFGALGIGLSFLLGCMLMGFVAELYYILWVKKGISKRPTE---------LSSIFCWKK  51

Query  764  SNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDG-----------------  892
            SNS V +  TQ +TT E+NG  QDLE+GT    LLKGF EDDG                 
Sbjct  52   SNS-VRKNGTQEVTTIEINGQDQDLELGTNNGLLLKGFVEDDGESSSHQEDYPIKLERYR  110

Query  893  ---VESXLMRLHNL  925
                E  LMRLHNL
Sbjct  111  EDNAELELMRLHNL  124



>ref|XP_012065016.1| PREDICTED: uncharacterized protein LOC105628243 [Jatropha curcas]
 gb|KDP44221.1| hypothetical protein JCGZ_05688 [Jatropha curcas]
Length=311

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 81/124 (65%), Gaps = 7/124 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETE--GEYTS-IGSDIAYLFC  754
            M SFSGLGIGLS VFGC+L+ LVAELYYLL+ ++R+ +RE E   +Y+S    +  +L C
Sbjct  1    MGSFSGLGIGLSLVFGCLLLALVAELYYLLFWKKRVANREIEENEDYSSNYAKEFFHLIC  60

Query  755  CKKSNSVVTRTSTQALTTSELNG---YSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL  925
             KK  S +   ST       ++      QDLE+GT KD L+K FGE + VES LMRLHNL
Sbjct  61   WKKHTSHLQGNSTNTQIRDPMDHCLQEQQDLELGTSKDLLIKAFGE-ESVESELMRLHNL  119

Query  926  CGPP  937
             GPP
Sbjct  120  SGPP  123



>ref|XP_011461233.1| PREDICTED: uncharacterized protein LOC101291610 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011461234.1| PREDICTED: uncharacterized protein LOC101291610 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=321

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 77/123 (63%), Gaps = 5/123 (4%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCC-K  760
            M S SGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E E  S    + + F C K
Sbjct  1    MTSLSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEDENYSNQPKVLFQFSCFK  60

Query  761  KSNSVVTR----TSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLC  928
            K +S+ T      S + +   + N    DLE+G+ KD LLK    +D VES L RLHNL 
Sbjct  61   KPSSLQTLNNNINSEENVRNPDANSGEPDLELGSSKDLLLKANYGEDSVESELKRLHNLA  120

Query  929  GPP  937
            GPP
Sbjct  121  GPP  123



>ref|XP_011461235.1| PREDICTED: uncharacterized protein LOC101291610 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=308

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 77/123 (63%), Gaps = 5/123 (4%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCC-K  760
            M S SGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E E  S    + + F C K
Sbjct  1    MTSLSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEDENYSNQPKVLFQFSCFK  60

Query  761  KSNSVVTR----TSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLC  928
            K +S+ T      S + +   + N    DLE+G+ KD LLK    +D VES L RLHNL 
Sbjct  61   KPSSLQTLNNNINSEENVRNPDANSGEPDLELGSSKDLLLKANYGEDSVESELKRLHNLA  120

Query  929  GPP  937
            GPP
Sbjct  121  GPP  123



>ref|XP_011000264.1| PREDICTED: uncharacterized protein LOC105107884 [Populus euphratica]
Length=319

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 80/121 (66%), Gaps = 4/121 (3%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGE---YTSIGSDIAYLFC  754
            M SFSGLG+GLS VFGC L+ LVAEL+YLLW ++R+ +R+ E E    +S   +  +L C
Sbjct  7    MISFSGLGLGLSLVFGCFLLALVAELFYLLWWKKRVTNRKVEEEDDYSSSYAKEFFHLIC  66

Query  755  CKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGP  934
             KK++S  ++ +   +   E      DLE+GT KD L+K  GE + VE+ +MRLHNLCGP
Sbjct  67   WKKASSFRSKITQGGVREPEGPCQEPDLELGTSKDLLIKTLGE-ESVEAEIMRLHNLCGP  125

Query  935  P  937
            P
Sbjct  126  P  126



>ref|XP_008385139.1| PREDICTED: uncharacterized protein LOC103447724 [Malus domestica]
Length=312

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 82/131 (63%), Gaps = 13/131 (10%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGE-----YTSIGSDIAYL  748
            M SF GLGIGL  VFGC+L+GLVAELYYLLW ++RI +RE E E       S   +I + 
Sbjct  1    MTSFRGLGIGLGIVFGCLLLGLVAELYYLLWGKKRITNREIEEEEDDGYIISHAKEIFHF  60

Query  749  FCCKKSNSVVTRTSTQALTTSEL-------NGYSQ-DLEVGTGKDSLLKGFGEDDGVESX  904
             C KK NS  TR++  + +   L       NG S+ DLE+G+ KD LLK  GE++   S 
Sbjct  61   NCFKKPNSFHTRSNGNSNSHENLREPDVNVNGSSEPDLEMGSSKDLLLKLNGEENVEISE  120

Query  905  LMRLHNLCGPP  937
            LMRLHNL GPP
Sbjct  121  LMRLHNLAGPP  131



>ref|XP_010252138.1| PREDICTED: uncharacterized protein LOC104593819 [Nelumbo nucifera]
Length=317

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 82/131 (63%), Gaps = 18/131 (14%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S SGLGIGLS VFGC+L+ LVAE YYLLW ++RI +RE E +Y+S   ++ YLFC KK
Sbjct  1    MRSLSGLGIGLSLVFGCLLLALVAEFYYLLWWKKRITNREIEEDYSSSTRELFYLFCWKK  60

Query  764  SNSVVTRTSTQALTTSEL---------NGYSQDLEV----GTGKDSLLKGFGEDDGVESX  904
             + +    S+ AL   EL         + +  D +V    G+ KD +LK  GE D +++ 
Sbjct  61   PSPL----SSTALNPQELCTTVRITDAHVHEPDTQVHLHSGSSKDFMLKPLGE-DSMDTE  115

Query  905  LMRLHNLCGPP  937
            LMRLHNL GPP
Sbjct  116  LMRLHNLSGPP  126



>ref|XP_002314190.1| hypothetical protein POPTR_0009s03470g [Populus trichocarpa]
 gb|EEE88145.1| hypothetical protein POPTR_0009s03470g [Populus trichocarpa]
Length=312

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETE---GEYTSIGSDIAYLFC  754
            M SFS LGIGL  VFGC+L+ +VAELYYLLW ++RI +RE E   G  ++      +L C
Sbjct  1    MTSFSELGIGLGLVFGCLLLAIVAELYYLLWWKKRISNREVEEDDGYSSNYAKGFFHLIC  60

Query  755  CKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGP  934
             KK +   +  +   +   E      D E+GT KD L+K FGE +  ES +MRLHNLCGP
Sbjct  61   WKKPSFFRSNITQDVVRDPEAPCQEPDQELGTSKDLLIKAFGE-ESAESEIMRLHNLCGP  119

Query  935  P  937
            P
Sbjct  120  P  120



>ref|XP_006488301.1| PREDICTED: uncharacterized protein LOC102610518 [Citrus sinensis]
Length=314

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 79/124 (64%), Gaps = 8/124 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDR-ETEGEYTSIGSD-IAYLFCC  757
            MASFSGLGIGLS VFGC+ + LVAELYY+LW ++RI  R E E EY +   +    LFC 
Sbjct  1    MASFSGLGIGLSLVFGCLFLALVAELYYVLWWKKRINHRQEIEDEYGNYAKEYFIQLFCW  60

Query  758  KKSNSVVTRTSTQALTTSELNGYS----QDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL  925
            KK +S+ +   TQ     ++N        D E+GT KD LLK FG++  V S LMRLHNL
Sbjct  61   KKPSSLHS-DHTQDRERGQINANGGHELADPELGTSKDLLLKAFGDESEV-SELMRLHNL  118

Query  926  CGPP  937
             GPP
Sbjct  119  AGPP  122



>gb|KDO72890.1| hypothetical protein CISIN_1g036629mg [Citrus sinensis]
Length=314

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 79/124 (64%), Gaps = 8/124 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDR-ETEGEYTSIGSD-IAYLFCC  757
            MASFSGLGIGLS VFGC+ + LVAELYY+LW ++RI  R E E EY +   +    LFC 
Sbjct  1    MASFSGLGIGLSLVFGCLFLALVAELYYVLWWKKRINHRQEIEDEYGNYAKEYFIQLFCW  60

Query  758  KKSNSVVTRTSTQALTTSELNGYS----QDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL  925
            KK +S+ +   TQ     ++N        D E+GT KD LLK FG++  V S LMRLHNL
Sbjct  61   KKPSSLHS-DHTQDRERGQINANGGHELADPELGTSKDLLLKAFGDESEV-SELMRLHNL  118

Query  926  CGPP  937
             GPP
Sbjct  119  AGPP  122



>ref|XP_006424802.1| hypothetical protein CICLE_v10028872mg [Citrus clementina]
 gb|ESR38042.1| hypothetical protein CICLE_v10028872mg [Citrus clementina]
Length=314

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 79/124 (64%), Gaps = 8/124 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDR-ETEGEYTSIGSD-IAYLFCC  757
            MASFSGLGIGLS VFGC+ + LVAELYY+LW ++RI  R E E EY +   +    LFC 
Sbjct  1    MASFSGLGIGLSLVFGCLFLALVAELYYVLWWKKRINHRQEIEDEYGNYAKEYFIQLFCW  60

Query  758  KKSNSVVTRTSTQALTTSELNGYS----QDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL  925
            KK +S+ +   TQ     ++N        D E+GT KD LLK FG++  V S LMRLHNL
Sbjct  61   KKPSSLHS-DHTQDCERGQINANGGHELADPELGTSKDLLLKAFGDESEV-SELMRLHNL  118

Query  926  CGPP  937
             GPP
Sbjct  119  AGPP  122



>ref|XP_009353698.1| PREDICTED: uncharacterized protein LOC103944942 [Pyrus x bretschneideri]
Length=312

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 81/131 (62%), Gaps = 13/131 (10%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGE-----YTSIGSDIAYL  748
            M SFSGLGIGL  VFGC+L+ LVAELYYLLW ++RI +RE E E       S   +I   
Sbjct  1    MTSFSGLGIGLGVVFGCLLLALVAELYYLLWGKKRITNREIEEEEDDGYIRSHAKEIFQF  60

Query  749  FCCKKSNSVVTRT-----STQALTTSE--LNGYSQ-DLEVGTGKDSLLKGFGEDDGVESX  904
             C KK NS  T +     S Q L   +  +NG S+ DLE+G+ KD LLK  GE++   S 
Sbjct  61   NCFKKPNSFHTSSNGNSNSHQNLREPDVNVNGSSEPDLELGSSKDLLLKLNGEENVEISE  120

Query  905  LMRLHNLCGPP  937
            LMRLHNL GPP
Sbjct  121  LMRLHNLAGPP  131



>ref|XP_004142748.1| PREDICTED: uncharacterized protein LOC101211670 [Cucumis sativus]
 gb|KGN51289.1| hypothetical protein Csa_5G512960 [Cucumis sativus]
Length=323

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 80/125 (64%), Gaps = 8/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS +FGC+ + LVAELYYLLW ++R  DR+ E +Y+S   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSVIFGCLFLALVAELYYLLWWKKRFTDRDVENDYSSPARELFYMFCWKR  60

Query  764  SNSVV-TRTSTQALTTS------ELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHN  922
            S+S+  T  + Q L++S       ++G      + T  D LLK FGE DG+E+  MRL +
Sbjct  61   SSSLSHTALNPQDLSSSVRFSETMIHGAEGQFNMHTNNDFLLKPFGE-DGIETEFMRLQS  119

Query  923  LCGPP  937
            L GPP
Sbjct  120  LSGPP  124



>ref|XP_011042738.1| PREDICTED: uncharacterized protein LOC105138381 [Populus euphratica]
Length=312

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETE---GEYTSIGSDIAYLFC  754
            M SFS LGIGL  VFGC+L+ +VAELYYLLW ++RI +RE E   G  ++  +   +L C
Sbjct  1    MTSFSELGIGLGLVFGCLLLAIVAELYYLLWWKKRISNREVEEDDGYSSNYATGFFHLIC  60

Query  755  CKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGP  934
             KK +   +  +   +   E      D E+G+ KD  +K FGE + VES +MRLHNLCGP
Sbjct  61   WKKPSFFRSNITQDGVRDPEAPCQEPDQELGSSKDLHIKAFGE-ESVESEIMRLHNLCGP  119

Query  935  P  937
            P
Sbjct  120  P  120



>ref|XP_008458900.1| PREDICTED: uncharacterized protein LOC103498168 [Cucumis melo]
Length=323

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 80/125 (64%), Gaps = 8/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS +FGC+ + LVAELYYLLW ++R  DR+ E +Y+S   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSVIFGCLFLALVAELYYLLWWKKRFTDRDVENDYSSPARELFYMFCWKR  60

Query  764  SNSVV-TRTSTQALTTS------ELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHN  922
            S+S+  T  + Q L++S       ++G      + T  D LLK FGE DG+E+  MRL +
Sbjct  61   SSSLSHTALNPQDLSSSVRFSETMIHGAEGQFNMHTNSDFLLKPFGE-DGIETEFMRLQS  119

Query  923  LCGPP  937
            L GPP
Sbjct  120  LSGPP  124



>ref|XP_008448398.1| PREDICTED: uncharacterized protein LOC103490597 [Cucumis melo]
Length=295

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR-IRDRETEGEYTSIGSDIAYLFCCK  760
            M SFSGLGIGLS VFGC+L  LVAELYYLLW ++R I   + E E+T+   +  +L C  
Sbjct  1    MTSFSGLGIGLSLVFGCLLFALVAELYYLLWWKKRSITSSQAEDEFTNYAKEFFHLICWD  60

Query  761  KSNSVVTRTSTQALTTS-------ELNGYSQDLEVGTGKDSLLKGF-GEDDGVESXLMRL  916
                  + +S Q    S       EL     D+E+G  KD LLK   GED GVE  LMRL
Sbjct  61   WKKGSSSSSSLQQPNNSRENQRNLELRNQESDIEIGCSKDLLLKSSGGEDGGVELELMRL  120

Query  917  HNLCGPP  937
            HNL GPP
Sbjct  121  HNLAGPP  127



>ref|XP_006378718.1| hypothetical protein POPTR_0010s21310g [Populus trichocarpa]
 gb|ERP56515.1| hypothetical protein POPTR_0010s21310g [Populus trichocarpa]
Length=316

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 77/122 (63%), Gaps = 5/122 (4%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+L+ LVAELYYLLW +RR  ++E   +Y+S   ++ ++FC +K
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAELYYLLWWKRRFANKEIGDDYSSPARELFFMFCLRK  60

Query  764  SNSVVTRTS--TQALTTSELNGYSQD--LEVGTGKDSLLKGFGEDDGVESXLMRLHNLCG  931
             +S+       +    T  L  + Q+  L + T KD LL+ F  DD VE+ LMRLH+L G
Sbjct  61   PSSLRNNQELCSSVRITDTLVHHDQESQLNINTSKDLLLRPFS-DDNVETELMRLHSLSG  119

Query  932  PP  937
            PP
Sbjct  120  PP  121



>ref|XP_002532293.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30077.1| conserved hypothetical protein [Ricinus communis]
Length=322

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 77/122 (63%), Gaps = 5/122 (4%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VF C+L+ LVAELYYLLW +RRI +RE   +Y+S   ++ Y+FC KK
Sbjct  1    MKSLSSVGLGLSIVFACLLLALVAELYYLLWWKRRITNREIGDDYSSPARELFYMFCLKK  60

Query  764  SNSVVTRTS--TQALTTSELNGYSQD--LEVGTGKDSLLKGFGEDDGVESXLMRLHNLCG  931
             +S+       +    T  L  + +D  L + T KD L K FG DD VE+ LMRL+++ G
Sbjct  61   PSSLRHSQELCSSVRITDTLVHHEEDSELNLNTSKDFLFKPFG-DDPVETELMRLNSISG  119

Query  932  PP  937
            PP
Sbjct  120  PP  121



>ref|XP_011090081.1| PREDICTED: uncharacterized protein LOC105170857 [Sesamum indicum]
Length=274

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 80/124 (65%), Gaps = 7/124 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR----IRDRETEGEYTSIGSDIAYLF  751
            M SFSG+GIGLSFVFGCILMGLVAE+YYLLW ++R         +    +    D + L 
Sbjct  1    MGSFSGVGIGLSFVFGCILMGLVAEVYYLLWWKKRIGISSTGSSSSSSNSEEIEDFSVLL  60

Query  752  CCKKSNSVVTRTSTQALTTSELNG--YSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL  925
            C KK  S  T +S+Q L++  +      QDLE+G+ KD   KGFGE +GVE+ LMR HNL
Sbjct  61   CWKKLTSFHTTSSSQELSSCSVRNPQEQQDLEMGSSKDLGPKGFGE-EGVETELMRTHNL  119

Query  926  CGPP  937
            CGPP
Sbjct  120  CGPP  123



>ref|XP_011027177.1| PREDICTED: uncharacterized protein LOC105127533 [Populus euphratica]
 ref|XP_011027178.1| PREDICTED: uncharacterized protein LOC105127533 [Populus euphratica]
Length=316

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 78/122 (64%), Gaps = 5/122 (4%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+L+ LVAELYYLLW +RR+ ++E   +Y+S   ++ ++FC +K
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAELYYLLWWKRRLANKEIGDDYSSPARELFFMFCLRK  60

Query  764  SNSVVTRTS--TQALTTSELNGYSQD--LEVGTGKDSLLKGFGEDDGVESXLMRLHNLCG  931
             +++       +    T  L  + Q+  L + T KD LL+ F  DD VE+ LMRLH+L G
Sbjct  61   PSTLRNNQELCSSVRITDTLVHHDQESQLNISTSKDLLLRPFS-DDNVETELMRLHSLSG  119

Query  932  PP  937
            PP
Sbjct  120  PP  121



>ref|XP_003633292.1| PREDICTED: uncharacterized protein LOC100249867 [Vitis vinifera]
Length=321

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 80/128 (63%), Gaps = 11/128 (9%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+L+ LVAELYYLLW ++R+   E E +Y+S   ++ Y++C KK
Sbjct  1    MRSLSSVGLGLSIVFGCLLLALVAELYYLLWWKKRLTSTEMEDDYSSPARELLYMYCWKK  60

Query  764  SNSVVTRT-STQALTTS---------ELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMR  913
             +S+ +R  + Q L +S         E +     L +   +D LLK FGE + +E+ LMR
Sbjct  61   PSSLSSRALNPQELCSSDRVTDTHVLEPHQAHHQLHMHGKEDYLLKPFGE-ETMETELMR  119

Query  914  LHNLCGPP  937
            LH+L GPP
Sbjct  120  LHDLSGPP  127



>ref|XP_002283778.1| PREDICTED: uncharacterized protein LOC100253074 [Vitis vinifera]
Length=321

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 11/128 (9%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+L+ LVAELYYLLW ++R+   E E +Y+S   ++ Y++C KK
Sbjct  1    MRSLSSVGLGLSIVFGCLLLALVAELYYLLWWKKRLTSTEMEDDYSSPARELLYMYCWKK  60

Query  764  SNSVVTRT-STQALTTS---------ELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMR  913
             +S+ +R  + Q L +S         E       L +   +D LLK FGE + +E+ LMR
Sbjct  61   PSSLSSRALNPQELCSSDRVTDTHVLEPQQAHHQLHLHGKEDYLLKPFGE-ETMETELMR  119

Query  914  LHNLCGPP  937
            LH+L GPP
Sbjct  120  LHDLSGPP  127



>ref|XP_011657164.1| PREDICTED: uncharacterized protein LOC101220684 [Cucumis sativus]
 gb|KGN47164.1| hypothetical protein Csa_6G191280 [Cucumis sativus]
Length=295

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 75/130 (58%), Gaps = 12/130 (9%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR-IRDRETEGEYTSIGSDIAYLFC--  754
            M SFSGLGIGLS VFGC+L  LVAELYYLLW ++R I     E E+T+   +  +L C  
Sbjct  1    MTSFSGLGIGLSLVFGCLLFALVAELYYLLWWKKRSITSSHVEDEFTNYAKEFFHLICWN  60

Query  755  CKKSNSVV--------TRTSTQALTTSELNGYSQDLEVGTGKDSLLKGF-GEDDGVESXL  907
             KK +S            +S +     EL     D+E+G  KD LLK   GED GVE  L
Sbjct  61   WKKGSSSSSSSSSLQQPNSSRENQRNLELRNQESDIEIGCSKDLLLKSSGGEDGGVELEL  120

Query  908  MRLHNLCGPP  937
            MRLHNL GPP
Sbjct  121  MRLHNLAGPP  130



>gb|EYU36263.1| hypothetical protein MIMGU_mgv1a011694mg [Erythranthe guttata]
Length=273

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 74/118 (63%), Gaps = 9/118 (8%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M SFSGLGIGLSFVFGCILMGLV ELYYLLW +++I    T    +    D ++ FC + 
Sbjct  1    MGSFSGLGIGLSFVFGCILMGLVGELYYLLWWKKKIIANSTNSSSSRENDDFSFHFCWRN  60

Query  764  SNSVVTRTSTQALTTSELNGYSQDLEVG-TGKDSLLKGFG----EDDGVESXLMRLHN  922
             +S     ST  LT S  N   QDLE+G + KDS  KG+     ED GVE+ LMR+HN
Sbjct  61   PSSF---RSTAQLTNSVRNS-QQDLEMGCSDKDSEFKGYNSNCEEDLGVETELMRIHN  114



>ref|XP_002311163.2| hypothetical protein POPTR_0008s05450g [Populus trichocarpa]
 gb|EEE88530.2| hypothetical protein POPTR_0008s05450g [Populus trichocarpa]
Length=316

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 77/122 (63%), Gaps = 5/122 (4%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+L+ LVAELYYLLW ++R  ++E   +Y+S   ++ ++FC +K
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAELYYLLWWKKRFANKEIGDDYSSPARELFFMFCLRK  60

Query  764  SNSVVTRTS--TQALTTSELNGYSQD--LEVGTGKDSLLKGFGEDDGVESXLMRLHNLCG  931
             +S+       +    T  L  + Q+  L + T KD LL+ +  DD VE+ LMRLH+L G
Sbjct  61   PSSLRHNQELCSSVRITDALVQHEQESQLNINTSKDILLRPWS-DDNVETELMRLHSLSG  119

Query  932  PP  937
            PP
Sbjct  120  PP  121



>ref|XP_012089431.1| PREDICTED: uncharacterized protein LOC105647810 [Jatropha curcas]
 gb|KDP44983.1| hypothetical protein JCGZ_01483 [Jatropha curcas]
Length=314

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 75/125 (60%), Gaps = 14/125 (11%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+L+ L+AELYYLLW +RR  +RE   +Y+S   ++ Y+FC KK
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALIAELYYLLWWKRRFTNREIGDDYSSPARELFYMFCLKK  60

Query  764  SNSVVTRTS-------TQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHN  922
             +S+            T AL   EL+           KD LLK FG DD +E+ LMRL++
Sbjct  61   PSSLRNSQELCSSLRITDALVHHELDSQ------LNSKDLLLKPFG-DDPLEAELMRLNS  113

Query  923  LCGPP  937
            L GPP
Sbjct  114  LSGPP  118



>ref|XP_006436013.1| hypothetical protein CICLE_v10032119mg [Citrus clementina]
 ref|XP_006486089.1| PREDICTED: uncharacterized protein LOC102616127 [Citrus sinensis]
 gb|ESR49253.1| hypothetical protein CICLE_v10032119mg [Citrus clementina]
 gb|KDO67646.1| hypothetical protein CISIN_1g041532mg [Citrus sinensis]
Length=323

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 78/128 (61%), Gaps = 10/128 (8%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+L+ L+AELYYLLW ++R   RE E +Y++   +  Y+FC ++
Sbjct  1    MKSLSSVGLGLSVVFGCLLLALIAELYYLLWWKKRFTRREIESDYSNPAREFLYMFCLRR  60

Query  764  SNSVV-TRTSTQALTTSELNGYSQDLEVG-------TGKDSLLKGFGE--DDGVESXLMR  913
             +S+  +  + Q L +S  +   Q+ +         + KD L K FG   +D +E+ LMR
Sbjct  61   PSSLSHSALNPQKLCSSVTDTLVQEPQSQHHLHTNTSNKDFLFKPFGSSGEDSMEAELMR  120

Query  914  LHNLCGPP  937
            LHNL GPP
Sbjct  121  LHNLSGPP  128



>ref|XP_011027862.1| PREDICTED: uncharacterized protein LOC105128025 [Populus euphratica]
Length=316

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 77/122 (63%), Gaps = 5/122 (4%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+L+ LVAELYYLLW ++R  ++E  G+Y+S   ++ ++FC +K
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAELYYLLWWKKRFANKEIGGDYSSPTRELFFMFCLRK  60

Query  764  SNSVVTRTS--TQALTTSELNGYSQD--LEVGTGKDSLLKGFGEDDGVESXLMRLHNLCG  931
             +S+       +    T  L  + Q+  L + T KD LL+ +  D  VE+ LMRLH+L G
Sbjct  61   PSSLRHNQELCSSVRITDALVQHEQESQLNINTSKDILLRPWS-DGNVETELMRLHSLSG  119

Query  932  PP  937
            PP
Sbjct  120  PP  121



>ref|XP_009358360.1| PREDICTED: uncharacterized protein LOC103948985 [Pyrus x bretschneideri]
Length=322

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 81/132 (61%), Gaps = 14/132 (11%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY------TSIGSDIAY  745
            M S SGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E E       ++   +I  
Sbjct  1    MTSLSGLGIGLSVVFGCLLLALVAELYYLLWWKKRITNREIEEEEDDDYISSNQAKEIFQ  60

Query  746  LFCCKKSNSVVTRTSTQALTTSEL-------NGYSQ-DLEVGTGKDSLLKGFGEDDGVES  901
              C KK NS+ T ++  + +   L       NG S+ DLE G+ KD LLK  GE++   S
Sbjct  61   FNCFKKPNSLHTSSNGNSNSHENLREPDVNVNGSSEPDLEQGSRKDLLLKLNGEENVEIS  120

Query  902  XLMRLHNLCGPP  937
             LMRLHNL GPP
Sbjct  121  ELMRLHNLAGPP  132



>ref|XP_008357486.1| PREDICTED: uncharacterized protein LOC103421235 [Malus domestica]
Length=322

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 81/132 (61%), Gaps = 14/132 (11%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY------TSIGSDIAY  745
            M S SGLGIGLS VFGC+L+ LVAELYYLLW ++R+ +RE E E       ++   +I  
Sbjct  1    MTSLSGLGIGLSVVFGCLLLALVAELYYLLWWKKRVTNREIEEEEDDDYISSNHAKEIFQ  60

Query  746  LFCCKKSNSVVTRTSTQALTTSEL-------NGYSQ-DLEVGTGKDSLLKGFGEDDGVES  901
              C KK NS+ T ++  + +   L       NG S+ DLE G+ KD LLK  GE++   S
Sbjct  61   FNCFKKPNSLHTSSNRNSNSHENLREPDVNVNGSSEPDLEQGSRKDLLLKLNGEENVEIS  120

Query  902  XLMRLHNLCGPP  937
             LMRLHNL GPP
Sbjct  121  ELMRLHNLAGPP  132



>ref|XP_008802763.1| PREDICTED: uncharacterized protein LOC103716515 isoform X2 [Phoenix 
dactylifera]
Length=172

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 75/125 (60%), Gaps = 7/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M   S LGIGL  V G + + L AELYYL W ++R  +R+ E  YTS G ++ YLFC KK
Sbjct  1    MGRLSSLGIGLILVSGFLFLALAAELYYLFWWKKRGANRDIEDNYTSPGRELLYLFCWKK  60

Query  764  SNSV-VTRTSTQALTTSELNGYSQD-----LEVGTGKDSLLKGF-GEDDGVESXLMRLHN  922
             +S+  T  + Q ++TS       D     L+  +GKD LL+ F G ++ +E+ LMRLH+
Sbjct  61   PSSLSPTALNPQEISTSANAAVHSDDGQLYLDPNSGKDLLLRPFGGGEESMEAELMRLHS  120

Query  923  LCGPP  937
            L GPP
Sbjct  121  LSGPP  125



>ref|XP_007139239.1| hypothetical protein PHAVU_008G012900g [Phaseolus vulgaris]
 gb|ESW11233.1| hypothetical protein PHAVU_008G012900g [Phaseolus vulgaris]
Length=283

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 13/128 (10%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS +FGC+L+ LVAE+YYLLW ++RI +RE E +Y +   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSIIFGCLLLALVAEVYYLLWWKKRITNREIENDYGNPVKELFYMFCWKR  60

Query  764  SNSVVTRTSTQALTTSELNG----------YSQDLEVGTGKDSLLKGFGEDDGVESXLMR  913
             +S   R +  + T  EL              + +   + KD + K FGE DG+++  MR
Sbjct  61   PSSSSLRQT--SFTPPELCSSMRIGDTLVHNPEQVHSQSAKDFVFKPFGE-DGIDAEYMR  117

Query  914  LHNLCGPP  937
              NL GPP
Sbjct  118  QQNLLGPP  125



>ref|XP_008802762.1| PREDICTED: uncharacterized protein LOC103716515 isoform X1 [Phoenix 
dactylifera]
Length=328

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 75/125 (60%), Gaps = 7/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M   S LGIGL  V G + + L AELYYL W ++R  +R+ E  YTS G ++ YLFC KK
Sbjct  1    MGRLSSLGIGLILVSGFLFLALAAELYYLFWWKKRGANRDIEDNYTSPGRELLYLFCWKK  60

Query  764  SNSV-VTRTSTQALTTSELNGYSQD-----LEVGTGKDSLLKGF-GEDDGVESXLMRLHN  922
             +S+  T  + Q ++TS       D     L+  +GKD LL+ F G ++ +E+ LMRLH+
Sbjct  61   PSSLSPTALNPQEISTSANAAVHSDDGQLYLDPNSGKDLLLRPFGGGEESMEAELMRLHS  120

Query  923  LCGPP  937
            L GPP
Sbjct  121  LSGPP  125



>ref|XP_010922359.1| PREDICTED: uncharacterized protein LOC105045691 [Elaeis guineensis]
Length=328

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 75/125 (60%), Gaps = 7/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M   S L IGLS V G + + L AELYYL W ++R  +R+ E  YTS   ++ YLFC KK
Sbjct  1    MGHLSSLRIGLSLVSGFLFLALAAELYYLFWWKKREPNRDIEANYTSPVRELLYLFCWKK  60

Query  764  SNS-VVTRTSTQALTTS-ELNGYSQD----LEVGTGKDSLLKGF-GEDDGVESXLMRLHN  922
             +S   T  + Q ++TS    G+S D    L   +GKD LL+ F G ++ +E+ LMRLH+
Sbjct  61   PSSQSPTALNPQEISTSANATGHSDDGHLYLHSNSGKDLLLRPFGGGEESMEAELMRLHS  120

Query  923  LCGPP  937
            L GPP
Sbjct  121  LSGPP  125



>ref|XP_009416133.1| PREDICTED: uncharacterized protein LOC103996838 [Musa acuminata 
subsp. malaccensis]
Length=322

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 77/125 (62%), Gaps = 8/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M   S LGIGLS V GC+ + LVAELYYLLW ++R   RE + +  S   ++ YL C +K
Sbjct  1    MRPLSSLGIGLSLVSGCLFLALVAELYYLLWWKKR-SSREVDHDSRSPAGELLYLCCWRK  59

Query  764  SNSV-VTRTSTQALTTS-ELNGYSQDLEV-----GTGKDSLLKGFGEDDGVESXLMRLHN  922
             +S+  T  + + +TTS +   YS + ++      + KD LLK FG +DG+E+ LMRLH 
Sbjct  60   PSSLSSTALNPRDMTTSVDAAAYSDEGQLQLRSDSSSKDLLLKAFGGEDGMEAELMRLHG  119

Query  923  LCGPP  937
            L GPP
Sbjct  120  LAGPP  124



>ref|XP_007220066.1| hypothetical protein PRUPE_ppa025332mg [Prunus persica]
 gb|EMJ21265.1| hypothetical protein PRUPE_ppa025332mg [Prunus persica]
Length=321

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 76/125 (61%), Gaps = 8/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R  +RE E +Y+S   ++ Y FC ++
Sbjct  1    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTNREIENDYSSPQKELFYTFCWRR  60

Query  764  SNSVVTRT-------STQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHN  922
            ++S+           ++  +T + ++  +  L + T  + LLK   E+D +++ LMRL N
Sbjct  61   NSSLCHTARGPRELCASLRMTETLVHDPNSQLHIHTSNNLLLKQL-EEDELDAELMRLQN  119

Query  923  LCGPP  937
              GPP
Sbjct  120  AAGPP  124



>ref|XP_008233609.1| PREDICTED: uncharacterized protein LOC103332636 [Prunus mume]
Length=324

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 76/125 (61%), Gaps = 8/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R  +RE E +Y+S   ++ Y FC ++
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTNREIENDYSSPQKELFYTFCWRR  63

Query  764  SNSVVTRT-------STQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHN  922
            ++S+           ++  +T + ++  +  L + T  + LLK   E+D +++ LMRL N
Sbjct  64   NSSLCHTARGPRELCASLRMTETLVHDPNSQLHMHTSNNLLLKQL-EEDELDAELMRLQN  122

Query  923  LCGPP  937
              GPP
Sbjct  123  AAGPP  127



>ref|XP_004307538.1| PREDICTED: uncharacterized protein LOC101294306 [Fragaria vesca 
subsp. vesca]
Length=332

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 78/130 (60%), Gaps = 13/130 (10%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R+ +R+ E +Y+S   ++ Y+FC ++
Sbjct  1    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRLTNRDIEDDYSSPSKEVFYMFCWRR  60

Query  764  SNSVVTR--TSTQALTTS---------ELNGYSQ-DLEVGTGKDSLLKGFGEDDGVESXL  907
            ++  ++    S Q L +S         E N   Q  +   +  D LLK F E+D +++ L
Sbjct  61   TSKSLSHMAQSPQQLCSSFRITDTLVHEPNTQLQLHMHTASNNDLLLKPF-EEDELDAEL  119

Query  908  MRLHNLCGPP  937
            MRL +  GPP
Sbjct  120  MRLQSAYGPP  129



>ref|XP_006603035.1| PREDICTED: uncharacterized protein LOC102662096 isoform X1 [Glycine 
max]
 ref|XP_006603036.1| PREDICTED: uncharacterized protein LOC102662096 isoform X2 [Glycine 
max]
Length=283

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 75/128 (59%), Gaps = 13/128 (10%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS +FGC+L+ LVAE+YYLLW ++RI +RE E  Y +   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSIIFGCLLLALVAEVYYLLWWKKRITNREIENNYGNPVKELFYMFCWKR  60

Query  764  SNSVVTRTSTQALTTSELNG----------YSQDLEVGTGKDSLLKGFGEDDGVESXLMR  913
             +S   R +  + T  EL              + ++  +GKD + K FGE DG+++  M 
Sbjct  61   PSSSSLRQT--SFTPPELCSSMRIGDTLVHNPEQVQSQSGKDFVFKPFGE-DGMDAEYMS  117

Query  914  LHNLCGPP  937
              +L GPP
Sbjct  118  QQDLLGPP  125



>ref|XP_007009365.1| Pentatricopeptide repeat-containing protein, putative [Theobroma 
cacao]
 gb|EOY18175.1| Pentatricopeptide repeat-containing protein, putative [Theobroma 
cacao]
Length=488

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 79/129 (61%), Gaps = 15/129 (12%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+++ LVAELYYLLW ++R+  R+ E +Y++   +  Y+FC K+
Sbjct  171  MKSLSSVGLGLSIVFGCLVLALVAELYYLLWWKKRLTSRDIENDYSNPAREFFYMFCWKR  230

Query  764  SNSVVTRTSTQALTTSELNGYSQ-------DLEVGTGKDSLLK-GFGEDD---GVESXLM  910
            S+S+    S  AL   E+    +        L + + KD LLK  FG  D   G+E+ L+
Sbjct  231  SSSM----SHTALNPQEIRMTEEQQQSHHHQLHLHSNKDLLLKPNFGHHDDPHGMENELL  286

Query  911  RLHNLCGPP  937
            RLH+L GPP
Sbjct  287  RLHSLSGPP  295



>gb|EYU18959.1| hypothetical protein MIMGU_mgv1a012478mg [Erythranthe guttata]
Length=249

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 74/127 (58%), Gaps = 20/127 (16%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY------TSIGSDIAY  745
            M SFSGL IGLSFVFGCILMGL  ELYYLLW ++++    +          + I    + 
Sbjct  1    MGSFSGLVIGLSFVFGCILMGLFLELYYLLWWKKKMAANNSNSNSNSSRSTSEIEEGFSL  60

Query  746  LFC--CKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKD-SLLKGFGEDDGVESXLMRL  916
             FC   KK NS    +S   L      G  QDLE+G  K+  LLK +GE +G+ES LMR+
Sbjct  61   FFCWNWKKPNS----SSNPQL------GQDQDLEMGPTKELGLLKSYGE-EGIESELMRV  109

Query  917  HNLCGPP  937
            HNL GPP
Sbjct  110  HNLSGPP  116



>ref|XP_010918393.1| PREDICTED: uncharacterized protein LOC105042774 [Elaeis guineensis]
Length=328

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 75/125 (60%), Gaps = 7/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M   S LGIGLS V G + + L AELYYL W ++R  + + E  YT+ G ++ YLFC KK
Sbjct  1    MRRLSSLGIGLSLVSGFLFLALAAELYYLFWWKKRGANGDIEDNYTNPGRELLYLFCWKK  60

Query  764  SNSV-VTRTSTQALTTS-ELNGYSQD----LEVGTGKDSLLKGF-GEDDGVESXLMRLHN  922
             +S+  T  + Q ++TS     +S D    L   +GKD LL  F G ++ +E+ L+RLH+
Sbjct  61   PSSLSSTALNPQEISTSANATDHSDDGHLYLHSNSGKDHLLSPFGGGEESMEAELIRLHS  120

Query  923  LCGPP  937
            L GPP
Sbjct  121  LSGPP  125



>gb|KHN13892.1| hypothetical protein glysoja_016176 [Glycine soja]
Length=283

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 74/128 (58%), Gaps = 13/128 (10%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS +FGC+L+ LVAE+YYL W ++RI +RE E  Y +   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSIIFGCLLLALVAEVYYLPWWKKRITNREIENNYGNPVKELFYMFCWKR  60

Query  764  SNSVVTRTSTQALTTSELNG----------YSQDLEVGTGKDSLLKGFGEDDGVESXLMR  913
             +S   R +  + T  EL              + ++  +GKD + K FGE DG+++  M 
Sbjct  61   PSSSSLRQT--SFTPPELCSSMRIGDTLVHNPEQVQSQSGKDFVFKPFGE-DGMDAEYMS  117

Query  914  LHNLCGPP  937
              +L GPP
Sbjct  118  QQDLLGPP  125



>ref|XP_010067398.1| PREDICTED: uncharacterized protein LOC104454286 [Eucalyptus grandis]
 gb|KCW65522.1| hypothetical protein EUGRSUZ_G02923 [Eucalyptus grandis]
 gb|KCW65523.1| hypothetical protein EUGRSUZ_G02923 [Eucalyptus grandis]
Length=284

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 79/127 (62%), Gaps = 10/127 (8%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGS-DIAYLFCCK  760
            M S SG+G+GLS VFGC+++ L AE YYLL  ++R  +R  E  Y +  + ++ ++FCCK
Sbjct  1    MKSLSGIGLGLSVVFGCLVLALFAEFYYLLCWKKRFTNRTIEEGYNNTPTKELLHIFCCK  60

Query  761  KSNSV-VTRTSTQALTTS------ELNGYSQDL-EVGTGKDSLLKGFGEDDGVESXLMRL  916
            K +S+  T  + Q L +S      +LNG    L +V + KD L+K   E++ +E+ LMRL
Sbjct  61   KPSSLSQTALNPQELPSSGIISDTQLNGSQNQLQQVHSNKDILVKP-CEEESMETELMRL  119

Query  917  HNLCGPP  937
            H L GPP
Sbjct  120  HKLGGPP  126



>ref|XP_006574854.1| PREDICTED: uncharacterized protein LOC100784512 isoform X1 [Glycine 
max]
 gb|KHN27223.1| hypothetical protein glysoja_025507 [Glycine soja]
Length=285

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 76/130 (58%), Gaps = 15/130 (12%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS +FGC+L+ LVAE+YYLLW ++RI +RE E +Y +   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSIIFGCLLLALVAEVYYLLWWKKRITNREIENDYGNPVKELFYMFCWKR  60

Query  764  SNSVVTRTSTQALTTSE----------LNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMR  913
             +S   R +  + T  E          L    + ++  +GK+ + K FGE DG ++  MR
Sbjct  61   PSSSSLRQT--SFTPPEFCSSMRIGDTLVHDPEQVQSQSGKEFVFKPFGE-DGTDAEYMR  117

Query  914  LHN--LCGPP  937
              +  L GPP
Sbjct  118  QQDLLLLGPP  127



>ref|XP_010033140.1| PREDICTED: uncharacterized protein LOC104422503 [Eucalyptus grandis]
 gb|KCW52692.1| hypothetical protein EUGRSUZ_J02060 [Eucalyptus grandis]
Length=322

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 71/132 (54%), Gaps = 14/132 (11%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR------IRDRETEGEYTSIGSDIAY  745
            MA+  GLG+ LS VFGC+ +  +AE+ Y+ W +RR      + D   E +YT    +   
Sbjct  1    MAASCGLGLVLSIVFGCLFLAFLAEVSYVFWWKRRRVASSSVADVPEEEDYTKYAKEFLQ  60

Query  746  LFCCKKSNSVVTRTSTQ-----ALTTSEL--NGYS-QDLEVGTGKDSLLKGFGEDDGVES  901
            L C K+ +S    T+ +     +    +L  NG+   DLE G GKD   K  G+ + VES
Sbjct  61   LICWKRPSSFQHPTNAKNSGANSANAKDLGANGHEMSDLEAGNGKDLQSKSLGDQESVES  120

Query  902  XLMRLHNLCGPP  937
             LMRLHNL GPP
Sbjct  121  ELMRLHNLHGPP  132



>ref|XP_008776689.1| PREDICTED: uncharacterized protein LOC103696750 [Phoenix dactylifera]
Length=320

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 74/125 (59%), Gaps = 7/125 (6%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M   S LGIGLS V G + + L AELYYL W ++R  + + E  YT+ G ++  LFC KK
Sbjct  1    MRRLSSLGIGLSLVSGFLFLALAAELYYLFWWKKRGANGDIEDNYTNPGRELLCLFCWKK  60

Query  764  SNSV-VTRTSTQALTTS-ELNGYSQD----LEVGTGKDSLLKGF-GEDDGVESXLMRLHN  922
             +S+  T  + Q ++TS     +S D    L   +GKD LL  F G ++ +E+ LMRLH+
Sbjct  61   PSSLSSTALNPQEISTSANATDHSDDSQLYLHSNSGKDLLLNPFGGGEESMEAELMRLHS  120

Query  923  LCGPP  937
            L GPP
Sbjct  121  LSGPP  125



>ref|XP_006846119.2| PREDICTED: uncharacterized protein LOC18436028 [Amborella trichopoda]
Length=388

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 11/128 (9%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRE-TEGEYTSIGSDIAYLFCCK  760
            M S SGLGIGLS VFG +L+ L AELYY+LW ++R   RE  E EY+S   ++ YL C K
Sbjct  4    MRSLSGLGIGLSLVFGFLLLALFAELYYVLWWKKRENHRELDEEEYSSSAREMLYLLCWK  63

Query  761  KSNSVVTRTSTQALTTSELN--GYSQDLEV-------GTGKDSLLKGFGEDDGVESXLMR  913
            K +S+ + T        E    G   D ++       G  KD L+K +GE DG+E+ +MR
Sbjct  64   KPHSLSSDTHDTYTVMRENRSLGPEPDPQIQLQSAMAGLSKDVLVKPYGE-DGIETEIMR  122

Query  914  LHNLCGPP  937
            +HNL GPP
Sbjct  123  IHNLSGPP  130



>gb|ERN07794.1| hypothetical protein AMTR_s00012p00143310 [Amborella trichopoda]
Length=385

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 11/128 (9%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRE-TEGEYTSIGSDIAYLFCCK  760
            M S SGLGIGLS VFG +L+ L AELYY+LW ++R   RE  E EY+S   ++ YL C K
Sbjct  1    MRSLSGLGIGLSLVFGFLLLALFAELYYVLWWKKRENHRELDEEEYSSSAREMLYLLCWK  60

Query  761  KSNSVVTRTSTQALTTSELN--GYSQDLEV-------GTGKDSLLKGFGEDDGVESXLMR  913
            K +S+ + T        E    G   D ++       G  KD L+K +GE DG+E+ +MR
Sbjct  61   KPHSLSSDTHDTYTVMRENRSLGPEPDPQIQLQSAMAGLSKDVLVKPYGE-DGIETEIMR  119

Query  914  LHNLCGPP  937
            +HNL GPP
Sbjct  120  IHNLSGPP  127



>ref|XP_004487018.1| PREDICTED: uncharacterized protein LOC101511700 [Cicer arietinum]
Length=308

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (59%), Gaps = 3/114 (3%)
 Frame = +2

Query  602  LGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKKSN-SVV  778
            L I LS VFGC+++G+ A+LYY LW ++R  + + E +  +    + Y  C K +  S+ 
Sbjct  6    LCIILSLVFGCLILGVFAQLYYFLWWKKRRTNLDIEIDEGNYAKKVFYFGCWKNTQCSLH  65

Query  779  TRTSTQALTTSELNGYSQDLEVG-TGKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
              T+   +   E   + QDLE+G  GKD LLK  G D+ +E  LMRLHNL GPP
Sbjct  66   NHTNPSVIRDQETTNHEQDLELGCDGKDMLLKSSG-DESLELELMRLHNLPGPP  118



>ref|XP_004492124.1| PREDICTED: uncharacterized protein LOC101499955 [Cicer arietinum]
Length=278

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +G+GLS VFGC+L+ LVAE+YYLLW ++RI  RE E +  +   +I ++FC K 
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAEVYYLLWWKKRIIKREIENDNVNPMKEIFHMFCWKT  60

Query  764  SNSVVTRTS-TQALTTSELNGYSQDLEV---------GTGKDSLLKGFGEDDGVESX---  904
            S++  T  +   ++T  E   +  D E+            KD L K FG+ DG+E     
Sbjct  61   SSTSFTPPNLCSSMTICE--NFVHDPELQQQQQQSHSQNTKDFLFKTFGDQDGMEEADYM  118

Query  905  LMRLHN  922
            +MR  N
Sbjct  119  MMRQQN  124



>gb|AES78094.2| transmembrane protein, putative [Medicago truncatula]
Length=293

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 74/129 (57%), Gaps = 14/129 (11%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGS--DIAYLFCC  757
            M S S +G+GLS VFGC+L+ LVAE+YYLLW +++I  RE E +Y +     ++ Y+FC 
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAEVYYLLWWKKKIIKREIENDYGNGNPLKELFYMFCW  60

Query  758  KKSNSVVTRTSTQALTTSEL-------NGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRL  916
            K+ ++ + +T     T  EL       + +  D +V T K+ L K +GED      +M+ 
Sbjct  61   KRPSTSLRQT---GFTPPELCSSMRINDNFVHDPQVQTSKEFLFKPYGEDVIDADYMMQH  117

Query  917  HN--LCGPP  937
            H+  L G P
Sbjct  118  HHDGLLGHP  126



>gb|AFK46332.1| unknown [Lotus japonicus]
Length=245

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 66/117 (56%), Gaps = 5/117 (4%)
 Frame = +2

Query  590  SFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKKSN  769
            S SGL I LS  FGC L+ L AEL YLLW ++R    ETE E  S  +       C K+ 
Sbjct  2    SLSGLVIALSVAFGCFLLALAAELCYLLWWKKRRTHTETEEEDHSNDAKGLLNGVCWKAP  61

Query  770  SVVTRTSTQALTTSELNGYSQDLEVGTGKDSL-LKGFGEDDGVESXLMRLHNLCGPP  937
            S    T++  + +SE    S + ++  GKD   LK FGE +GVE  LMRLHNL GPP
Sbjct  62   ST---TNSVTVRSSEPENKSHEPDLELGKDVAGLKNFGE-EGVECELMRLHNLAGPP  114



>ref|XP_010108745.1| hypothetical protein L484_011403 [Morus notabilis]
 gb|EXC20159.1| hypothetical protein L484_011403 [Morus notabilis]
Length=332

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 67/129 (52%), Gaps = 15/129 (12%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGE---YTSIGSDIAYLFC  754
            M S S +GIGLS VF C+ + L+AELYYL W ++R+    +E E   Y S   ++ Y+FC
Sbjct  1    MKSLSSVGIGLSVVFSCLFLALIAELYYLFWWKKRLITNRSEIENHDYISPAKELFYMFC  60

Query  755  CKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGED--------DGVESXLM  910
             +K ++     S  AL   E+   S  + +    ++LL+   +D        DG E+  M
Sbjct  61   WRKHSAF----SHSALNPQEICSSSTRIPINDNNNTLLQEPNDDFLFKPFEEDGPETQFM  116

Query  911  RLHNLCGPP  937
             L N  GPP
Sbjct  117  TLQNCSGPP  125



>emb|CDP00076.1| unnamed protein product [Coffea canephora]
Length=327

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 70/127 (55%), Gaps = 11/127 (9%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRET-EGEYTSIGS---DIAYLF  751
            M S S +G+GLS VFGC+ + L AELYYLLW ++RI +R   E  Y+S G+   +  Y  
Sbjct  1    MKSLSSVGLGLSLVFGCLFLALAAELYYLLWWKKRIPNRHNIEDGYSSTGTVAKESFYKL  60

Query  752  CCKKSNSVVT---RTSTQALTTSE--LNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRL  916
            C KK +S+ +   + + Q + +S   L    Q    G     L     E+D VE+ L+R+
Sbjct  61   CWKKPSSLRSAALKLNPQHVCSSHETLVHEPQAQHHGNSNKDLWP--YEEDSVEAELVRM  118

Query  917  HNLCGPP  937
            HN  GPP
Sbjct  119  HNFSGPP  125



>ref|XP_009357714.1| PREDICTED: uncharacterized protein LOC103948407 [Pyrus x bretschneideri]
Length=280

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 71/123 (58%), Gaps = 11/123 (9%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY-TSIGSDIAYLFCCK  760
            M S S +G+GLS VFGC+ + L+AELYYLLW +++   RE +  Y +S   +I Y+FC +
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKKFTSREIDSGYSSSPQKEIFYMFCWR  63

Query  761  KSNSVVTRTST---QALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL-C  928
            +S    +R  T    +L  SE   +       +  + +LK F EDD +++ LMRL N   
Sbjct  64   RSTCTSSRNPTGICASLRMSETLVHEP-----SSNNLVLKSFEEDD-LDAELMRLQNAGG  117

Query  929  GPP  937
            GPP
Sbjct  118  GPP  120



>ref|XP_008371593.1| PREDICTED: uncharacterized protein LOC103434986 [Malus domestica]
 ref|XP_008343565.1| PREDICTED: uncharacterized protein LOC103406346 [Malus domestica]
Length=280

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 71/123 (58%), Gaps = 11/123 (9%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY-TSIGSDIAYLFCCK  760
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R   RE +  Y +S   +I Y+FC +
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTSREIDSGYSSSPQKEIFYMFCWR  63

Query  761  KSNSVVTRTST---QALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL-C  928
            +S    +R  T    +L  SE   +       +  + +LK F E+D +++ LMRL N   
Sbjct  64   RSTCTPSRNPTGICASLRMSETLVHE-----PSSNNLVLKSFEEED-LDAELMRLQNAGG  117

Query  929  GPP  937
            GPP
Sbjct  118  GPP  120



>ref|XP_008343543.1| PREDICTED: uncharacterized protein LOC103406324 [Malus domestica]
Length=273

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 69/120 (58%), Gaps = 4/120 (3%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY-TSIGSDIAYLFCCK  760
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R  +RE +  Y +S   +I Y+FC +
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTNREIDNGYSSSPQKEIFYMFCWR  63

Query  761  KSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL-CGPP  937
            +S    ++  T    +  L      +      ++L++   E+D +++ LMRL N   GPP
Sbjct  64   RSTCTSSQNPTDICAS--LRMSETLVHEPCNSNNLVRKSYEEDDLDAELMRLQNAGGGPP  121



>ref|XP_008370730.1| PREDICTED: uncharacterized protein LOC103434193 [Malus domestica]
Length=273

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 72/122 (59%), Gaps = 8/122 (7%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY-TSIGSDIAYLFCCK  760
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R  +RE +  Y +S   +I Y+FC +
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTNREIDNGYSSSPQKEIFYMFCWR  63

Query  761  KSNSVVTRTSTQALTT--SELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNL-CG  931
            +S    T TS+Q  T   + L      +      ++L++   E+D +++ LMRL N   G
Sbjct  64   RS----TCTSSQNPTDICASLRMSETLVHEPCNSNNLVRKSYEEDDLDAELMRLQNAGGG  119

Query  932  PP  937
            PP
Sbjct  120  PP  121



>ref|XP_009388620.1| PREDICTED: uncharacterized protein LOC103975390 [Musa acuminata 
subsp. malaccensis]
Length=267

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 63/122 (52%), Gaps = 18/122 (15%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M     LGIGLS V GC+ + +VA+LYY  W ++R  D +              LFC KK
Sbjct  1    MRPLGCLGIGLSLVSGCLFLAVVAQLYYFFWWKKRKIDGD--------------LFCWKK  46

Query  764  SN-SVVTRTSTQALTTSELNGYSQD---LEVGTGKDSLLKGFGEDDGVESXLMRLHNLCG  931
            S+ S     + Q +  S +     D   L+  + +D L K FGE+D VE+ LMRLH L G
Sbjct  47   SSFSSSADLNPQEICVSVIGAIPSDEEQLDSNSTRDLLWKPFGEEDTVEAELMRLHRLAG  106

Query  932  PP  937
            PP
Sbjct  107  PP  108



>ref|XP_010669892.1| PREDICTED: uncharacterized protein LOC104887013 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTS--IGSDIAYLFCC  757
            M S S +G+GLS VF C+L+ L+AE+YYLLW +RRI  RE + +Y +     D  Y+FCC
Sbjct  3    MKSLSRVGLGLSVVFTCLLLALIAEIYYLLWWKRRIFKREIKDDYNTRNTSKDYFYMFCC  62

Query  758  K-KSNSVVTRTSTQALTTSELNGYSQDLEVGT--GKDSLLKGFGE  883
            K +SN+     ST            QD    +   KD ++K F E
Sbjct  63   KTQSNASALNISTVIPNAQIHQSSDQDFHFHSQDNKDYMVKPFEE  107



>ref|XP_006345955.1| PREDICTED: uncharacterized protein LOC102580380 [Solanum tuberosum]
Length=300

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 72/129 (56%), Gaps = 15/129 (12%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY--TSIGSDIAYLFCC  757
            M S S +G+ LS VFGC+L+ L+AELYYLLW + RI     E  Y  +S   +  Y+FC 
Sbjct  1    MKSLSSVGLALSVVFGCLLLALIAELYYLLWWKNRILKTNLEDGYSNSSKAREFCYMFCG  60

Query  758  KKSNSVVTRTS---TQALTTS--ELNGYSQDLEVGTGKDS----LLKGFGEDDGVESXLM  910
            K S + +T T+   +Q + +S  +L      L++G+  DS      K FG DD +++  M
Sbjct  61   KPSTTSLTPTNALKSQEICSSDTQLVHEPTQLQLGSNMDSSSDFWFKPFG-DDTMDNEFM  119

Query  911  RLHNLCGPP  937
                LCGPP
Sbjct  120  A---LCGPP  125



>ref|XP_009625921.1| PREDICTED: uncharacterized protein LOC104116711 [Nicotiana tomentosiformis]
Length=302

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 65/137 (47%), Gaps = 23/137 (17%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAY-LFCCK  760
            M S S +G+ LS VFGC+L+ L+AELYYLLW + RI     E  Y+S  +   + +FC K
Sbjct  1    MKSLSSVGLALSLVFGCLLLALIAELYYLLWWKNRIVKTSLEDGYSSNKAKEFFCMFCVK  60

Query  761  KSNS------------------VVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGED  886
             S S                  +V   + Q  +  E N   +D  V    D   K FG D
Sbjct  61   PSTSLNSNIALKSQEICANDTQLVHEPTIQVQSNVESNSQWRDQPVEEATDFWFKPFG-D  119

Query  887  DGVESXLMRLHNLCGPP  937
            D VE+  +    LCGPP
Sbjct  120  DNVENEFI---GLCGPP  133



>ref|XP_009384831.1| PREDICTED: uncharacterized protein LOC103972270 [Musa acuminata 
subsp. malaccensis]
Length=293

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 62/120 (52%), Gaps = 8/120 (7%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTS--IGSDIAYLFCC  757
            M S SGLGIG+S V GC+ + LVAEL YL W  R+I D + E    +      + +LFC 
Sbjct  1    MRSLSGLGIGVSVVSGCLFLALVAELCYLFWW-RKISDGDMEDRCRACLPAKGLVHLFCW  59

Query  758  KKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
            KK +S+      +   TS       D     GKD LL     +D VE+ LMR H L GPP
Sbjct  60   KKPHSLSFAAPDRVDVTS-----CSDEGQPEGKDLLLNPLRREDTVEAELMRFHGLPGPP  114



>gb|KEH39417.1| transmembrane protein, putative [Medicago truncatula]
Length=272

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 4/116 (3%)
 Frame = +2

Query  599  GLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKKSNSVV  778
             L I LS VFG I++   A ++Y LW ++R    + E E ++    + Y  C KK+   +
Sbjct  5    SLCITLSLVFGFIVLMAFAHIFYFLWWKKRRTHIDIEMEQSNYAKGVFYWGCWKKTPCSL  64

Query  779  TRTSTQALTTSELNGYSQ--DLEVGT-GKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
              T+T      E  G +Q  DLE+G  GKD LLK  GE + +E  LMRLHNL GPP
Sbjct  65   HATNTSESVIREKEGTNQEHDLELGVDGKDLLLKSNGE-ESLEVELMRLHNLPGPP  119



>ref|XP_009381069.1| PREDICTED: uncharacterized protein LOC103969300 [Musa acuminata 
subsp. malaccensis]
Length=295

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 17/128 (13%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M     LG+GLS + GCI + LVAE YY  W ++R   R+ E  Y+S   ++  LFC KK
Sbjct  1    MKPLGCLGVGLSLISGCIFLALVAEFYYFFWWKKRGSSRDVEENYSSPVKELPDLFCWKK  60

Query  764  SNSVVTRTSTQALTTSEL----NGYSQDLEVG------TGKDSLLKGFGEDDGVESXLMR  913
              S+    S  AL   E+    NG +   E        +G D +LK  G +D V++ LM 
Sbjct  61   PTSL----SPTALKPQEICISVNGATHSEEEQPHLRSISGNDLVLKPLGGEDTVDAELM-  115

Query  914  LHNLCGPP  937
               L GPP
Sbjct  116  --CLAGPP  121



>ref|XP_004239786.1| PREDICTED: uncharacterized protein LOC101263027 [Solanum lycopersicum]
Length=301

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 70/130 (54%), Gaps = 16/130 (12%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY--TSIGSDIAYLFCC  757
            M S S +G+ LS VFGC+L+ L+AELYYLLW + RI     E  Y  +S   +  ++FC 
Sbjct  1    MKSLSSVGLALSVVFGCLLLALIAELYYLLWWKNRILKTNLEDGYSNSSKAREFCFMFCG  60

Query  758  KKSNSVVTRTS----TQALTTS--ELNGYSQDLEVGTGKDS----LLKGFGEDDGVESXL  907
            K S + +T  S    +Q + +S  +L      L++G+  DS      K FG DD ++   
Sbjct  61   KPSTTSLTPPSNALKSQEICSSDTQLVHEPTQLQLGSNVDSSSDFWFKPFG-DDTMDDEF  119

Query  908  MRLHNLCGPP  937
            M    LCGPP
Sbjct  120  M---GLCGPP  126



>ref|XP_011091461.1| PREDICTED: uncharacterized protein LOC105171902 [Sesamum indicum]
Length=243

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 60/114 (53%), Gaps = 19/114 (17%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRE-----------TEGEYTSIG  730
            M S SG+GIGLS VFGC+L+ LVAELYYLLW ++R+  ++           T  +  +  
Sbjct  1    MKSLSGVGIGLSLVFGCLLLALVAELYYLLWWKKRVMSKKRSSSSSSSNQVTTHQIPAET  60

Query  731  SDIAYLF-CCKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDD  889
                Y+F CC+K  S    ++ Q L +S      Q     + KD  LK FG+ +
Sbjct  61   PQFCYMFWCCRKPTS----STPQELCSSPTTLVHQP---QSNKDLWLKPFGDSN  107



>gb|EPS57174.1| hypothetical protein M569_17647 [Genlisea aurea]
Length=221

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 58/119 (49%), Gaps = 13/119 (11%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR-IRDRETEGEYTSIGSDIAYLFCCK  760
            M SFSGLGI LSFVFG IL+G+V EL YLLW ++R +    T      I   +       
Sbjct  1    MRSFSGLGIVLSFVFGLILIGVVGELLYLLWWKKRCVHPNTTTAASGEISGKVRIFGSFL  60

Query  761  KSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
            ++N    R +              DLE G  K    +  G D+ +E  L R+HNL GPP
Sbjct  61   RNNPTSERRNP------------DDLETGGEKKPAGRVPGGDENIEIELRRVHNLGGPP  107



>ref|XP_010685790.1| PREDICTED: uncharacterized protein LOC104900135 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010685791.1| PREDICTED: uncharacterized protein LOC104900135 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=303

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 68/122 (56%), Gaps = 12/122 (10%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRR-RI---RDRETEGEYTSIGSDIAYLF  751
            M   SGLGI LS VFGC+L+ LVAELYYLLW ++ RI        + +Y++   ++ YLF
Sbjct  1    MTILSGLGIVLSLVFGCLLLALVAELYYLLWWKKQRIIGNTSNRIDQDYSTHAKEMFYLF  60

Query  752  CCKKSNSVVTRTSTQALTTSEL---NGYSQDLEVGTG----KDSLLKGFGEDDGVESXLM  910
            C  K  +++   +     +S     N    D +V  G    KD LLK  GE +GV+S +M
Sbjct  61   CWDKPTTIINNNNNNNTNSSNTVVGNPVQNDPDVEMGLETRKDLLLKALGE-EGVDSDIM  119

Query  911  RL  916
            RL
Sbjct  120  RL  121



>ref|XP_010520280.1| PREDICTED: uncharacterized protein LOC104799446 [Tarenaya hassleriana]
Length=295

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 62/126 (49%), Gaps = 18/126 (14%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIRDR---------ETEGEYTSIGS  733
            M + S LGIGLS VFGC+L+ LVAE+YYL  W + +   R         + E        
Sbjct  1    MKTVSELGIGLSLVFGCLLLALVAEVYYLFRWKKNKKSKRIMSQESEEEKEEEHNNGYAK  60

Query  734  DIAYLFCCKKSNSVVTRTSTQALTTSELNG---YSQDLEVGTGKDSLLKGFGEDDGVESX  904
            D+  LFC KK  S+         T    +G    +QDLE+G     L+K  G D G E+ 
Sbjct  61   DLIQLFCFKKPQSLHPNNGGGGETVGNPDGDFSETQDLELG-----LMKHLGGDAGFEAE  115

Query  905  LMRLHN  922
             M+LHN
Sbjct  116  FMKLHN  121



>gb|KJB73843.1| hypothetical protein B456_011G256800 [Gossypium raimondii]
Length=201

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRD-RETEGEYTSIGSDIAYLFCCK  760
            M S S +G+GLS VF C+ + L+ ELYYLLW ++R+   R+ E +Y +  S++ Y+FC K
Sbjct  1    MKSLSSVGLGLSIVFCCLFLALIIELYYLLWWKKRLTSTRDIENDYNNPASELFYMFCWK  60

Query  761  KS  766
            K+
Sbjct  61   KT  62



>gb|KJB73844.1| hypothetical protein B456_011G256800 [Gossypium raimondii]
Length=259

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRD-RETEGEYTSIGSDIAYLFCCK  760
            M S S +G+GLS VF C+ + L+ ELYYLLW ++R+   R+ E +Y +  S++ Y+FC K
Sbjct  1    MKSLSSVGLGLSIVFCCLFLALIIELYYLLWWKKRLTSTRDIENDYNNPASELFYMFCWK  60

Query  761  KS  766
            K+
Sbjct  61   KT  62



>ref|XP_009769532.1| PREDICTED: uncharacterized protein LOC104220372 [Nicotiana sylvestris]
Length=296

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 66/139 (47%), Gaps = 27/139 (19%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAY-LFCCK  760
            M S S +G+ LS VFGC+L+ L+AELYYLLW + RI     E  Y+S  +   + +FC K
Sbjct  1    MKSLSSVGLVLSVVFGCLLLALIAELYYLLWWKNRIVKTSLEDGYSSNKAKEFFCMFCIK  60

Query  761  KSNSV-----------------VTRTSTQALTTSELNGYS---QDLEVGTGKDSLLKGFG  880
             S S+                 V   + Q  +  E N      Q +E  T  D   K FG
Sbjct  61   PSTSLNSNIALKSQEICANDTQVHEPTIQVQSNVESNSTQWRGQPVEEAT--DFWFKPFG  118

Query  881  EDDGVESXLMRLHNLCGPP  937
             DD +E+  +    LCGPP
Sbjct  119  -DDNMENEFI---GLCGPP  133



>ref|XP_010535505.1| PREDICTED: uncharacterized protein LOC104810787 [Tarenaya hassleriana]
Length=299

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 62/125 (50%), Gaps = 17/125 (14%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIRDR---------ETEGEYTSIGS  733
            M +  GL IGLS VFGC+L+ LVAE+YYLL W + +   R         + E        
Sbjct  1    MKTVGGLAIGLSLVFGCLLLALVAEVYYLLRWNKNKKSKRVISQESEEEKEEEHNNGYAK  60

Query  734  DIAYLFCCKKSNSVVTRTSTQALTTSELNGY--SQDLEVGTGKDSLLKGFGEDDGVESXL  907
            D+  LFC KK  S+        +  +    +  ++DLE+G     L+K    D G E+ L
Sbjct  61   DLIQLFCFKKPQSLQPNNGGGEIARNPDGDFDETRDLELG-----LMKHLAGDAGFEAEL  115

Query  908  MRLHN  922
            M+LHN
Sbjct  116  MKLHN  120



>ref|XP_010106447.1| hypothetical protein L484_025204 [Morus notabilis]
 gb|EXC10623.1| hypothetical protein L484_025204 [Morus notabilis]
Length=307

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 8/105 (8%)
 Frame = +2

Query  644  GLVAELYYLL-WVRRRIRD--RETEGEYTSIGSDIAYLFCCKKSNSVVTRTSTQALTTSE  814
             LVAELYYLL W ++RI D     E EY +   ++ + F C K N+   + +    +  +
Sbjct  21   ALVAELYYLLWWKKKRITDGSEIEEDEYGNFAKEL-FHFICWKRNASNDKDNKNDTSQRK  79

Query  815  LNGYSQDLEVG-TGKDS-LLKGFGED--DGVESXLMRLHNLCGPP  937
             +   +D E+G +GKD  LLK    D  +GVES LMRLHN+ GPP
Sbjct  80   RDPDEEDPELGCSGKDHVLLKPINGDHQEGVESELMRLHNMAGPP  124



>ref|XP_006280849.1| hypothetical protein CARUB_v10026835mg [Capsella rubella]
 gb|EOA13747.1| hypothetical protein CARUB_v10026835mg [Capsella rubella]
Length=307

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 65/122 (53%), Gaps = 14/122 (11%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR-------DRETEGEYTSIGSDI  739
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R       + + E ++     ++
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEVYYLLRWKKHKKRVISQESEEEKEEEQHNGYAKEL  60

Query  740  AYLFCCKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGF-GEDDGVESXLMRL  916
              LFC KK  S+      +    S     + DLE+G     L+K   G D G E+ LM+L
Sbjct  61   IQLFCFKKPQSLQHSNGEREGEISRNQDGNPDLELG-----LMKHLNGGDLGFEAELMKL  115

Query  917  HN  922
            HN
Sbjct  116  HN  117



>gb|KFK27464.1| hypothetical protein AALP_AA8G386500 [Arabis alpina]
Length=282

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 66/123 (54%), Gaps = 15/123 (12%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR------DRETEGEYTSIG--SD  736
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R      + E E E   IG   +
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEIYYLLRWKKHKKRVISQESEEEREEEQQQIGYAKE  60

Query  737  IAYLFCCKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGF-GEDDGVESXLMR  913
            +  LFC KK  S+      +    S     + DLE+G     L+K   G D G E+ LM+
Sbjct  61   LIQLFCFKKPQSLQANNGGREGEISRNQDVNPDLELG-----LMKHLNGGDLGFEAELMK  115

Query  914  LHN  922
            LHN
Sbjct  116  LHN  118



>ref|XP_006400971.1| hypothetical protein EUTSA_v10014249mg [Eutrema salsugineum]
 gb|ESQ42424.1| hypothetical protein EUTSA_v10014249mg [Eutrema salsugineum]
Length=294

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 65/122 (53%), Gaps = 14/122 (11%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR-----DRETEGEYTSIG--SDI  739
            M + SGLGIGLS VFG +L+ L AE+YYLL W + + R       E + E   IG   ++
Sbjct  1    MKTISGLGIGLSLVFGFLLLALAAEVYYLLRWKKHKKRVISQESEEEKEEEEQIGYAKEL  60

Query  740  AYLFCCKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDD-GVESXLMRL  916
              LFC KK  S+      +    S     +QDLE+G     L+K  G  D G E+ LM+L
Sbjct  61   IQLFCFKKPQSLQANNGGREGEISMNQDGTQDLELG-----LMKHLGGGDLGFEAELMKL  115

Query  917  HN  922
            HN
Sbjct  116  HN  117



>ref|XP_007150313.1| hypothetical protein PHAVU_005G143000g [Phaseolus vulgaris]
 gb|ESW22307.1| hypothetical protein PHAVU_005G143000g [Phaseolus vulgaris]
Length=304

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 64/116 (55%), Gaps = 5/116 (4%)
 Frame = +2

Query  590  SFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKKSN  769
            SF GL + LS VFGC+L+ L A+LYY LW ++R    +   ++ +    + Y  C K   
Sbjct  2    SFGGLSVALSLVFGCLLLALCAQLYYFLWWKKRRAQMDIGMDHGNYAKGVFYWGCWKTPC  61

Query  770  SVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
            S+    +   +   E   +  ++E+    D L K FGE +GVES LMRLHNL GPP
Sbjct  62   SLHGANAGGVVRDIESTIHEPEMEL----DLLHKSFGE-EGVESELMRLHNLAGPP  112



>ref|XP_003542025.1| PREDICTED: uncharacterized protein LOC100787251 [Glycine max]
 gb|KHN30181.1| hypothetical protein glysoja_010559 [Glycine soja]
Length=311

 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 66/125 (53%), Gaps = 17/125 (14%)
 Frame = +2

Query  590  SFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKKSN  769
            SF GL I LS VFGC+L+ L A+LYY LW ++    R T+ +       + Y  C K + 
Sbjct  2    SFGGLSIALSLVFGCLLLALCAQLYYFLWWKK----RRTQMDIEMDAKGVFYWGCWKATP  57

Query  770  SVVTR---------TSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMRLHN  922
              +            +++ + ++  + +  D+E+    D L K FGE+  VES LMRLHN
Sbjct  58   CAMMHGGNNTGRGGVNSRDIESTTRSHHEPDMEL----DLLHKSFGEESTVESELMRLHN  113

Query  923  LCGPP  937
            L GPP
Sbjct  114  LAGPP  118



>gb|KHN33394.1| hypothetical protein glysoja_005436 [Glycine soja]
Length=300

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 64/123 (52%), Gaps = 17/123 (14%)
 Frame = +2

Query  590  SFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKKSN  769
            SF GL I LS VFGC+L+ L A+LYY LW ++R    + E     + +  A+ + C K  
Sbjct  2    SFGGLSIALSLVFGCLLLALCAQLYYFLWWKKRRTQMDIE-----MDAKGAFYWGCWK--  54

Query  770  SVVTRTSTQALTTSELNGYSQDLEVGTGK-------DSLLKGFGEDDGVESXLMRLHNLC  928
               T  +      +   G ++D+E  T         D L K FGE+  VES LMRLHNL 
Sbjct  55   ---TPCAMHVANNTGRGGVNRDIERTTTSREPEMELDLLHKPFGEEGTVESELMRLHNLA  111

Query  929  GPP  937
            GPP
Sbjct  112  GPP  114



>ref|XP_006597277.1| PREDICTED: uncharacterized protein LOC102670362 [Glycine max]
Length=300

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 64/123 (52%), Gaps = 17/123 (14%)
 Frame = +2

Query  590  SFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKKSN  769
            SF GL I LS VFGC+L+ L A+LYY LW ++R    + E     + +  A+ + C K  
Sbjct  2    SFGGLSIALSLVFGCLLLALCAQLYYFLWWKKRRTQMDIE-----MDAKGAFYWGCWK--  54

Query  770  SVVTRTSTQALTTSELNGYSQDLEVGTGK-------DSLLKGFGEDDGVESXLMRLHNLC  928
               T  +      +   G ++D+E  T         D L K FGE+  VES LMRLHNL 
Sbjct  55   ---TPCAMHVANNTGRGGVNRDIERTTTSREPEMELDLLHKPFGEEGTVESELMRLHNLA  111

Query  929  GPP  937
            GPP
Sbjct  112  GPP  114



>ref|XP_010454903.1| PREDICTED: uncharacterized protein LOC104736584 [Camelina sativa]
Length=302

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 17/125 (14%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR---------DRETEGEYTSIGS  733
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R           E + +      
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEVYYLLRWKKHKKRVTSQESEEEKEEEQQQQNGYAK  60

Query  734  DIAYLFCCKKSNSVVTRT-STQALTTSELNGYSQDLEVGTGKDSLLKGF-GEDDGVESXL  907
            ++  LFC KK   +       +    S     +QDLE+G     L+K   G D G E+ L
Sbjct  61   ELIQLFCFKKPQPLQQNNGGREGNEISRDQDGNQDLELG-----LMKHLNGGDLGFEAEL  115

Query  908  MRLHN  922
            M+LHN
Sbjct  116  MKLHN  120



>ref|XP_010483553.1| PREDICTED: uncharacterized protein LOC104762045 isoform X1 [Camelina 
sativa]
 ref|XP_010483554.1| PREDICTED: uncharacterized protein LOC104762045 isoform X2 [Camelina 
sativa]
Length=307

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 64/126 (51%), Gaps = 18/126 (14%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR---------DRETEGEYTSIGS  733
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R           E + +      
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEVYYLLRWKKHKKRVISQESEEEKEEEQQQQNGYAK  60

Query  734  DIAYLFCCKKSNSVVTRTS--TQALTTSELNGYSQDLEVGTGKDSLLKGF-GEDDGVESX  904
            ++  LFC KK   +    +   +    S     +QDLE+G     L+K   G D G E+ 
Sbjct  61   ELIQLFCFKKPQPLQHSNNGGREGSEISRDQDGNQDLELG-----LMKHLNGGDLGFEAE  115

Query  905  LMRLHN  922
            LM+LHN
Sbjct  116  LMKLHN  121



>ref|XP_010443687.1| PREDICTED: uncharacterized protein LOC104726517 [Camelina sativa]
Length=306

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 63/126 (50%), Gaps = 18/126 (14%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR---------DRETEGEYTSIGS  733
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R           E E +      
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEVYYLLRWKKHKKRVISQESEEEKEEEEQQQNGYAK  60

Query  734  DIAYLFCCKKSNSVVTRTS--TQALTTSELNGYSQDLEVGTGKDSLLKGF-GEDDGVESX  904
            ++  LFC KK   +    +   +    S      QDLE+G     L+K   G D G E+ 
Sbjct  61   ELIQLFCFKKPQPLQHSNNGGREGSEISRDQDGDQDLELG-----LMKHLNGGDLGFEAE  115

Query  905  LMRLHN  922
            LM+LHN
Sbjct  116  LMKLHN  121



>ref|XP_009420089.1| PREDICTED: uncharacterized protein LOC103999913 [Musa acuminata 
subsp. malaccensis]
Length=261

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 5/90 (6%)
 Frame = +2

Query  668  LLWVRRRIRDRETEGEYTSIGSDIAYLFCCKKSNSVVTRTSTQALTTSELNGYSQDLEVG  847
            + W ++R R R+ E  Y S   ++ +LFC  + +S+    S+ AL   E++         
Sbjct  1    MFWWKKRAR-RDIEDNYGSPAKELLHLFCWNQPSSL----SSTALNPQEISASVDVATCS  55

Query  848  TGKDSLLKGFGEDDGVESXLMRLHNLCGPP  937
             GKD  LK F  +D +E+ LMRLH L GPP
Sbjct  56   DGKDLPLKPFEGEDTIEAELMRLHRLAGPP  85



>gb|KJB78845.1| hypothetical protein B456_013G022600 [Gossypium raimondii]
Length=260

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%), Gaps = 17/100 (17%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  763
            M S S +GIGLS  F  +L+ LV ELYYLLW ++R+  R           D  Y+FC K 
Sbjct  1    MKSLSSVGIGLSIAFASLLLALVGELYYLLWWKKRLTSR----------RDFFYMFCLKT  50

Query  764  SNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGE  883
            S+S    T+ +       N +S        KD +LK F +
Sbjct  51   SSSSSPPTTNEDDVHHHNNLHS-------NKDGMLKPFDD  83



>ref|NP_200743.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA97471.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO64169.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04073.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00562.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97174.1| uncharacterized protein AT5G59350 [Arabidopsis thaliana]
Length=287

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 63/123 (51%), Gaps = 15/123 (12%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIR---------DRETEGEYTSIGSD  736
            M + SGLGIGLS +FG +L+ LV E+YYLL  ++  +         ++E E +      +
Sbjct  1    MKTISGLGIGLSLMFGFLLLALVGEVYYLLRCKKHKKRVISQESEEEKEEEQQQNGYAKE  60

Query  737  IAYLFCCKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGF-GEDDGVESXLMR  913
            +  LFC KK  S+      +    S     + DLE+G     L+K   G D G E+ LM+
Sbjct  61   LIQLFCFKKPQSLQQNNGGREGEVSMNEDGNPDLELG-----LMKHLNGGDLGFEAELMK  115

Query  914  LHN  922
            LHN
Sbjct  116  LHN  118



>gb|AAM62607.1| unknown [Arabidopsis thaliana]
Length=287

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 63/124 (51%), Gaps = 17/124 (14%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDR----------ETEGEYTSIGS  733
            M + SGLGIGLS +FG +L+ LV E+YYLL  ++  ++R          E E +      
Sbjct  1    MKTISGLGIGLSLMFGFLLLALVGEVYYLLRCKKH-KNRVISQESEEEKEEEQQQNGYAK  59

Query  734  DIAYLFCCKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGF-GEDDGVESXLM  910
            ++  LFC KK  S+      +    S     + DLE+G     L+K   G D G E+ LM
Sbjct  60   ELIQLFCFKKPQSLQQNNGGREGEVSMNEDGNPDLELG-----LMKHLNGGDLGFEAELM  114

Query  911  RLHN  922
            +LHN
Sbjct  115  KLHN  118



>gb|KJB60678.1| hypothetical protein B456_009G319200 [Gossypium raimondii]
Length=249

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIR  694
            M S S +G+GLS VFGC+++ L+AE+YYLLW + R+R
Sbjct  1    MKSLSSVGLGLSIVFGCLVLALIAEVYYLLWWKNRLR  37



>ref|XP_009126699.1| PREDICTED: uncharacterized protein LOC103851582 [Brassica rapa]
Length=275

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 16/123 (13%)
 Frame = +2

Query  584  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR---------DRETEGEYTSIGS  733
            M +   LGIGLS VFG +L+ L+AE+YYLL W + + R           E + + T    
Sbjct  1    MKTIIKLGIGLSLVFGFLLLALIAEVYYLLRWKKHKKRVISQESEEEKEEEQQQQTGYAK  60

Query  734  DIAYLFCCKKSNSVVTRTSTQALTTSELNGYSQDLEVGTGKDSLLKGFGEDDGVESXLMR  913
            ++  LFC KK  S+          T      +QDLE+G  K   L+G G ++G E+ LM+
Sbjct  61   ELIQLFCFKKPQSLHANNGGSEGETPR----NQDLELGLMKH--LEGGGGEEGFEAELMK  114

Query  914  LHN  922
            LHN
Sbjct  115  LHN  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2282261823154