BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1958

Length=915
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003635158.1|  PREDICTED: oligopeptide transporter 3-like         390   2e-132   Vitis vinifera
ref|XP_009773627.1|  PREDICTED: oligopeptide transporter 3              402   7e-131   Nicotiana sylvestris
emb|CDP04526.1|  unnamed protein product                                402   9e-131   Coffea canephora [robusta coffee]
ref|XP_006352325.1|  PREDICTED: oligopeptide transporter 3-like         400   3e-130   Solanum tuberosum [potatoes]
emb|CBI18636.3|  unnamed protein product                                382   3e-130   Vitis vinifera
ref|XP_004250295.1|  PREDICTED: oligopeptide transporter 3              399   9e-130   Solanum lycopersicum
ref|XP_009590288.1|  PREDICTED: oligopeptide transporter 3              396   1e-128   Nicotiana tomentosiformis
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              394   8e-128   Vitis vinifera
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              394   8e-128   Sesamum indicum [beniseed]
gb|KDO78547.1|  hypothetical protein CISIN_1g004659mg                   384   9e-128   Citrus sinensis [apfelsine]
emb|CBI18634.3|  unnamed protein product                                392   5e-127   Vitis vinifera
ref|XP_002522882.1|  Oligopeptide transporter, putative                 391   7e-127   
ref|XP_012074788.1|  PREDICTED: oligopeptide transporter 3              391   8e-127   Jatropha curcas
gb|ABF98906.1|  oligopeptide transporter 3, putative, expressed         383   2e-126   Oryza sativa Japonica Group [Japonica rice]
gb|KDO78546.1|  hypothetical protein CISIN_1g004659mg                   383   3e-126   Citrus sinensis [apfelsine]
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              389   3e-126   Nelumbo nucifera [Indian lotus]
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         389   4e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007026362.1|  Oligopeptide transporter isoform 1                 389   6e-126   
gb|ADW66457.1|  oligopeptide transporter                                388   7e-126   Phytolacca americana [common pokeberry]
gb|ABF70152.1|  oligopeptide transporter OPT family protein             389   7e-126   Musa acuminata [banana]
ref|XP_009397220.1|  PREDICTED: oligopeptide transporter 3-like         389   9e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010039442.1|  PREDICTED: oligopeptide transporter 3-like         388   1e-125   Eucalyptus grandis [rose gum]
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         388   1e-125   Populus euphratica
ref|XP_002463868.1|  hypothetical protein SORBIDRAFT_01g007900          374   2e-125   
gb|EYU27660.1|  hypothetical protein MIMGU_mgv1a001879mg                387   3e-125   Erythranthe guttata [common monkey flower]
ref|XP_002308764.1|  OLIGOPEPTIDE TRANSPORTER family protein            387   3e-125   Populus trichocarpa [western balsam poplar]
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         386   5e-125   Elaeis guineensis
ref|XP_002323123.2|  OLIGOPEPTIDE TRANSPORTER family protein            384   6e-125   
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              386   8e-125   Populus euphratica
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             385   1e-124   Citrus clementina [clementine]
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         385   2e-124   Citrus sinensis [apfelsine]
ref|XP_010686627.1|  PREDICTED: oligopeptide transporter 3              385   2e-124   Beta vulgaris subsp. vulgaris [field beet]
gb|AAO32313.1|  putative oligopeptide transporter protein               384   2e-124   Oryza sativa Japonica Group [Japonica rice]
gb|KDO78542.1|  hypothetical protein CISIN_1g004659mg                   384   2e-124   Citrus sinensis [apfelsine]
ref|XP_004981750.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    385   3e-124   
ref|NP_001292781.1|  oligopeptide transporter 3                         384   4e-124   Zea mays [maize]
gb|ACL82964.1|  glutathione transporter                                 384   4e-124   Zea mays [maize]
ref|NP_001051290.1|  Os03g0751100                                       384   4e-124   
ref|XP_007211357.1|  hypothetical protein PRUPE_ppa001984mg             383   6e-124   
gb|KHN42268.1|  Oligopeptide transporter 3                              382   9e-124   Glycine soja [wild soybean]
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                383   1e-123   Gossypium arboreum [tree cotton]
ref|XP_003529676.1|  PREDICTED: oligopeptide transporter 3-like         382   2e-123   Glycine max [soybeans]
gb|AAQ91200.1|  putative glutathione transporter                        381   3e-123   Zea mays [maize]
dbj|BAK07444.1|  predicted protein                                      381   6e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT33592.1|  Oligopeptide transporter 3                              380   1e-122   
ref|XP_003549274.1|  PREDICTED: oligopeptide transporter 3-like         380   1e-122   Glycine max [soybeans]
ref|XP_008224626.1|  PREDICTED: oligopeptide transporter 3              379   2e-122   Prunus mume [ume]
gb|KHN03544.1|  Oligopeptide transporter 3                              379   2e-122   Glycine soja [wild soybean]
gb|KJB67417.1|  hypothetical protein B456_010G190300                    379   4e-122   Gossypium raimondii
ref|XP_010057794.1|  PREDICTED: oligopeptide transporter 3-like         379   5e-122   Eucalyptus grandis [rose gum]
ref|XP_006651827.1|  PREDICTED: oligopeptide transporter 3-like         379   6e-122   
ref|XP_009374520.1|  PREDICTED: oligopeptide transporter 3              379   6e-122   Pyrus x bretschneideri [bai li]
ref|XP_008780991.1|  PREDICTED: oligopeptide transporter 3-like         377   1e-121   Phoenix dactylifera
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         377   2e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007154044.1|  hypothetical protein PHAVU_003G086500g             377   2e-121   Phaseolus vulgaris [French bean]
ref|XP_002463867.1|  hypothetical protein SORBIDRAFT_01g007880          377   2e-121   Sorghum bicolor [broomcorn]
gb|KFK26550.1|  hypothetical protein AALP_AA8G263100                    376   3e-121   Arabis alpina [alpine rockcress]
ref|XP_004295330.1|  PREDICTED: oligopeptide transporter 3              376   5e-121   Fragaria vesca subsp. vesca
ref|XP_008464311.1|  PREDICTED: oligopeptide transporter 3              375   8e-121   Cucumis melo [Oriental melon]
ref|XP_008345787.1|  PREDICTED: oligopeptide transporter 3-like         375   1e-120   Malus domestica [apple tree]
ref|XP_006283198.1|  hypothetical protein CARUB_v10004230mg             375   1e-120   Capsella rubella
ref|XP_006856263.1|  PREDICTED: oligopeptide transporter 3 isofor...    375   1e-120   Amborella trichopoda
ref|XP_010440168.1|  PREDICTED: oligopeptide transporter 3-like         375   1e-120   Camelina sativa [gold-of-pleasure]
gb|AAK96781.1|  Unknown protein                                         375   1e-120   Arabidopsis thaliana [mouse-ear cress]
sp|O23482.3|OPT3_ARATH  RecName: Full=Oligopeptide transporter 3;...    375   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449801.1|  PREDICTED: oligopeptide transporter 3              375   2e-120   Camelina sativa [gold-of-pleasure]
ref|XP_004139520.1|  PREDICTED: oligopeptide transporter 3              375   2e-120   Cucumis sativus [cucumbers]
ref|XP_009124517.1|  PREDICTED: oligopeptide transporter 3              374   2e-120   Brassica rapa
emb|CDY42539.1|  BnaC08g10640D                                          374   2e-120   Brassica napus [oilseed rape]
ref|XP_002868139.1|  hypothetical protein ARALYDRAFT_355122             374   2e-120   Arabidopsis lyrata subsp. lyrata
ref|XP_008785648.1|  PREDICTED: oligopeptide transporter 3-like         374   2e-120   Phoenix dactylifera
gb|ADW09325.1|  oligopeptide transporter 3                              374   2e-120   Noccaea caerulescens
gb|KEH32683.1|  oligopeptide transporter OPT family protein             372   1e-119   Medicago truncatula
emb|CAD91127.1|  glutathione transporter GT1                            370   1e-119   Brassica juncea [brown mustard]
ref|XP_004507597.1|  PREDICTED: oligopeptide transporter 3-like         372   1e-119   Cicer arietinum [garbanzo]
ref|XP_006414361.1|  hypothetical protein EUTSA_v10024512mg             372   2e-119   Eutrema salsugineum [saltwater cress]
ref|XP_009374859.1|  PREDICTED: oligopeptide transporter 3-like         372   3e-119   Pyrus x bretschneideri [bai li]
ref|NP_567493.5|  oligopeptide transporter                              370   7e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010039444.1|  PREDICTED: oligopeptide transporter 3-like i...    370   2e-118   Eucalyptus grandis [rose gum]
ref|XP_010039447.1|  PREDICTED: oligopeptide transporter 3-like i...    368   3e-118   Eucalyptus grandis [rose gum]
ref|XP_008349335.1|  PREDICTED: oligopeptide transporter 3-like         367   2e-117   
ref|XP_010542186.1|  PREDICTED: oligopeptide transporter 3              357   1e-113   Tarenaya hassleriana [spider flower]
ref|XP_010039443.1|  PREDICTED: oligopeptide transporter 3-like         354   4e-113   Eucalyptus grandis [rose gum]
gb|KCW45990.1|  hypothetical protein EUGRSUZ_L00158                     354   1e-112   Eucalyptus grandis [rose gum]
ref|XP_010436532.1|  PREDICTED: oligopeptide transporter 3              349   9e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010939248.1|  PREDICTED: oligopeptide transporter 3-like         347   9e-110   Elaeis guineensis
gb|AAO72613.1|  Isp-4-like protein                                      315   1e-100   Oryza sativa Japonica Group [Japonica rice]
emb|CDP04527.1|  unnamed protein product                                320   3e-100   Coffea canephora [robusta coffee]
ref|XP_010087657.1|  Oligopeptide transporter 3                         321   5e-100   
gb|KDP35952.1|  hypothetical protein JCGZ_09924                         288   4e-93    Jatropha curcas
ref|XP_012074611.1|  PREDICTED: oligopeptide transporter 4-like         293   3e-90    
ref|XP_010919977.1|  PREDICTED: oligopeptide transporter 4-like         285   4e-90    
gb|ABK94821.1|  unknown                                                 286   6e-90    Populus trichocarpa [western balsam poplar]
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like         295   7e-90    Nelumbo nucifera [Indian lotus]
gb|KJB58811.1|  hypothetical protein B456_009G227200                    292   5e-89    Gossypium raimondii
gb|KDO67987.1|  hypothetical protein CISIN_1g020208mg                   280   1e-88    Citrus sinensis [apfelsine]
ref|XP_009398499.1|  PREDICTED: oligopeptide transporter 4-like         291   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like         290   4e-88    Solanum tuberosum [potatoes]
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4              289   9e-88    Nicotiana tomentosiformis
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4              289   1e-87    Nicotiana sylvestris
gb|KJB32168.1|  hypothetical protein B456_005G227300                    283   1e-87    Gossypium raimondii
emb|CDO97359.1|  unnamed protein product                                278   1e-87    Coffea canephora [robusta coffee]
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4              288   1e-87    Solanum lycopersicum
gb|KEH36459.1|  oligopeptide transporter OPT family protein             283   2e-87    Medicago truncatula
ref|XP_007018304.1|  Oligopeptide transporter 2                         288   2e-87    
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like         288   3e-87    Pyrus x bretschneideri [bai li]
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g             287   6e-87    Populus trichocarpa [western balsam poplar]
ref|XP_002518328.1|  Oligopeptide transporter, putative                 287   8e-87    Ricinus communis
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like         286   1e-86    Citrus sinensis [apfelsine]
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like         286   1e-86    Eucalyptus grandis [rose gum]
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4              286   1e-86    Sesamum indicum [beniseed]
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like         286   1e-86    Eucalyptus grandis [rose gum]
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4              286   1e-86    Populus euphratica
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg             286   2e-86    Citrus clementina [clementine]
gb|EYU18387.1|  hypothetical protein MIMGU_mgv1a0036351mg               281   2e-86    Erythranthe guttata [common monkey flower]
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             285   2e-86    Selaginella moellendorffii
ref|XP_004485624.1|  PREDICTED: oligopeptide transporter 4-like         285   2e-86    Cicer arietinum [garbanzo]
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein                286   3e-86    Gossypium arboreum [tree cotton]
ref|XP_010933427.1|  PREDICTED: oligopeptide transporter 4-like         286   3e-86    Elaeis guineensis
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2              285   3e-86    Cucumis sativus [cucumbers]
ref|XP_012074612.1|  PREDICTED: oligopeptide transporter 4-like         280   4e-86    Jatropha curcas
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like         285   4e-86    Phoenix dactylifera
gb|AES90550.2|  oligopeptide transporter OPT family protein             284   5e-86    Medicago truncatula
gb|KJB58809.1|  hypothetical protein B456_009G227000                    278   5e-86    Gossypium raimondii
ref|XP_003593303.1|  Oligopeptide transporter                           284   6e-86    
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2              284   6e-86    Vitis vinifera
ref|XP_008219191.1|  PREDICTED: oligopeptide transporter 2-like         284   7e-86    Prunus mume [ume]
emb|CAN81605.1|  hypothetical protein VITISV_025060                     284   7e-86    Vitis vinifera
ref|XP_007042780.1|  Oligopeptide transporter 4                         288   8e-86    
gb|KJB32170.1|  hypothetical protein B456_005G227300                    284   1e-85    Gossypium raimondii
ref|XP_010030911.1|  PREDICTED: oligopeptide transporter 4-like         284   1e-85    
emb|CBI35438.3|  unnamed protein product                                283   1e-85    Vitis vinifera
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like         283   1e-85    Citrus sinensis [apfelsine]
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             284   1e-85    Selaginella moellendorffii
gb|KJB58808.1|  hypothetical protein B456_009G227000                    284   1e-85    Gossypium raimondii
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2              283   1e-85    Cucumis melo [Oriental melon]
ref|XP_003608353.1|  Oligopeptide transporter                           283   1e-85    
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like         283   1e-85    
gb|KJB32169.1|  hypothetical protein B456_005G227300                    284   1e-85    Gossypium raimondii
ref|XP_007225210.1|  hypothetical protein PRUPE_ppa002011mg             283   2e-85    Prunus persica
ref|XP_010112260.1|  Oligopeptide transporter 4                         283   2e-85    Morus notabilis
ref|XP_007159179.1|  hypothetical protein PHAVU_002G215700g             283   2e-85    Phaseolus vulgaris [French bean]
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4              283   2e-85    Vitis vinifera
ref|XP_003528403.1|  PREDICTED: oligopeptide transporter 4-like         283   2e-85    Glycine max [soybeans]
emb|CAN61122.1|  hypothetical protein VITISV_038682                     279   2e-85    Vitis vinifera
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...    283   3e-85    Phoenix dactylifera
gb|EMS45133.1|  Oligopeptide transporter 4                              281   4e-85    Triticum urartu
gb|KCW56911.1|  hypothetical protein EUGRSUZ_I02587                     282   4e-85    Eucalyptus grandis [rose gum]
gb|AAM64614.1|  Isp4-like protein                                       282   5e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649             281   5e-85    Arabidopsis lyrata subsp. lyrata
ref|NP_201246.1|  oligopeptide transporter 4                            281   5e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like         281   6e-85    Camelina sativa [gold-of-pleasure]
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg             281   6e-85    Eutrema salsugineum [saltwater cress]
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like         281   6e-85    Camelina sativa [gold-of-pleasure]
emb|CBI19305.3|  unnamed protein product                                281   6e-85    Vitis vinifera
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4              281   6e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010104576.1|  Oligopeptide transporter 2                         281   6e-85    
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg             281   7e-85    Capsella rubella
ref|XP_002967106.1|  hypothetical protein SELMODRAFT_87413              281   7e-85    
emb|CBI19303.3|  unnamed protein product                                284   7e-85    Vitis vinifera
ref|XP_002960906.1|  hypothetical protein SELMODRAFT_229868             281   7e-85    
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4              282   8e-85    Tarenaya hassleriana [spider flower]
ref|XP_003545740.1|  PREDICTED: oligopeptide transporter 4              281   9e-85    
ref|XP_002283674.1|  PREDICTED: oligopeptide transporter 4-like         281   9e-85    Vitis vinifera
ref|XP_007148333.1|  hypothetical protein PHAVU_006G200000g             281   1e-84    Phaseolus vulgaris [French bean]
gb|EMT05383.1|  Oligopeptide transporter 4                              277   1e-84    
gb|KHN33580.1|  Oligopeptide transporter 4                              281   1e-84    Glycine soja [wild soybean]
ref|XP_001767301.1|  predicted protein                                  280   1e-84    
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                     280   1e-84    Eucalyptus grandis [rose gum]
gb|EPS59040.1|  hypothetical protein M569_15770                         276   1e-84    Genlisea aurea
ref|XP_007148334.1|  hypothetical protein PHAVU_006G200100g             280   2e-84    Phaseolus vulgaris [French bean]
ref|XP_006422647.1|  hypothetical protein CICLE_v10027887mg             280   2e-84    
gb|EMT16469.1|  Oligopeptide transporter 4                              281   2e-84    
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like         281   2e-84    
gb|KJB32171.1|  hypothetical protein B456_005G227300                    284   2e-84    Gossypium raimondii
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like         280   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_003547106.1|  PREDICTED: oligopeptide transporter 4-like         280   3e-84    
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4              280   3e-84    Brassica rapa
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg             280   4e-84    Citrus clementina [clementine]
ref|XP_011627879.1|  PREDICTED: oligopeptide transporter 4 isofor...    272   4e-84    
gb|EMT13287.1|  Oligopeptide transporter 4                              274   5e-84    
dbj|BAJ90957.1|  predicted protein                                      279   6e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2              279   6e-84    Tarenaya hassleriana [spider flower]
ref|XP_010029956.1|  PREDICTED: oligopeptide transporter 4-like         279   7e-84    Eucalyptus grandis [rose gum]
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4              279   7e-84    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein                279   8e-84    Gossypium arboreum [tree cotton]
gb|KJB58807.1|  hypothetical protein B456_009G227000                    279   9e-84    Gossypium raimondii
ref|XP_011624487.1|  PREDICTED: oligopeptide transporter 4              268   1e-83    
emb|CDP19591.1|  unnamed protein product                                275   1e-83    Coffea canephora [robusta coffee]
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like         278   1e-83    Nelumbo nucifera [Indian lotus]
gb|KCW56912.1|  hypothetical protein EUGRSUZ_I02589                     279   1e-83    Eucalyptus grandis [rose gum]
emb|CDY46800.1|  BnaC02g43080D                                          278   2e-83    Brassica napus [oilseed rape]
emb|CDY31321.1|  BnaA02g34200D                                          278   2e-83    Brassica napus [oilseed rape]
gb|EMS64171.1|  Oligopeptide transporter 4                              276   2e-83    Triticum urartu
gb|KGN53886.1|  hypothetical protein Csa_4G179700                       278   2e-83    Cucumis sativus [cucumbers]
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4              278   2e-83    Cucumis sativus [cucumbers]
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4              277   3e-83    Cucumis melo [Oriental melon]
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like         278   3e-83    Eucalyptus grandis [rose gum]
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like         277   3e-83    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                    281   4e-83    Arabis alpina [alpine rockcress]
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg             276   5e-83    Capsella rubella
ref|XP_003570148.1|  PREDICTED: oligopeptide transporter 4-like         276   7e-83    Brachypodium distachyon [annual false brome]
ref|XP_003522744.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    276   7e-83    Glycine max [soybeans]
ref|NP_001266848.1|  uncharacterized protein LOC101027225               266   8e-83    
gb|KHN33579.1|  Oligopeptide transporter 4                              274   1e-82    Glycine soja [wild soybean]
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like         275   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_007018306.1|  Oligopeptide transporter 4                         276   1e-82    
ref|XP_012068072.1|  PREDICTED: oligopeptide transporter 2              275   1e-82    Jatropha curcas
emb|CDP04528.1|  unnamed protein product                                273   2e-82    Coffea canephora [robusta coffee]
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2              275   2e-82    Camelina sativa [gold-of-pleasure]
gb|AFW63465.1|  hypothetical protein ZEAMMB73_812110                    268   2e-82    
emb|CBI19304.3|  unnamed protein product                                274   6e-82    Vitis vinifera
ref|XP_002527347.1|  Oligopeptide transporter, putative                 274   7e-82    Ricinus communis
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4              274   7e-82    Vitis vinifera
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g             273   9e-82    
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        273   9e-82    
gb|EEE57620.1|  hypothetical protein OsJ_08019                          273   9e-82    Oryza sativa Japonica Group [Japonica rice]
emb|CDP19592.1|  unnamed protein product                                273   1e-81    Coffea canephora [robusta coffee]
dbj|BAD08158.1|  putative sexual differentiation process protein ...    273   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006856596.1|  PREDICTED: oligopeptide transporter 4 isofor...    273   1e-81    Amborella trichopoda
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2              273   1e-81    Populus euphratica
ref|XP_002892535.1|  ATOPT2                                             273   1e-81    Arabidopsis lyrata subsp. lyrata
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like         273   2e-81    Solanum tuberosum [potatoes]
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like         273   2e-81    Sesamum indicum [beniseed]
gb|EYU21027.1|  hypothetical protein MIMGU_mgv1a026700mg                272   3e-81    Erythranthe guttata [common monkey flower]
gb|EEC73829.1|  hypothetical protein OsI_08562                          272   3e-81    Oryza sativa Indica Group [Indian rice]
ref|NP_172464.1|  oligopeptide transporter 2                            271   4e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KDP41519.1|  hypothetical protein JCGZ_15926                         264   4e-81    Jatropha curcas
gb|ABE65610.1|  oligopeptide transporter OPT family protein             271   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg             271   7e-81    Prunus persica
emb|CDY69955.1|  BnaCnng66090D                                          271   7e-81    Brassica napus [oilseed rape]
ref|XP_009118291.1|  PREDICTED: oligopeptide transporter 2              270   1e-80    Brassica rapa
ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like         270   2e-80    Nicotiana tomentosiformis
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like         270   3e-80    Solanum lycopersicum
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...    270   3e-80    Setaria italica
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like         270   3e-80    Prunus mume [ume]
ref|XP_008466652.1|  PREDICTED: oligopeptide transporter 4-like         269   4e-80    Cucumis melo [Oriental melon]
ref|XP_004953567.1|  PREDICTED: oligopeptide transporter 4-like i...    270   4e-80    
ref|XP_008646108.1|  PREDICTED: oligopeptide transporter 4-like         269   6e-80    Zea mays [maize]
ref|XP_008677393.1|  PREDICTED: oligopeptide transporter 4 isofor...    268   8e-80    
gb|EMS53301.1|  Oligopeptide transporter 4                              266   9e-80    Triticum urartu
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like         268   1e-79    Citrus sinensis [apfelsine]
ref|XP_004136414.1|  PREDICTED: oligopeptide transporter 4-like         267   2e-79    Cucumis sativus [cucumbers]
gb|ERN09040.1|  hypothetical protein AMTR_s03508p00001080               257   2e-79    Amborella trichopoda
ref|XP_007137663.1|  hypothetical protein PHAVU_009G145300g             266   3e-79    Phaseolus vulgaris [French bean]
dbj|BAD94325.1|  hypothetical protein                                   255   3e-79    Arabidopsis thaliana [mouse-ear cress]
gb|KHG27447.1|  Oligopeptide transporter 2 -like protein                253   3e-79    Gossypium arboreum [tree cotton]
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg             266   3e-79    
gb|EAY75055.1|  hypothetical protein OsI_02950                          267   3e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_010064240.1|  PREDICTED: oligopeptide transporter 4-like         266   4e-79    
ref|XP_008348885.1|  PREDICTED: oligopeptide transporter 4-like         253   4e-79    
dbj|BAB89477.1|  isp4 protein-like                                      266   4e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010267482.1|  PREDICTED: oligopeptide transporter 7-like         266   5e-79    Nelumbo nucifera [Indian lotus]
gb|KCW66677.1|  hypothetical protein EUGRSUZ_F00450                     266   5e-79    Eucalyptus grandis [rose gum]
ref|XP_004288877.2|  PREDICTED: oligopeptide transporter 2-like         266   6e-79    Fragaria vesca subsp. vesca
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like         266   7e-79    Phoenix dactylifera
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg             265   7e-79    Eutrema salsugineum [saltwater cress]
emb|CDY22616.1|  BnaC08g42500D                                          267   1e-78    Brassica napus [oilseed rape]
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4              265   2e-78    Pyrus x bretschneideri [bai li]
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like         265   2e-78    
ref|XP_004252726.1|  PREDICTED: oligopeptide transporter 2-like         264   2e-78    Solanum lycopersicum
ref|XP_012068073.1|  PREDICTED: oligopeptide transporter 4-like         265   2e-78    Jatropha curcas
ref|XP_010104574.1|  Oligopeptide transporter 4                         264   3e-78    Morus notabilis
ref|XP_011626075.1|  PREDICTED: oligopeptide transporter 7              264   4e-78    Amborella trichopoda
gb|ERN13351.1|  hypothetical protein AMTR_s00041p00121000               263   5e-78    Amborella trichopoda
ref|XP_009619170.1|  PREDICTED: oligopeptide transporter 2-like         263   5e-78    Nicotiana tomentosiformis
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         263   5e-78    Nicotiana sylvestris
emb|CDP00949.1|  unnamed protein product                                263   9e-78    Coffea canephora [robusta coffee]
ref|XP_010244696.1|  PREDICTED: oligopeptide transporter 4-like         263   1e-77    Nelumbo nucifera [Indian lotus]
ref|XP_004289821.1|  PREDICTED: oligopeptide transporter 4              261   2e-77    Fragaria vesca subsp. vesca
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like         262   3e-77    Nelumbo nucifera [Indian lotus]
emb|CDP19589.1|  unnamed protein product                                261   3e-77    Coffea canephora [robusta coffee]
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like         262   3e-77    
ref|XP_002971950.1|  hypothetical protein SELMODRAFT_148240             261   4e-77    
gb|ACF78596.1|  unknown                                                 250   4e-77    Zea mays [maize]
gb|KHN08229.1|  Oligopeptide transporter 4                              259   6e-77    Glycine soja [wild soybean]
ref|XP_002977317.1|  hypothetical protein SELMODRAFT_232939             260   7e-77    
ref|XP_002874647.1|  ATOPT7                                             260   1e-76    
gb|EYU36438.1|  hypothetical protein MIMGU_mgv1a023798mg                258   1e-76    Erythranthe guttata [common monkey flower]
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like         260   2e-76    
gb|KDO81278.1|  hypothetical protein CISIN_1g0461252mg                  254   2e-76    
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7              259   2e-76    
ref|XP_010422002.1|  PREDICTED: oligopeptide transporter 7              259   2e-76    
ref|XP_010436760.1|  PREDICTED: oligopeptide transporter 7-like         259   2e-76    
emb|CDP19590.1|  unnamed protein product                                259   3e-76    
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         259   3e-76    
ref|NP_200164.1|  oligopeptide transporter 8                            258   4e-76    
gb|AAB60748.1|  Similar to S. pombe ISP4 (gb|D83992)                    258   5e-76    
ref|NP_192815.1|  oligopeptide transporter 7                            258   6e-76    
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like         258   6e-76    
ref|XP_009795358.1|  PREDICTED: oligopeptide transporter 2-like         258   6e-76    
ref|XP_010455470.1|  PREDICTED: oligopeptide transporter 7-like         258   7e-76    
gb|EPS65868.1|  hypothetical protein M569_08909                         253   8e-76    
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             257   9e-76    
ref|XP_009616769.1|  PREDICTED: oligopeptide transporter 2-like         257   1e-75    
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070          258   1e-75    
ref|XP_010064243.1|  PREDICTED: oligopeptide transporter 4-like         257   1e-75    
ref|NP_194503.1|  oligopeptide transporter                              257   1e-75    
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like         257   1e-75    
ref|XP_006289826.1|  hypothetical protein CARUB_v10003431mg             258   1e-75    
ref|XP_006413163.1|  hypothetical protein EUTSA_v10024804mg             253   1e-75    
ref|XP_002867556.1|  ATOPT5                                             257   2e-75    
ref|XP_002867483.1|  ATOPT6                                             256   2e-75    
ref|XP_006397011.1|  hypothetical protein EUTSA_v10028453mg             257   2e-75    
ref|XP_010252553.1|  PREDICTED: oligopeptide transporter 7-like         256   2e-75    
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...    256   2e-75    
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...    256   2e-75    
ref|XP_006401694.1|  hypothetical protein EUTSA_v10015543mg             256   2e-75    
ref|XP_008219210.1|  PREDICTED: oligopeptide transporter 2-like         256   3e-75    
ref|XP_010671041.1|  PREDICTED: oligopeptide transporter 2              256   3e-75    
gb|KCW76549.1|  hypothetical protein EUGRSUZ_D00938                     253   4e-75    
ref|XP_010090089.1|  Oligopeptide transporter 7                         248   4e-75    
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    255   4e-75    
ref|XP_004138881.2|  PREDICTED: oligopeptide transporter 6-like         255   5e-75    
ref|XP_008790539.1|  PREDICTED: oligopeptide transporter 7-like         256   5e-75    
ref|XP_010448244.1|  PREDICTED: oligopeptide transporter 5-like         256   5e-75    
ref|XP_009132467.1|  PREDICTED: oligopeptide transporter 8-like         255   5e-75    
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    255   5e-75    
emb|CDY47076.1|  BnaA03g12220D                                          255   6e-75    
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like         256   6e-75    
ref|XP_010442919.1|  PREDICTED: oligopeptide transporter 8-like         255   7e-75    
gb|KFK31865.1|  hypothetical protein AALP_AA6G168500                    255   9e-75    
ref|NP_001169171.1|  hypothetical protein                               246   9e-75    
ref|XP_004238545.1|  PREDICTED: oligopeptide transporter 4-like         255   9e-75    
emb|CDY55351.1|  BnaAnng13860D                                          254   9e-75    
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like         254   1e-74    
ref|XP_004972025.1|  PREDICTED: oligopeptide transporter 4-like         255   1e-74    
ref|XP_010934151.1|  PREDICTED: oligopeptide transporter 7-like         255   1e-74    
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7              255   1e-74    
ref|XP_010438730.1|  PREDICTED: oligopeptide transporter 5              254   1e-74    
ref|XP_010320236.1|  PREDICTED: oligopeptide transporter 2-like         254   1e-74    
ref|XP_009780017.1|  PREDICTED: oligopeptide transporter 4-like         254   1e-74    
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              254   1e-74    
emb|CDY19030.1|  BnaC01g20380D                                          254   2e-74    
ref|XP_009795934.1|  PREDICTED: oligopeptide transporter 7-like i...    251   2e-74    
ref|XP_002864248.1|  predicted protein                                  254   2e-74    
dbj|BAJ85921.1|  predicted protein                                      244   2e-74    
ref|XP_011040150.1|  PREDICTED: oligopeptide transporter 1-like i...    254   2e-74    
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              253   2e-74    
dbj|BAD94070.1|  sexual differentiation process protein ISP4-like       243   3e-74    
ref|XP_006656581.1|  PREDICTED: oligopeptide transporter 7-like         253   3e-74    
ref|XP_010433474.1|  PREDICTED: oligopeptide transporter 5-like         254   3e-74    
ref|XP_002323113.2|  hypothetical protein POPTR_0016s00650g             253   3e-74    
ref|NP_001167707.1|  uncharacterized protein LOC100381394               252   3e-74    
ref|XP_011040149.1|  PREDICTED: oligopeptide transporter 1-like i...    254   3e-74    
ref|XP_010445886.1|  PREDICTED: oligopeptide transporter 8              253   3e-74    
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         253   3e-74    
emb|CDY38751.1|  BnaC03g14980D                                          253   4e-74    
emb|CDX96230.1|  BnaC02g14210D                                          253   4e-74    
ref|XP_006655737.1|  PREDICTED: oligopeptide transporter 7-like         253   4e-74    
ref|XP_006652734.1|  PREDICTED: oligopeptide transporter 4-like         253   5e-74    
ref|XP_007156163.1|  hypothetical protein PHAVU_003G263700g             247   5e-74    
emb|CDX86844.1|  BnaA09g22340D                                          253   5e-74    
gb|EYU30413.1|  hypothetical protein MIMGU_mgv1a002159mg                252   5e-74    
emb|CBI34570.3|  unnamed protein product                                251   6e-74    
gb|KJB40154.1|  hypothetical protein B456_007G049100                    248   6e-74    
ref|XP_009127158.1|  PREDICTED: oligopeptide transporter 8              253   6e-74    
emb|CDY28832.1|  BnaA02g10240D                                          253   6e-74    
ref|XP_010485098.1|  PREDICTED: oligopeptide transporter 8-like         252   7e-74    
ref|XP_009126974.1|  PREDICTED: oligopeptide transporter 1              252   8e-74    
emb|CDY06549.1|  BnaC02g12730D                                          252   8e-74    
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             253   8e-74    
gb|EYU19483.1|  hypothetical protein MIMGU_mgv1a023929mg                251   9e-74    
ref|XP_008663549.1|  PREDICTED: oligopeptide transporter 4-like         252   9e-74    
ref|NP_194389.1|  oligopeptide transporter 5                            252   9e-74    
ref|XP_006281558.1|  hypothetical protein CARUB_v10027665mg             252   9e-74    
ref|XP_008445079.1|  PREDICTED: oligopeptide transporter 6-like         252   1e-73    
ref|XP_009615074.1|  PREDICTED: oligopeptide transporter 4-like         252   1e-73    
dbj|BAJ85522.1|  predicted protein                                      250   1e-73    
ref|XP_007156168.1|  hypothetical protein PHAVU_003G263900g             252   1e-73    
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          251   1e-73    
ref|XP_003603705.1|  Oligopeptide transporter                           251   1e-73    
ref|XP_009591882.1|  PREDICTED: oligopeptide transporter 7-like         252   1e-73    
ref|XP_006340746.1|  PREDICTED: oligopeptide transporter 7-like         251   1e-73    
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7              251   2e-73    
dbj|BAJ95761.1|  predicted protein                                      250   2e-73    
ref|XP_002452707.1|  hypothetical protein SORBIDRAFT_04g031080          251   2e-73    
emb|CDP01884.1|  unnamed protein product                                251   2e-73    
ref|NP_001130398.1|  uncharacterized protein LOC100191494               252   2e-73    
ref|XP_009795933.1|  PREDICTED: oligopeptide transporter 7-like i...    251   2e-73    
ref|XP_006343361.1|  PREDICTED: oligopeptide transporter 7-like         251   2e-73    
gb|KFK29177.1|  hypothetical protein AALP_AA7G099400                    251   2e-73    
ref|XP_011626108.1|  PREDICTED: oligopeptide transporter 7              252   3e-73    
gb|ERN13358.1|  hypothetical protein AMTR_s00041p00133990               251   3e-73    
ref|XP_010932249.1|  PREDICTED: oligopeptide transporter 5-like         238   4e-73    
ref|XP_012071038.1|  PREDICTED: oligopeptide transporter 1-like i...    251   4e-73    
gb|KDP39297.1|  hypothetical protein JCGZ_01054                         250   5e-73    
ref|XP_009412736.1|  PREDICTED: oligopeptide transporter 7-like         250   5e-73    
ref|XP_012071036.1|  PREDICTED: oligopeptide transporter 1-like         250   5e-73    
ref|XP_010317692.1|  PREDICTED: oligopeptide transporter 7-like         250   5e-73    
ref|NP_001056665.1|  Os06g0127700                                       250   7e-73    
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530          250   9e-73    
ref|XP_011658051.1|  PREDICTED: oligopeptide transporter 7-like i...    248   9e-73    
ref|XP_008346658.1|  PREDICTED: oligopeptide transporter 7-like         245   9e-73    
ref|XP_012071040.1|  PREDICTED: oligopeptide transporter 1-like         249   9e-73    
gb|KFK27168.1|  hypothetical protein AALP_AA8G344300                    249   9e-73    
ref|XP_010483061.1|  PREDICTED: oligopeptide transporter 1              249   1e-72    
gb|KDP39296.1|  hypothetical protein JCGZ_01053                         249   1e-72    
ref|XP_010443233.1|  PREDICTED: oligopeptide transporter 1-like         249   1e-72    
ref|XP_007156164.1|  hypothetical protein PHAVU_003G263700g             247   1e-72    
ref|NP_001056650.2|  Os06g0125400                                       235   1e-72    
ref|XP_010450442.1|  PREDICTED: oligopeptide transporter 1-like         249   1e-72    
ref|XP_011649758.1|  PREDICTED: oligopeptide transporter 6-like         248   2e-72    
ref|XP_010228050.1|  PREDICTED: oligopeptide transporter 7-like i...    248   2e-72    
gb|EEC79904.1|  hypothetical protein OsI_21444                          249   2e-72    
ref|XP_003557106.2|  PREDICTED: oligopeptide transporter 7-like i...    248   2e-72    
gb|KJB68518.1|  hypothetical protein B456_010G248000                    248   2e-72    
gb|EMS65130.1|  Oligopeptide transporter 7                              247   2e-72    
emb|CCO06497.1|  oligopeptide transporter                               248   2e-72    
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         248   2e-72    
gb|KJB40153.1|  hypothetical protein B456_007G049100                    248   2e-72    
dbj|BAD67732.1|  putative sexual differentiation process protein ...    249   2e-72    
gb|KCW53169.1|  hypothetical protein EUGRSUZ_J02450                     244   2e-72    
ref|XP_008390300.1|  PREDICTED: oligopeptide transporter 7 isofor...    248   3e-72    
ref|XP_002864417.1|  ATOPT1                                             248   3e-72    
ref|XP_011658049.1|  PREDICTED: oligopeptide transporter 7-like i...    248   3e-72    
ref|XP_008374152.1|  PREDICTED: oligopeptide transporter 7-like         245   3e-72    
ref|XP_008445076.1|  PREDICTED: oligopeptide transporter 6-like         248   3e-72    
gb|KDP39295.1|  hypothetical protein JCGZ_01052                         247   3e-72    
ref|XP_008376782.1|  PREDICTED: oligopeptide transporter 6              248   4e-72    
gb|KCW45497.1|  hypothetical protein EUGRSUZ_L00776                     245   4e-72    
ref|XP_008440830.1|  PREDICTED: oligopeptide transporter 7-like         248   4e-72    
ref|XP_004964383.1|  PREDICTED: oligopeptide transporter 7-like i...    248   4e-72    
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like         248   4e-72    
ref|XP_004964382.1|  PREDICTED: oligopeptide transporter 7-like i...    248   5e-72    
ref|XP_008648099.1|  PREDICTED: uncharacterized protein LOC100383...    248   5e-72    
ref|XP_009414381.1|  PREDICTED: oligopeptide transporter 5-like         247   5e-72    
ref|XP_007142437.1|  hypothetical protein PHAVU_008G280400g             247   5e-72    
ref|XP_012071261.1|  PREDICTED: oligopeptide transporter 1-like         248   5e-72    
ref|XP_006279740.1|  hypothetical protein CARUB_v10027572mg             248   6e-72    
ref|XP_010536754.1|  PREDICTED: oligopeptide transporter 5-like         247   6e-72    
ref|XP_010113336.1|  Oligopeptide transporter 7                         250   6e-72    
ref|XP_007156166.1|  hypothetical protein PHAVU_003G263700g             247   6e-72    
ref|XP_007207290.1|  hypothetical protein PRUPE_ppa014997mg             247   7e-72    
ref|XP_004511249.1|  PREDICTED: oligopeptide transporter 7-like         247   7e-72    
gb|KCW53166.1|  hypothetical protein EUGRSUZ_J02448                     245   7e-72    
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...    247   7e-72    
gb|EPS62495.1|  hypothetical protein M569_12295                         246   8e-72    
emb|CDP13696.1|  unnamed protein product                                246   8e-72    
gb|KDP35527.1|  hypothetical protein JCGZ_08965                         243   9e-72    
ref|XP_009142514.1|  PREDICTED: oligopeptide transporter 5              247   9e-72    
gb|KHG27803.1|  Oligopeptide transporter 7 -like protein                247   9e-72    
ref|XP_006476310.1|  PREDICTED: oligopeptide transporter 7-like i...    246   9e-72    
emb|CDX89322.1|  BnaA01g15710D                                          247   1e-71    
ref|XP_009137603.1|  PREDICTED: oligopeptide transporter 5-like         246   1e-71    
emb|CDX94308.1|  BnaC01g18760D                                          246   1e-71    
ref|XP_010097383.1|  Oligopeptide transporter 1                         246   1e-71    
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like         247   1e-71    
ref|XP_009349149.1|  PREDICTED: oligopeptide transporter 1-like         246   1e-71    
gb|KEH19466.1|  oligopeptide transporter OPT family protein             244   1e-71    
gb|EYU45287.1|  hypothetical protein MIMGU_mgv1a0020141mg               232   1e-71    
ref|XP_009361323.1|  PREDICTED: oligopeptide transporter 6-like         246   1e-71    
ref|XP_011008821.1|  PREDICTED: oligopeptide transporter 7-like         246   1e-71    
ref|XP_006476309.1|  PREDICTED: oligopeptide transporter 7-like i...    246   1e-71    
gb|EMT07894.1|  Oligopeptide transporter 7                              246   2e-71    
ref|XP_009414376.1|  PREDICTED: oligopeptide transporter 5-like         246   2e-71    
ref|XP_010034698.1|  PREDICTED: oligopeptide transporter 7-like         246   2e-71    
ref|XP_009777242.1|  PREDICTED: oligopeptide transporter 1-like         246   2e-71    
ref|XP_006439249.1|  hypothetical protein CICLE_v10018971mg             246   2e-71    
ref|XP_006655730.1|  PREDICTED: oligopeptide transporter 7-like         246   3e-71    
ref|XP_006439250.1|  hypothetical protein CICLE_v10018971mg             246   3e-71    
gb|KJB39494.1|  hypothetical protein B456_007G016300                    245   3e-71    
dbj|BAJ85948.1|  predicted protein                                      245   3e-71    
ref|XP_003628537.1|  Oligopeptide transporter                           245   3e-71    
ref|XP_007156167.1|  hypothetical protein PHAVU_003G263800g             245   4e-71    
ref|XP_006401399.1|  hypothetical protein EUTSA_v10012759mg             245   4e-71    
ref|XP_012066014.1|  PREDICTED: oligopeptide transporter 7-like         245   4e-71    
gb|KCW77331.1|  hypothetical protein EUGRSUZ_D01692                     244   5e-71    
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              244   5e-71    
ref|XP_007208018.1|  hypothetical protein PRUPE_ppa003195mg             241   5e-71    
ref|XP_007039427.1|  Oligopeptide transporter 7 isoform 2               239   6e-71    
gb|AET00810.2|  oligopeptide transporter OPT family protein             244   6e-71    
ref|XP_003617851.1|  Oligopeptide transporter OPT family                244   6e-71    
ref|XP_009132469.1|  PREDICTED: oligopeptide transporter 9-like         244   7e-71    
ref|XP_002530420.1|  Oligopeptide transporter, putative                 243   8e-71    
ref|NP_200404.1|  oligopeptide transporter 1                            244   8e-71    
ref|XP_007039134.1|  Oligopeptide transporter 1 isoform 3               240   8e-71    
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    244   9e-71    
emb|CAH67988.1|  OSIGBa0142I02-OSIGBa0101B20.31                         244   9e-71    
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    244   9e-71    
ref|XP_012074813.1|  PREDICTED: oligopeptide transporter 1-like         244   9e-71    
ref|XP_010053083.1|  PREDICTED: oligopeptide transporter 7              244   9e-71    
ref|XP_008239235.1|  PREDICTED: oligopeptide transporter 7-like         244   1e-70    
emb|CAE04152.1|  OSJNBa0009P12.37                                       244   1e-70    
ref|XP_010040072.1|  PREDICTED: oligopeptide transporter 7-like         244   1e-70    
ref|XP_011075935.1|  PREDICTED: oligopeptide transporter 6              243   1e-70    
ref|NP_001053729.2|  Os04g0594800                                       244   1e-70    
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7              244   1e-70    
ref|XP_004976663.1|  PREDICTED: oligopeptide transporter 4-like         243   1e-70    
ref|XP_006452633.1|  hypothetical protein CICLE_v10007763mg             241   1e-70    
gb|KCW76553.1|  hypothetical protein EUGRSUZ_D00943                     240   1e-70    
ref|XP_010109222.1|  Oligopeptide transporter 6                         244   1e-70    
ref|XP_007039133.1|  Oligopeptide transporter 1 isoform 2               241   2e-70    
ref|XP_012086643.1|  PREDICTED: oligopeptide transporter 7              243   2e-70    
ref|XP_008449039.1|  PREDICTED: oligopeptide transporter 5-like         243   2e-70    
ref|XP_008366120.1|  PREDICTED: oligopeptide transporter 1-like         242   2e-70    
ref|XP_007162247.1|  hypothetical protein PHAVU_001G136300g             241   2e-70    
emb|CAN76256.1|  hypothetical protein VITISV_023414                     233   2e-70    
ref|XP_006413037.1|  hypothetical protein EUTSA_v10024519mg             239   2e-70    
ref|XP_008437437.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    243   3e-70    



>ref|XP_003635158.1| PREDICTED: oligopeptide transporter 3-like [Vitis vinifera]
Length=283

 Score =   390 bits (1002),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDAS
Sbjct  68   KIPPRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDAS  127

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGF
Sbjct  128  VIWGLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGF  187

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  188  AGMPPATPTNIASWLITGAIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  247

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE+  LKWWG++LDHCPLA+CPT PGIVVEGCPVF+
Sbjct  248  NENHNLKWWGTKLDHCPLATCPTQPGIVVEGCPVFQ  283



>ref|XP_009773627.1| PREDICTED: oligopeptide transporter 3 [Nicotiana sylvestris]
Length=751

 Score =   402 bits (1032),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 192/216 (89%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G VNLAV WWMLGSIENICD +AL P+SPWTCPKFRVTFDAS
Sbjct  536  KIPPRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVEALHPDSPWTCPKFRVTFDAS  595

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  596  VIWGLIGPQRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGF  655

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVFKYRK WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  656  AGMPPATPTNIASWLITGMIFNYFVFKYRKEWWQKYNYVLSAALDAGTAFMGVLLFFALQ  715

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE K LKWWG+ELDHCPLA+CPTAPGIVV GCPVFK
Sbjct  716  NEGKNLKWWGTELDHCPLATCPTAPGIVVAGCPVFK  751



>emb|CDP04526.1| unnamed protein product [Coffea canephora]
Length=755

 Score =   402 bits (1032),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLVSG VNLAV WWMLGSIEN+CD +AL P SPWTCPKFRVTFDAS
Sbjct  540  KIPPRCMYTAQLVGTLVSGTVNLAVAWWMLGSIENLCDVEALHPESPWTCPKFRVTFDAS  599

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLF+IGAVLPVPVW+LSKMFP++KWIPLINIPVISYGF
Sbjct  600  VIWGLIGPERLFGPGGLYRNLVWLFIIGAVLPVPVWMLSKMFPDQKWIPLINIPVISYGF  659

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SWI+TG+IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  660  AGMPPATPTNIASWIITGMIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQ  719

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE K +KWWG+E DHCPLASCPTAPGIVVEGCP+FK
Sbjct  720  NEGKNIKWWGAEPDHCPLASCPTAPGIVVEGCPLFK  755



>ref|XP_006352325.1| PREDICTED: oligopeptide transporter 3-like [Solanum tuberosum]
Length=752

 Score =   400 bits (1028),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G +NLAV WWMLGSI+NICD +AL P+SPWTCPKFRVTFDAS
Sbjct  537  KIPPRCMYTAQLVGTLVAGTINLAVAWWMLGSIDNICDVEALHPDSPWTCPKFRVTFDAS  596

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGA+LPVP+WVLSKMFPEKKWIPLINIPVISYGF
Sbjct  597  VIWGLIGPERLFGPGGLYRNLVWLFLIGALLPVPIWVLSKMFPEKKWIPLINIPVISYGF  656

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVFKYRK WW+KYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  657  AGMPPATPTNIASWLITGMIFNYFVFKYRKEWWKKYNYVLSAALDAGTAFMGVLLFFALQ  716

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE K LKWWG+ELDHCPLA+CPTAPGI+V+GCPVFK
Sbjct  717  NEGKNLKWWGTELDHCPLATCPTAPGIIVQGCPVFK  752



>emb|CBI18636.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   382 bits (982),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDAS
Sbjct  2    KIPPRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDAS  61

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGF
Sbjct  62   VIWGLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGF  121

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  122  AGMPPATPTNIASWLITGAIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  181

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
            NE+  LKWWG++LDHCPLA+CPT PGIVVEGCP
Sbjct  182  NENHNLKWWGTKLDHCPLATCPTQPGIVVEGCP  214



>ref|XP_004250295.1| PREDICTED: oligopeptide transporter 3 [Solanum lycopersicum]
Length=755

 Score =   399 bits (1025),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G +NLAV WWMLGSI+NICD +AL P+SPWTCPKFRVTFDAS
Sbjct  540  KIPPRCMYTAQLVGTLVAGTINLAVAWWMLGSIDNICDVEALHPDSPWTCPKFRVTFDAS  599

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGA+LPVP+WVLSKMFPEKKWIPLINIPVISYGF
Sbjct  600  VIWGLIGPERLFGPGGLYRNLVWLFLIGALLPVPIWVLSKMFPEKKWIPLINIPVISYGF  659

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVFKYRK WW+KYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  660  AGMPPATPTNIASWLITGMIFNYFVFKYRKEWWKKYNYVLSAALDAGTAFMGVLLFFALQ  719

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE K LKWWG+ELDHCPLA+CPTAPGI+V+GCPVF 
Sbjct  720  NEGKNLKWWGTELDHCPLATCPTAPGIIVQGCPVFN  755



>ref|XP_009590288.1| PREDICTED: oligopeptide transporter 3 [Nicotiana tomentosiformis]
Length=751

 Score =   396 bits (1017),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDAS
Sbjct  536  KIPPRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDAS  595

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFG GGLYRNLVWLFLIGAVLPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  596  VIWGLIGPERLFGSGGLYRNLVWLFLIGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGF  655

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVFKYRK WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  656  AGMPPATPTNIASWLITGMIFNYFVFKYRKEWWQKYNYVLSAALDAGTAFMGVLLFFALQ  715

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE K LKWWG++LDHCPLA+CPTAPGIVV GCPVFK
Sbjct  716  NEGKNLKWWGTQLDHCPLATCPTAPGIVVAGCPVFK  751



>ref|XP_002273768.2| PREDICTED: oligopeptide transporter 3 [Vitis vinifera]
Length=748

 Score =   394 bits (1011),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDAS
Sbjct  533  KIPPRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDAS  592

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGF
Sbjct  593  VIWGLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGF  652

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  653  AGMPPATPTNIASWLITGAIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  712

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE+  LKWWG++LDHCPLA+CPT PGIVVEGCPVF+
Sbjct  713  NENHNLKWWGTKLDHCPLATCPTQPGIVVEGCPVFQ  748



>ref|XP_011095913.1| PREDICTED: oligopeptide transporter 3 [Sesamum indicum]
Length=740

 Score =   394 bits (1011),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 197/216 (91%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLVSG VNLAV WWMLGSIENICD +AL P SPWTCPKFRVTFDAS
Sbjct  525  KIPPRCMYTAQLVGTLVSGTVNLAVAWWMLGSIENICDVEALHPESPWTCPKFRVTFDAS  584

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVW+LSK+FP+KKWIPLINIPVISYGF
Sbjct  585  VIWGLIGPERLFGPGGLYRNLVWLFLIGAVLPVPVWILSKIFPDKKWIPLINIPVISYGF  644

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SWI+TG IFNYFVFKYRK WWQ+YNYVLSAALDAGTAFM VLLFFALQ
Sbjct  645  AGMPPATPTNIASWIITGTIFNYFVFKYRKTWWQRYNYVLSAALDAGTAFMGVLLFFALQ  704

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE K + WWGS+ DHCPLASCPTAPGI VEGCP F+
Sbjct  705  NEGKNVNWWGSKPDHCPLASCPTAPGIAVEGCPFFR  740



>gb|KDO78547.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=441

 Score =   384 bits (985),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+VSGVVNL V WWML SIENICD ++L P+S WTCPK+RVTFDAS
Sbjct  226  KIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDAS  285

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  286  VIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGF  345

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  346  AGMPPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  405

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N    LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  406  NNDINLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  441



>emb|CBI18634.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   392 bits (1006),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 186/220 (85%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDAS
Sbjct  533  KIPPRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDAS  592

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGF
Sbjct  593  VIWGLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGF  652

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  653  AGMPPATPTNIASWLITGAIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  712

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK*ASS  242
            NE+  LKWWG++LDHCPLA+CPT PGIVVEGCPV    SS
Sbjct  713  NENHNLKWWGTKLDHCPLATCPTQPGIVVEGCPVSSGKSS  752



>ref|XP_002522882.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF39482.1| Oligopeptide transporter, putative [Ricinus communis]
Length=734

 Score =   391 bits (1004),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MYVAQLVGTL++G VNLAV WWML ++ENICD +AL P SPWTCPK+RVTFDAS
Sbjct  519  KIPPRCMYVAQLVGTLIAGTVNLAVAWWMLENVENICDIEALHPESPWTCPKYRVTFDAS  578

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGA LPVP+W+LSKMFPEKKWIPLINIPVISYGF
Sbjct  579  VIWGLIGPRRLFGPGGLYRNLVWLFLIGAFLPVPIWILSKMFPEKKWIPLINIPVISYGF  638

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  639  AGMPPATPTNIASWLVTGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  698

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            NE K LKWWG+E+DHCPLA+CPTAPGI VEGCPVF
Sbjct  699  NEGKTLKWWGTEIDHCPLATCPTAPGITVEGCPVF  733



>ref|XP_012074788.1| PREDICTED: oligopeptide transporter 3 [Jatropha curcas]
 gb|KDP35505.1| hypothetical protein JCGZ_08943 [Jatropha curcas]
Length=743

 Score =   391 bits (1004),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSMY AQLVGT V+G +NLAV WWML +IENICD DAL P SPWTCPK+RVTFDAS
Sbjct  528  KIPPRSMYAAQLVGTFVAGTLNLAVAWWMLENIENICDVDALHPESPWTCPKYRVTFDAS  587

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGA LPVP+W+LSKM+PEKKWIPLINIPVISYGF
Sbjct  588  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAFLPVPIWILSKMYPEKKWIPLINIPVISYGF  647

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  648  AGMPPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  707

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            NE K LKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  708  NEGKNLKWWGTEIDHCPLASCPTAPGIEVKGCPVF  742



>gb|ABF98906.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95541.1| unnamed protein product [Oryza sativa Japonica Group]
Length=528

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDAS
Sbjct  314  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDAS  373

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGF
Sbjct  374  VIWGLIGPARLFGRHGLYRNLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGF  433

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  434  AGMPPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  493

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H ELKWWG+ +DHCPLASCPTAPGI V+GCPVF
Sbjct  494  NAHHELKWWGTAVDHCPLASCPTAPGIAVKGCPVF  528



>gb|KDO78546.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=527

 Score =   383 bits (983),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+VSGVVNL V WWML SIENICD ++L P+S WTCPK+RVTFDAS
Sbjct  312  KIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDAS  371

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  372  VIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGF  431

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  432  AGMPPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  491

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N    LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  492  NNDINLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  527



>ref|XP_010270227.1| PREDICTED: oligopeptide transporter 3 [Nelumbo nucifera]
Length=746

 Score =   389 bits (1000),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR M+ AQLVGT+++G VNLAV WWMLGSI+NICD +AL P+SPWTCPKFRVTFDAS
Sbjct  531  KIPPRCMFTAQLVGTIIAGTVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKFRVTFDAS  590

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVW+LSKMFPEKKWIPLINIPVISYGF
Sbjct  591  VIWGLIGPERLFGPGGLYRNLVWLFLIGAVLPVPVWILSKMFPEKKWIPLINIPVISYGF  650

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+ TG IFNYFVF+YRK WWQ+YNYVLSAALDAGTAFM VLLFFALQ
Sbjct  651  AGMPPATPTNIASWLATGTIFNYFVFRYRKRWWQRYNYVLSAALDAGTAFMGVLLFFALQ  710

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE + LKWWG++ DHCPLA+CPT PGI V+GCPVFK
Sbjct  711  NEGRNLKWWGTKYDHCPLATCPTEPGIAVKGCPVFK  746



>ref|XP_009380132.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=740

 Score =   389 bits (1000),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SIENICD ++L P+SPWTCPK+RVTFDAS
Sbjct  526  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIENICDVESLHPDSPWTCPKYRVTFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG GGLYRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  586  VIWGLIGPGRLFGHGGLYRNLVWLFLVGAVLPVPVWVLSKIFPEKKWIPLINIPVISYGF  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  646  AGMPPATPTNIASWLITGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQ  705

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N+   LKWWG+ELDHCPLASCPTAPGI VEGCPVF
Sbjct  706  NQDHNLKWWGTELDHCPLASCPTAPGISVEGCPVF  740



>ref|XP_007026362.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
 gb|EOY28984.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
Length=739

 Score =   389 bits (998),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G VNLAV WWML SI+NICD +   P SPWTCPK+RVTFDAS
Sbjct  524  KIPPRCMYTAQLVGTLVAGTVNLAVAWWMLDSIDNICDVEGKHPESPWTCPKYRVTFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  584  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKIFPEKKWIPLINIPVISYGF  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  644  AGMPPATPTNIASWLITGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE   +KWWG+E+DHCPLASCPTAPGI VEGCPVFK
Sbjct  704  NEGHNVKWWGTEVDHCPLASCPTAPGITVEGCPVFK  739



>gb|ADW66457.1| oligopeptide transporter [Phytolacca americana]
Length=733

 Score =   388 bits (997),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLVSGVVNLAV WWML SI+N+CD ++L+PNSPWTCPKFRVTFDAS
Sbjct  519  KIPPRCMYTAQLVGTLVSGVVNLAVAWWMLASIDNLCDVESLNPNSPWTCPKFRVTFDAS  578

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVW+L K++PEKKWIPLINIPVISYGF
Sbjct  579  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWILHKIYPEKKWIPLINIPVISYGF  638

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVFKYRK WW+KYNYVLSAALDAGTAFMAV +FFALQ
Sbjct  639  AGMPPATPTNIASWLVTGTIFNYFVFKYRKEWWKKYNYVLSAALDAGTAFMAVFIFFALQ  698

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
            NE  +LKWWG+++DHCPLASCPTAPGIVV+GCP
Sbjct  699  NEKIDLKWWGTDIDHCPLASCPTAPGIVVQGCP  731



>gb|ABF70152.1| oligopeptide transporter OPT family protein [Musa acuminata]
Length=748

 Score =   389 bits (998),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+VSGVVNLAV WWMLGSIENICD DAL P SPWTCPK+RVTFDAS
Sbjct  534  KIPPRCMYTAQLVGTVVSGVVNLAVAWWMLGSIENICDVDALHPESPWTCPKYRVTFDAS  593

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP RLFG GGLYRNLVWLFL+GA LPVPVW LSK+FPEKKWIPLINIPVISYGF
Sbjct  594  VIWGLVGPGRLFGHGGLYRNLVWLFLVGAALPVPVWALSKIFPEKKWIPLINIPVISYGF  653

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  654  AGMPPATPTNIASWLITGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQ  713

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N +  L+WWG+ELDHCPLASCPT PGI V+GCPVF
Sbjct  714  NANHNLRWWGTELDHCPLASCPTEPGISVKGCPVF  748



>ref|XP_009397220.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=748

 Score =   389 bits (998),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+VSGVVNLAV WWMLGSIENICD DAL P SPWTCPK+RVTFDAS
Sbjct  534  KIPPRCMYTAQLVGTVVSGVVNLAVAWWMLGSIENICDVDALHPESPWTCPKYRVTFDAS  593

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP RLFG GGLYRNLVWLFL+GA LPVPVW LSK+FPEKKWIPLINIPVISYGF
Sbjct  594  VIWGLVGPGRLFGHGGLYRNLVWLFLVGAALPVPVWALSKIFPEKKWIPLINIPVISYGF  653

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  654  AGMPPATPTNIASWLITGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQ  713

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N +  L+WWG+ELDHCPLASCPT PGI V+GCPVF
Sbjct  714  NANHNLRWWGTELDHCPLASCPTEPGISVKGCPVF  748



>ref|XP_010039442.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW45989.1| hypothetical protein EUGRSUZ_L00157 [Eucalyptus grandis]
Length=745

 Score =   388 bits (997),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLVSGVVNLAV WWML  IENICD +AL P+SPWTCPK+RVTFDAS
Sbjct  530  KIPPRCMYTAQLVGTLVSGVVNLAVAWWMLDGIENICDVEALHPDSPWTCPKYRVTFDAS  589

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNL+WLFLIGAVLPVP+W LSKMFPEKKWI LINIPVISYGF
Sbjct  590  VIWGLIGPRRLFGPGGLYRNLIWLFLIGAVLPVPIWALSKMFPEKKWIALINIPVISYGF  649

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+YRK WWQKYNY+LSAALDAGTAFM VLLFFALQ
Sbjct  650  AGMPPATPTNIASWLITGTIFNYFVFRYRKRWWQKYNYILSAALDAGTAFMGVLLFFALQ  709

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE+K LKWWG+++DHCPLASCPTAPGI V  CPVF 
Sbjct  710  NENKNLKWWGTDIDHCPLASCPTAPGISVPNCPVFN  745



>ref|XP_011002374.1| PREDICTED: oligopeptide transporter 3-like [Populus euphratica]
Length=744

 Score =   388 bits (996),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/215 (86%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MYVAQLVGT V+G VNLAV WWML +IENICDTD L  NSPWTCPK+RVTFDAS
Sbjct  530  KIPPRCMYVAQLVGTFVAGTVNLAVAWWMLENIENICDTDVLDSNSPWTCPKYRVTFDAS  589

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGP GLYRNLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGF
Sbjct  590  VIWGLIGPRRLFGPDGLYRNLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGF  649

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+Q
Sbjct  650  AGMPPATPTNIASWLVTGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQ  709

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N  K+LKWWG+ELDHCPLASCPTAPGIVV+GCPVF
Sbjct  710  NSGKQLKWWGTELDHCPLASCPTAPGIVVKGCPVF  744



>ref|XP_002463868.1| hypothetical protein SORBIDRAFT_01g007900 [Sorghum bicolor]
 gb|EER90866.1| hypothetical protein SORBIDRAFT_01g007900 [Sorghum bicolor]
Length=349

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQL+GT+V+GVVNLAV WWML +I+NICD +AL P+SPWTCPK+RVTFDAS
Sbjct  135  KIPPRCMYTAQLIGTVVAGVVNLAVAWWMLDNIDNICDVEALHPDSPWTCPKYRVTFDAS  194

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGF
Sbjct  195  VIWGLIGPGRLFGRHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGF  254

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI +W+VTG IFN+FVF+YRK WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  255  AGMPPATPTNIATWLVTGTIFNFFVFRYRKAWWQKYNYVLSAALDAGTAFMGVLIFFALQ  314

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H +LKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  315  NAHHDLKWWGTEVDHCPLASCPTAPGIAVKGCPVF  349



>gb|EYU27660.1| hypothetical protein MIMGU_mgv1a001879mg [Erythranthe guttata]
Length=745

 Score =   387 bits (994),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+ M+ AQLVGT VSG VNLAV WWMLGSIENICD +AL P SPWTCPKFRVTFDAS
Sbjct  530  KIPPKCMFTAQLVGTFVSGTVNLAVAWWMLGSIENICDVEALHPESPWTCPKFRVTFDAS  589

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGA LPVPVWVLSK++PEKKWIPLINIPVISYGF
Sbjct  590  VIWGLIGPERLFGPGGMYRNLVWLFLIGAFLPVPVWVLSKIYPEKKWIPLINIPVISYGF  649

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SWI+TG +FNYFVFKYRK WWQ+YNYVLSAALDAGTAFM VLLFFALQ
Sbjct  650  AGMPPATPTNIASWIITGTVFNYFVFKYRKTWWQRYNYVLSAALDAGTAFMGVLLFFALQ  709

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE   +KWWGS+ DHCPLASCPTAPGIVV+GCPVF 
Sbjct  710  NEGVNVKWWGSQPDHCPLASCPTAPGIVVQGCPVFS  745



>ref|XP_002308764.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEE92287.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=744

 Score =   387 bits (994),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MYVAQLVGT V+G +NLAV WWML +IENICDTD L  +SPWTCPK+RVTFDAS
Sbjct  530  KIPPRCMYVAQLVGTFVAGTLNLAVAWWMLENIENICDTDVLDSSSPWTCPKYRVTFDAS  589

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGF
Sbjct  590  VIWGLIGPRRLFGPGGLYRNLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGF  649

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+Q
Sbjct  650  AGMPPATPTNIASWLVTGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQ  709

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N  KELKWWG+E+DHCPLASCPTAPGIVV+GCPVF
Sbjct  710  NSGKELKWWGTEVDHCPLASCPTAPGIVVKGCPVF  744



>ref|XP_010907563.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=735

 Score =   386 bits (992),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+G++NLAV WWML SIENICD +AL P+SPWTCPK+RVTFDAS
Sbjct  521  KIPPRCMYTAQLVGTVVAGIMNLAVAWWMLESIENICDVEALHPDSPWTCPKYRVTFDAS  580

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG GGLYRNLVWLFLIGA LPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  581  VIWGLIGPGRLFGHGGLYRNLVWLFLIGAFLPVPVWVLSKIFPEKKWIPLINIPVISYGF  640

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  641  AGMPPATPTNIASWLITGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQ  700

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            NE++ L WWG+ELDHCPLASCPT PGI V+GCPVF
Sbjct  701  NENRNLSWWGTELDHCPLASCPTEPGISVKGCPVF  735



>ref|XP_002323123.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEF04884.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=661

 Score =   384 bits (985),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MYVAQLVGTLV+G VNLAV WWML +IENICD D+   NSPWTCPK+RVTFDAS
Sbjct  447  KIPPRCMYVAQLVGTLVAGTVNLAVAWWMLENIENICDVDSQDSNSPWTCPKYRVTFDAS  506

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGF
Sbjct  507  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGF  566

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPP+TPTNI SW++TG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+Q
Sbjct  567  AGMPPSTPTNIASWLITGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQ  626

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N  K+L WWG+ELDHCPLA+CPTAPGIVV+GCPVF
Sbjct  627  NTDKKLSWWGAELDHCPLATCPTAPGIVVKGCPVF  661



>ref|XP_011040169.1| PREDICTED: oligopeptide transporter 3 [Populus euphratica]
Length=743

 Score =   386 bits (991),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MYVAQLVGTLV+G VNLAV WWML +IENICD D+   NSPWTCPK+RVTFDAS
Sbjct  529  KIPPRCMYVAQLVGTLVAGTVNLAVAWWMLENIENICDVDSQDSNSPWTCPKYRVTFDAS  588

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGF
Sbjct  589  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGF  648

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+Q
Sbjct  649  AGMPPATPTNIASWLITGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQ  708

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N  K+L WWG+ELDHCPLA+CPTAPGIVV+GCPVF
Sbjct  709  NTDKKLSWWGAELDHCPLATCPTAPGIVVKGCPVF  743



>ref|XP_006449924.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
 gb|ESR63164.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
Length=739

 Score =   385 bits (989),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLVSGVVNL V WWML S+ENICD ++L P+S WTCPK+RVTFDAS
Sbjct  524  KIPPRCMYTAQLVGTLVSGVVNLGVAWWMLESVENICDVESLHPDSQWTCPKYRVTFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  584  VIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGF  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  644  AGMPPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N    LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  704  NNDINLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  739



>ref|XP_006467278.1| PREDICTED: oligopeptide transporter 3-like [Citrus sinensis]
Length=739

 Score =   385 bits (988),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+VSGVVNL V WWML SIENICD ++L P+S WTCPK+RVTFDAS
Sbjct  524  KIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  584  VIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGF  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  644  AGMPPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N    LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  704  NNDINLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  739



>ref|XP_010686627.1| PREDICTED: oligopeptide transporter 3 [Beta vulgaris subsp. vulgaris]
Length=741

 Score =   385 bits (988),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+GVVNLAV WWML +I+N+CD ++L+PNSPWTCPKFRVTFDAS
Sbjct  527  KIPPRCMYTAQLVGTLVAGVVNLAVAWWMLATIDNLCDVESLNPNSPWTCPKFRVTFDAS  586

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG GGLYRNLVWLFLIGAVLPVPVWVL KMFP+ KWIPLINIPVISYGF
Sbjct  587  VIWGLIGPNRLFGSGGLYRNLVWLFLIGAVLPVPVWVLHKMFPKNKWIPLINIPVISYGF  646

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVFKYRK WW++YNYVLSAALDAGTAFMAVL+FFALQ
Sbjct  647  AGMPPATPTNIASWLVTGTIFNYFVFKYRKEWWKRYNYVLSAALDAGTAFMAVLIFFALQ  706

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
            NE+KELKWWG+++DHCPLASCPTAPGI+VE CP+
Sbjct  707  NENKELKWWGTDIDHCPLASCPTAPGIMVEKCPL  740



>gb|AAO32313.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
Length=726

 Score =   384 bits (987),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDAS
Sbjct  512  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDAS  571

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGF
Sbjct  572  VIWGLIGPARLFGRHGLYRNLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGF  631

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  632  AGMPPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  691

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H ELKWWG+ +DHCPLASCPTAPGI V+GCPVF
Sbjct  692  NAHHELKWWGTAVDHCPLASCPTAPGIAVKGCPVF  726



>gb|KDO78542.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=739

 Score =   384 bits (987),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+VSGVVNL V WWML SIENICD ++L P+S WTCPK+RVTFDAS
Sbjct  524  KIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  584  VIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGF  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  644  AGMPPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N    LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  704  NNDINLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  739



>ref|XP_004981750.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3-like 
[Setaria italica]
Length=750

 Score =   385 bits (988),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDAS
Sbjct  536  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDAS  595

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLF++GAVLPVPVW+LS+ FPEKKWI LINIPVISYGF
Sbjct  596  VIWGLIGPGRLFGRHGLYRNLVWLFVVGAVLPVPVWLLSRAFPEKKWIALINIPVISYGF  655

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI +W+VTG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  656  AGMPPATPTNIATWLVTGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  715

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H ELKWWG+E+DHCPLASCPTAPGIVV+GCPVF
Sbjct  716  NAHHELKWWGTEVDHCPLASCPTAPGIVVKGCPVF  750



>ref|NP_001292781.1| oligopeptide transporter 3 [Zea mays]
 tpg|DAA51401.1| TPA: glutathione transporter [Zea mays]
Length=748

 Score =   384 bits (987),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDAS
Sbjct  534  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDAS  593

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGF
Sbjct  594  VIWGLIGPGRLFGQHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGF  653

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI +W+VTG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  654  AGMPPATPTNIATWLVTGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  713

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H ELKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  714  NAHHELKWWGTEVDHCPLASCPTAPGIAVKGCPVF  748



>gb|ACL82964.1| glutathione transporter [Zea mays]
Length=746

 Score =   384 bits (987),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDAS
Sbjct  532  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDAS  591

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGF
Sbjct  592  VIWGLIGPGRLFGQHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGF  651

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI +W+VTG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  652  AGMPPATPTNIATWLVTGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  711

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H ELKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  712  NAHHELKWWGTEVDHCPLASCPTAPGIAVKGCPVF  746



>ref|NP_001051290.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|AAR87263.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
 gb|ABF98905.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13204.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|EEC76189.1| hypothetical protein OsI_13528 [Oryza sativa Indica Group]
 gb|EEE59939.1| hypothetical protein OsJ_12589 [Oryza sativa Japonica Group]
Length=757

 Score =   384 bits (987),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDAS
Sbjct  543  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDAS  602

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGF
Sbjct  603  VIWGLIGPARLFGRHGLYRNLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGF  662

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  663  AGMPPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  722

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H ELKWWG+ +DHCPLASCPTAPGI V+GCPVF
Sbjct  723  NAHHELKWWGTAVDHCPLASCPTAPGIAVKGCPVF  757



>ref|XP_007211357.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
 gb|EMJ12556.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
Length=733

 Score =   383 bits (984),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G+VNLAV WWML SI+N+CD DAL PNSPWTCPK+RVTFDAS
Sbjct  519  KIPPRCMYTAQLVGTLVAGIVNLAVAWWMLESIDNLCDIDALHPNSPWTCPKYRVTFDAS  578

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLF++GA LPVP+W+LSK+FP+KKWIPLIN+PVI+YGF
Sbjct  579  VIWGLIGPKRLFGPGGLYRNLVWLFIVGAFLPVPIWILSKIFPDKKWIPLINMPVITYGF  638

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  639  AGMPPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  698

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N +  +KWWG+ELDHCPLA+CPTAPGI VEGCPVF
Sbjct  699  NNNYNVKWWGTELDHCPLATCPTAPGIKVEGCPVF  733



>gb|KHN42268.1| Oligopeptide transporter 3 [Glycine soja]
Length=698

 Score =   382 bits (980),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D L  +SPWTCPK+RVTFDAS
Sbjct  483  KIPPRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKLHHDSPWTCPKYRVTFDAS  542

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGF
Sbjct  543  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGF  602

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATP NI SW+VTG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  603  AGMPPATPANIASWLVTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQ  662

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N    LKWWGSELDHCPLA+CPTAPGI VEGCPVFK
Sbjct  663  NAGHNLKWWGSELDHCPLATCPTAPGIEVEGCPVFK  698



>gb|KHG20373.1| Oligopeptide transporter 3 -like protein [Gossypium arboreum]
Length=741

 Score =   383 bits (983),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+G+VNL V WWML  I+NICD +   P+SPWTCPK+RVTFDAS
Sbjct  526  KIPPRCMYTAQLVGTVVAGIVNLGVAWWMLDDIDNICDVEGNHPDSPWTCPKYRVTFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGA LPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  586  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAFLPVPVWVLSKIFPEKKWIPLINIPVISYGF  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  646  AGMPPATPTNIASWLITGTIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  705

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE   LKWWG+E+DHCPLA+CPTAPGI VEGCPVFK
Sbjct  706  NEGHNLKWWGTEVDHCPLATCPTAPGISVEGCPVFK  741



>ref|XP_003529676.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=742

 Score =   382 bits (981),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D L  +SPWTCPK+RVTFDAS
Sbjct  527  KIPPRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKLHHDSPWTCPKYRVTFDAS  586

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGF
Sbjct  587  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGF  646

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATP NI SW+VTG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  647  AGMPPATPANIASWLVTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQ  706

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N    LKWWGSELDHCPLA+CPTAPGI VEGCPVFK
Sbjct  707  NAGHNLKWWGSELDHCPLATCPTAPGIEVEGCPVFK  742



>gb|AAQ91200.1| putative glutathione transporter [Zea mays]
Length=721

 Score =   381 bits (979),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDAS
Sbjct  507  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDAS  566

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGF
Sbjct  567  VIWGLIGPGRLFGQHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGF  626

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI +W+VTG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  627  AGMPPATPTNIATWLVTGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  686

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H ELKWWG+E+DHCPLASCP APGI V+GCPVF
Sbjct  687  NAHHELKWWGTEVDHCPLASCPPAPGIAVKGCPVF  721



>dbj|BAK07444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=745

 Score =   381 bits (978),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWML SIENICD +AL P+SPWTCPK+RVTFDAS
Sbjct  531  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLDSIENICDVEALHPDSPWTCPKYRVTFDAS  590

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLF++GAVLPVPVW+LS+ FPEKKWI L+N+PVISYGF
Sbjct  591  VIWGLIGPGRLFGQHGLYRNLVWLFVVGAVLPVPVWLLSRAFPEKKWIALVNVPVISYGF  650

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG +FN+FVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  651  AGMPPATPTNIASWLVTGTVFNFFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  710

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H +LKWWG+E+DHCPLA+CPTAPGIVV+GCPVF
Sbjct  711  NAHHDLKWWGTEVDHCPLATCPTAPGIVVKGCPVF  745



>gb|EMT33592.1| Oligopeptide transporter 3 [Aegilops tauschii]
Length=750

 Score =   380 bits (977),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWML SI+NICD +AL P+SPWTCPK+RVTFDAS
Sbjct  536  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLDSIDNICDVEALHPDSPWTCPKYRVTFDAS  595

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLF++GAVLPVPVW+LS+ FPEKKWI L+N+PVISYGF
Sbjct  596  VIWGLIGPGRLFGQHGLYRNLVWLFVVGAVLPVPVWLLSRAFPEKKWIALVNVPVISYGF  655

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG +FN+FVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  656  AGMPPATPTNIASWLVTGTVFNFFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  715

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H +LKWWG+E+DHCPLA+CPTAPGIVV+GCPVF
Sbjct  716  NAHHDLKWWGTEVDHCPLATCPTAPGIVVKGCPVF  750



>ref|XP_003549274.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=741

 Score =   380 bits (976),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D +  +SPWTCPK+RVTFDAS
Sbjct  526  KIPPRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKVHHDSPWTCPKYRVTFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGF
Sbjct  586  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGF  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATP NI SW+VTG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  646  AGMPPATPANIASWLVTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQ  705

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N    LKWWGSELDHCPLA+CPTAPGI V+GCPVFK
Sbjct  706  NAGHNLKWWGSELDHCPLATCPTAPGIEVDGCPVFK  741



>ref|XP_008224626.1| PREDICTED: oligopeptide transporter 3 [Prunus mume]
Length=739

 Score =   379 bits (974),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G+VNLAV WWML SI+N+CD DA  PNSPWTCPK++VTFDAS
Sbjct  525  KIPPRCMYTAQLVGTLVAGIVNLAVAWWMLESIDNLCDIDAHHPNSPWTCPKYKVTFDAS  584

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLF++GA LPVP+W+LSK+FP+KKWIPLIN+PVI+YGF
Sbjct  585  VIWGLIGPRRLFGPGGLYRNLVWLFIVGAFLPVPIWILSKIFPDKKWIPLINMPVITYGF  644

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  645  AGMPPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  704

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N +  +KWWG+ELDHCPLA+CPTAPGI VEGCPVF
Sbjct  705  NNNYNVKWWGTELDHCPLATCPTAPGIKVEGCPVF  739



>gb|KHN03544.1| Oligopeptide transporter 3 [Glycine soja]
Length=725

 Score =   379 bits (973),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D +  +SPWTCPK+RVTFDAS
Sbjct  510  KIPPRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKVHHDSPWTCPKYRVTFDAS  569

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGF
Sbjct  570  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGF  629

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATP NI SW+VTG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  630  AGMPPATPANIASWLVTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQ  689

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N    LKWWGSELDHCPLA+CPTAPGI V+GCPVFK
Sbjct  690  NAGHNLKWWGSELDHCPLATCPTAPGIEVDGCPVFK  725



>gb|KJB67417.1| hypothetical protein B456_010G190300 [Gossypium raimondii]
Length=741

 Score =   379 bits (973),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+G+VNL V WWML  I+NICD +   P+SPWTCPK+RVTFDAS
Sbjct  526  KIPPRCMYTAQLVGTVVAGIVNLGVAWWMLDDIDNICDVEGNHPDSPWTCPKYRVTFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGA LPVPVWVLSK+FPEKKWIPLINIPVISYGF
Sbjct  586  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAFLPVPVWVLSKIFPEKKWIPLINIPVISYGF  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  646  AGMPPATPTNIASWLITGTIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  705

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            NE   LKWWG+E+DHCPLA+CPTAPGI V+GC VFK
Sbjct  706  NEGHNLKWWGTEVDHCPLATCPTAPGISVDGCRVFK  741



>ref|XP_010057794.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW75109.1| hypothetical protein EUGRSUZ_E03859 [Eucalyptus grandis]
Length=744

 Score =   379 bits (972),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MYVAQLVGT+V+ +VNLAV WWML +I +ICD +   P+SPWTCPK+RVTFDAS
Sbjct  529  KIPPRCMYVAQLVGTVVAALVNLAVAWWMLENINDICDVEGQHPDSPWTCPKYRVTFDAS  588

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWI LINIPVISYGF
Sbjct  589  VIWGLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIALINIPVISYGF  648

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  649  AGMPPATPTNIASWLITGMIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  708

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N ++ LKWWGSELDHCPLASCPT PGIVV+GC VF
Sbjct  709  NNNRNLKWWGSELDHCPLASCPTEPGIVVKGCRVF  743



>ref|XP_006651827.1| PREDICTED: oligopeptide transporter 3-like [Oryza brachyantha]
Length=742

 Score =   379 bits (972),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWMLG+I+NICD +AL P+SPWTCPK+RVTFDAS
Sbjct  528  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLGNIDNICDVEALHPDSPWTCPKYRVTFDAS  587

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWL   GAVLPVPVW+LS+ FPEKKWI L+N+PVISYGF
Sbjct  588  VIWGLIGPARLFGRHGLYRNLVWLGGAGAVLPVPVWLLSRAFPEKKWIALVNVPVISYGF  647

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  648  AGMPPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQ  707

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H ELKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  708  NAHHELKWWGTEVDHCPLASCPTAPGIAVKGCPVF  742



>ref|XP_009374520.1| PREDICTED: oligopeptide transporter 3 [Pyrus x bretschneideri]
Length=749

 Score =   379 bits (972),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLVSG+VNLAV WWML SIENICD ++ +PNSPWTCPK+RVTFDAS
Sbjct  535  KIPPRCMYTAQLVGTLVSGIVNLAVAWWMLESIENICDVESQNPNSPWTCPKYRVTFDAS  594

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFL+GA LPVP+WV+SK+FP+KKWIPLIN+PVI YGF
Sbjct  595  VIWGLIGPRRLFGPGGLYRNLVWLFLVGAFLPVPIWVMSKIFPDKKWIPLINMPVILYGF  654

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  655  AGMPPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  714

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   ELKWWG++LDHCPLA+CP APGI V+GCPVF
Sbjct  715  NPKHELKWWGTKLDHCPLATCPIAPGIHVDGCPVF  749



>ref|XP_008780991.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=735

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+G++NLAV WWML SI+NICD +AL P+SPWTCPK+RVTFDAS
Sbjct  521  KIPPRCMYTAQLVGTVVAGIMNLAVAWWMLESIDNICDFEALHPDSPWTCPKYRVTFDAS  580

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG GGLYRNLVWLFLIGA LPVPVWVLSK+FPEK+WIPLINIPVISYGF
Sbjct  581  VIWGLIGPSRLFGHGGLYRNLVWLFLIGAFLPVPVWVLSKIFPEKEWIPLINIPVISYGF  640

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFF LQ
Sbjct  641  AGMPPATPTNIASWLITGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFVLQ  700

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            NE++ L WWG++LDHCPLASCPT PGI V+GCPVF
Sbjct  701  NENRNLSWWGTDLDHCPLASCPTEPGISVKGCPVF  735



>ref|XP_009404107.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   377 bits (968),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQL GT+V+GV+NL+V WWML +IENICD D+L P+SPWTCPK+RVTFDAS
Sbjct  524  KIPPRCMYTAQLAGTVVAGVLNLSVAWWMLENIENICDVDSLHPDSPWTCPKYRVTFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLI P RLFG GGLYRNLVWLFL+GAVLPVPVWVLSK+FPEKKWI LIN+PVI+YGF
Sbjct  584  VIWGLIAPGRLFGHGGLYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWISLINVPVITYGF  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+YRK WWQ+YNYVLSAALDAGTAFM VLLFFALQ
Sbjct  644  AGMPPATPTNIASWLITGTIFNYFVFRYRKVWWQRYNYVLSAALDAGTAFMGVLLFFALQ  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N+H  L WWGSELDHCPLASCPTAPGI V+GCPVF
Sbjct  704  NQHHNLHWWGSELDHCPLASCPTAPGISVKGCPVF  738



>ref|XP_007154044.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
 gb|ESW26038.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
Length=741

 Score =   377 bits (968),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D L  +SPWTCPK+RVTFDAS
Sbjct  526  KIPPRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKLHHDSPWTCPKYRVTFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK++PEKKWIPLINIPVISYGF
Sbjct  586  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIYPEKKWIPLINIPVISYGF  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATP NI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  646  AGMPPATPANIASWLLTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQ  705

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N    LKWWGSE+DHCPLA+CPTAPGI V+GCPVF
Sbjct  706  NAGHNLKWWGSEMDHCPLATCPTAPGIEVDGCPVF  740



>ref|XP_002463867.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
 gb|EER90865.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
Length=747

 Score =   377 bits (968),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQL+GT+V+GVVNLAV WWML +I+NICD +AL P+SPWTCPK+RVTFDAS
Sbjct  533  KIPPRCMYTAQLIGTVVAGVVNLAVAWWMLDNIDNICDVEALHPDSPWTCPKYRVTFDAS  592

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGF
Sbjct  593  VIWGLIGPGRLFGRHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGF  652

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI +W+VTG IFN+FVF+YRK WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  653  AGMPPATPTNIATWLVTGTIFNFFVFRYRKAWWQKYNYVLSAALDAGTAFMGVLIFFALQ  712

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N H +LKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  713  NAHHDLKWWGTEVDHCPLASCPTAPGIAVKGCPVF  747



>gb|KFK26550.1| hypothetical protein AALP_AA8G263100 [Arabis alpina]
Length=734

 Score =   376 bits (966),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+G VNL V WWML SI++ICD + + PNSPWTCPK+RVTFDAS
Sbjct  520  KIPPRCMYTAQLVGTVVAGAVNLGVAWWMLESIQDICDIEGVHPNSPWTCPKYRVTFDAS  579

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGF
Sbjct  580  VIWGLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGF  639

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  640  AGMPPATPTNIASWLVTGTIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  699

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI+ +GCPVF
Sbjct  700  NAGHDLKWWGTEVDHCPLASCPTAPGIIAKGCPVF  734



>ref|XP_004295330.1| PREDICTED: oligopeptide transporter 3 [Fragaria vesca subsp. 
vesca]
Length=736

 Score =   376 bits (965),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLVSG+VNLAV WWML  I+NICDTD L P+SPWTCPK+RVTFDAS
Sbjct  522  KIPPRCMYTAQLVGTLVSGIVNLAVAWWMLEGIQNICDTDVLPPDSPWTCPKYRVTFDAS  581

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFL+GA+LPVP++VLSK+FP+KKWIPLIN+PVI YGF
Sbjct  582  VIWGLIGPRRLFGPGGLYRNLVWLFLVGALLPVPIYVLSKIFPDKKWIPLINMPVILYGF  641

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYF+F+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  642  AGMPPATPTNIASWLITGAIFNYFLFRYHKRWWQKYNYVLSAALDAGTAFMGVLIFFALQ  701

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N +  + WWGSELDHCPLASCPTAPGI V+GCPVF
Sbjct  702  NNNILVHWWGSELDHCPLASCPTAPGITVKGCPVF  736



>ref|XP_008464311.1| PREDICTED: oligopeptide transporter 3 [Cucumis melo]
Length=745

 Score =   375 bits (964),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G +NLAV WWML SIENICD DAL   SPWTCPK+RVTFDAS
Sbjct  531  KIPPRCMYTAQLVGTLVAGTINLAVAWWMLDSIENICDDDALHAESPWTCPKYRVTFDAS  590

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVP+W LSK FPEKKWI LINIPVISYGF
Sbjct  591  VIWGLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPIWALSKAFPEKKWIKLINIPVISYGF  650

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  651  AGMPPATPTNIASWLMTGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  710

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N    L+WWGS+ DHCPLA CPTAPGI V+GCPVF
Sbjct  711  NAGHNLRWWGSQPDHCPLAKCPTAPGIAVKGCPVF  745



>ref|XP_008345787.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=753

 Score =   375 bits (964),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLVSGVVNLAV WWML SI+NICD ++ +PNSPWTCPK+RVTFDAS
Sbjct  539  KIPPRCMYTAQLVGTLVSGVVNLAVAWWMLESIDNICDVESQNPNSPWTCPKYRVTFDAS  598

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFL+G  LPVP+WV+SK+FP+KKWIPLIN+PVI YGF
Sbjct  599  VIWGLIGPRRLFGPGGLYRNLVWLFLVGVFLPVPIWVMSKIFPDKKWIPLINMPVILYGF  658

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  659  AGMPPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  718

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   ELKWWG+ LDHCPLA+CP APGI V+GCPVF
Sbjct  719  NPKHELKWWGTTLDHCPLATCPIAPGIHVDGCPVF  753



>ref|XP_006283198.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
 gb|EOA16096.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
Length=737

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  523  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP+KKWIPLINIPVISYGF
Sbjct  583  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKIFPKKKWIPLINIPVISYGF  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  643  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  702

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  703  NAGHDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_006856263.1| PREDICTED: oligopeptide transporter 3 isoform X1 [Amborella trichopoda]
 gb|ERN17730.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
Length=738

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQL GTL++G VNLA+ WWMLGSI+++CD ++L PNSPWTCPK+RVTFD+S
Sbjct  524  KIPPRCMYTAQLAGTLIAGTVNLAIAWWMLGSIKDLCDVESLHPNSPWTCPKYRVTFDSS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFL+GA+LP+PVWVLSK+FP KKWIPLINIPVISYGF
Sbjct  584  VIWGLIGPRRLFGPGGMYRNLVWLFLVGALLPIPVWVLSKIFPNKKWIPLINIPVISYGF  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG+IFNYFVF+Y KGWWQKYNYVLSAALDAGTAFM VLL+FAL 
Sbjct  644  AGMPPATPTNIASWLVTGMIFNYFVFRYNKGWWQKYNYVLSAALDAGTAFMGVLLYFALG  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E++ L WWG++LDHCPLASCPT PG+ V GCPVF
Sbjct  704  MENRNLNWWGTQLDHCPLASCPTEPGVSVAGCPVF  738



>ref|XP_010440168.1| PREDICTED: oligopeptide transporter 3-like [Camelina sativa]
Length=737

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  523  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGTHPNSPWTCPKYRVTFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGF
Sbjct  583  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKVFPNKKWIPLINIPVISYGF  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  643  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  702

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  703  NAGHDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>gb|AAK96781.1| Unknown protein [Arabidopsis thaliana]
Length=737

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  523  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGF
Sbjct  583  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGF  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  643  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  702

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  703  NAGHDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>sp|O23482.3|OPT3_ARATH RecName: Full=Oligopeptide transporter 3; Short=AtOPT3 [Arabidopsis 
thaliana]
 gb|AAN72034.1| isp4 like protein [Arabidopsis thaliana]
Length=737

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  523  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGF
Sbjct  583  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGF  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  643  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  702

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  703  NAGHDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_010449801.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=737

 Score =   375 bits (962),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  523  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGTHPNSPWTCPKYRVTFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGF
Sbjct  583  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKVFPNKKWIPLINIPVISYGF  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  643  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  702

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  703  NAGHDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_004139520.1| PREDICTED: oligopeptide transporter 3 [Cucumis sativus]
 gb|KGN65011.1| hypothetical protein Csa_1G180750 [Cucumis sativus]
Length=745

 Score =   375 bits (962),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G +NLAV WWML SIENICD DAL   SPWTCPK+RVTFDAS
Sbjct  531  KIPPRCMYTAQLVGTLVAGTINLAVAWWMLDSIENICDDDALHAESPWTCPKYRVTFDAS  590

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNLVWLFLIGAVLPVP+W LSK FPEKKWI LINIPVISYGF
Sbjct  591  VIWGLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPIWALSKAFPEKKWIALINIPVISYGF  650

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG +FNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  651  AGMPPATPTNIASWLMTGTVFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  710

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N    L+WWGS+ DHCPLA CPTAPGI V+GCPVF
Sbjct  711  NAGHNLRWWGSQPDHCPLAKCPTAPGISVKGCPVF  745



>ref|XP_009124517.1| PREDICTED: oligopeptide transporter 3 [Brassica rapa]
 emb|CDY22769.1| BnaA08g05990D [Brassica napus]
Length=735

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  521  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDAS  580

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW +SK+FP+KKWIPLINIPVISYGF
Sbjct  581  VIWGLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWAMSKIFPDKKWIPLINIPVISYGF  640

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  641  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  700

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI+ +GCPVF
Sbjct  701  NAGHDLKWWGTEVDHCPLASCPTAPGIIAKGCPVF  735



>emb|CDY42539.1| BnaC08g10640D [Brassica napus]
Length=735

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  521  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDAS  580

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW +SK+FP+KKWIPLINIPVISYGF
Sbjct  581  VIWGLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWAMSKIFPDKKWIPLINIPVISYGF  640

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  641  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  700

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI+ +GCPVF
Sbjct  701  NAGHDLKWWGTEVDHCPLASCPTAPGIIAKGCPVF  735



>ref|XP_002868139.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44398.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
Length=737

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  523  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGF
Sbjct  583  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGF  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  643  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  702

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  703  NAGHDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_008785648.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=730

 Score =   374 bits (960),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWML +IENICDTDAL  +SPWTCPK+RVTFDAS
Sbjct  516  KIPPRCMYTAQLVGTIVAGVVNLAVAWWMLENIENICDTDALPSDSPWTCPKYRVTFDAS  575

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLF  GGLYRNLVWLFLIGAVLPVP+W+LSKM+P+KKWIPLINIPVISYGF
Sbjct  576  VIWGLIGPSRLFAHGGLYRNLVWLFLIGAVLPVPIWLLSKMYPKKKWIPLINIPVISYGF  635

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFN+FV +YRK WWQKYNYVLSAALDAGTAFM VLLF ALQ
Sbjct  636  AGMPPATPTNIASWLITGTIFNFFVLRYRKEWWQKYNYVLSAALDAGTAFMGVLLFLALQ  695

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N+H  + WWG+E+DHCPLASCPT PGIVV+GCPVF
Sbjct  696  NQHIGVHWWGTEVDHCPLASCPTEPGIVVKGCPVF  730



>gb|ADW09325.1| oligopeptide transporter 3 [Noccaea caerulescens]
Length=736

 Score =   374 bits (960),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD + + PNSPWTCPK+RVTFDAS
Sbjct  522  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGVHPNSPWTCPKYRVTFDAS  581

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW +SK+FP KKWIPLINIPVISYGF
Sbjct  582  VIWGLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWAMSKIFPNKKWIPLINIPVISYGF  641

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  642  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  701

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLA+CPTAPGI V+GCPVF
Sbjct  702  NAGHDLKWWGTEVDHCPLATCPTAPGIRVKGCPVF  736



>gb|KEH32683.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=741

 Score =   372 bits (956),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+GVVNL+V WWML SI++IC  D    +SPWTCPK+RVTFDAS
Sbjct  527  KIPPRCMYTAQLVGTLVAGVVNLSVAWWMLDSIKDICMDDKAHHDSPWTCPKYRVTFDAS  586

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFL+GAVLPVPVWV SK++P KKWIPLINIPVISYGF
Sbjct  587  VIWGLIGPKRLFGPGGLYRNLVWLFLVGAVLPVPVWVFSKIYPNKKWIPLINIPVISYGF  646

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVF++ K WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  647  AGMPPATPTNIASWLLTGMIFNYFVFRFHKRWWQKYNYVLSAALDAGTAFMGVLIFFALQ  706

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N    LKWWG+ELDHCPLA+CPTAPGIVV+GCPVF
Sbjct  707  NAGHTLKWWGTELDHCPLATCPTAPGIVVDGCPVF  741



>emb|CAD91127.1| glutathione transporter GT1 [Brassica juncea]
Length=661

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  447  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDAS  506

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW +SK+FP+KKWIPLINIPVISYGF
Sbjct  507  VIWGLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWAMSKIFPDKKWIPLINIPVISYGF  566

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYN VLSAALDAGTAFM VLLFFALQ
Sbjct  567  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNCVLSAALDAGTAFMGVLLFFALQ  626

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI+ +GCPVF
Sbjct  627  NAGHDLKWWGTEVDHCPLASCPTAPGIIAKGCPVF  661



>ref|XP_004507597.1| PREDICTED: oligopeptide transporter 3-like [Cicer arietinum]
Length=739

 Score =   372 bits (955),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D    +SPWTCPK+RVTFDAS
Sbjct  525  KIPPRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKAHHDSPWTCPKYRVTFDAS  584

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFL+GAVLPVPVWV SK++P+KKWI LINIPVISYGF
Sbjct  585  VIWGLIGPKRLFGPGGLYRNLVWLFLVGAVLPVPVWVFSKIYPDKKWIALINIPVISYGF  644

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG+IFNYFVF++ K WWQKYNYVLSAALDAGTAFM VL+FFALQ
Sbjct  645  AGMPPATPTNIASWLLTGMIFNYFVFRFHKRWWQKYNYVLSAALDAGTAFMGVLIFFALQ  704

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N    LKWWG+ELDHCPLA+CPTAPGIVV+GCPVF
Sbjct  705  NAGHSLKWWGTELDHCPLATCPTAPGIVVDGCPVF  739



>ref|XP_006414361.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
 gb|ESQ55814.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
Length=736

 Score =   372 bits (954),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+ VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  522  KIPPRCMYTAQLVGTVVASVVNLGVAWWMLESIQDICDIEGEHPNSPWTCPKYRVTFDAS  581

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW +SK+FP KKWIPLINIPVISYGF
Sbjct  582  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWAMSKIFPNKKWIPLINIPVISYGF  641

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  642  AGMPPATPTNIASWLVTGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  701

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLA+CPTAPGI  +GCPVF
Sbjct  702  NAGHDLKWWGTEVDHCPLATCPTAPGIRAKGCPVF  736



>ref|XP_009374859.1| PREDICTED: oligopeptide transporter 3-like [Pyrus x bretschneideri]
Length=753

 Score =   372 bits (954),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTLV+G+VNLAV WWML +IENICD ++ +PNSPWTCPK+RVTFDAS
Sbjct  539  KIPPRCMYTAQLVGTLVAGIVNLAVAWWMLENIENICDVESHNPNSPWTCPKYRVTFDAS  598

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGP GLYRNLVWLFL+GA+LP P+  +SK+FP+KKWIPLIN+PVI+YGF
Sbjct  599  VIWGLIGPRRLFGPRGLYRNLVWLFLVGALLPFPICAMSKIFPDKKWIPLINMPVITYGF  658

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  659  AGMPPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  718

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   ELKWWG+ELDHCPLA+CP APGI VEGCPVF
Sbjct  719  NPKHELKWWGTELDHCPLATCPIAPGIHVEGCPVF  753



>ref|NP_567493.5| oligopeptide transporter [Arabidopsis thaliana]
 gb|AEE83738.1| oligopeptide transporter [Arabidopsis thaliana]
Length=737

 Score =   370 bits (951),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 190/215 (88%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  523  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLV LFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGF
Sbjct  583  VIWGLIGPRRLFGPGGMYRNLVGLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGF  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  643  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  702

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  703  NAGHDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_010039444.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039445.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW45991.1| hypothetical protein EUGRSUZ_L00159 [Eucalyptus grandis]
Length=765

 Score =   370 bits (950),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR M+  QLV +LVSG+VNLAV WWM+GSIENICD +AL P+SPWTCPKF VTFD S
Sbjct  550  KIPPRCMFTVQLVASLVSGIVNLAVAWWMMGSIENICDVEALHPDSPWTCPKFAVTFDNS  609

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLF P GLYRNL+WLFL+GA+LP+P+W LSKMFPEKKWI LINIPV+S+GF
Sbjct  610  VIWGLIGPRRLFVPDGLYRNLIWLFLVGALLPLPIWALSKMFPEKKWIRLINIPVLSFGF  669

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AG+PPA+PTNI SW++TG+ FNYF+F+YRK WWQKYNYVLSAALDAGTAFM V LFFALQ
Sbjct  670  AGVPPASPTNIASWLITGMFFNYFMFRYRKRWWQKYNYVLSAALDAGTAFMGVFLFFALQ  729

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N++K LKWWG+E+DHCPLA+CPT PG+VV+GCPVFK
Sbjct  730  NQNKSLKWWGTEIDHCPLATCPTEPGVVVQGCPVFK  765



>ref|XP_010039447.1| PREDICTED: oligopeptide transporter 3-like isoform X2 [Eucalyptus 
grandis]
Length=704

 Score =   368 bits (944),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR M+  QLV +LVSG+VNLAV WWM+GSIENICD +AL P+SPWTCPKF VTFD S
Sbjct  489  KIPPRCMFTVQLVASLVSGIVNLAVAWWMMGSIENICDVEALHPDSPWTCPKFAVTFDNS  548

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLF P GLYRNL+WLFL+GA+LP+P+W LSKMFPEKKWI LINIPV+S+GF
Sbjct  549  VIWGLIGPRRLFVPDGLYRNLIWLFLVGALLPLPIWALSKMFPEKKWIRLINIPVLSFGF  608

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AG+PPA+PTNI SW++TG+ FNYF+F+YRK WWQKYNYVLSAALDAGTAFM V LFFALQ
Sbjct  609  AGVPPASPTNIASWLITGMFFNYFMFRYRKRWWQKYNYVLSAALDAGTAFMGVFLFFALQ  668

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N++K LKWWG+E+DHCPLA+CPT PG+VV+GCPVFK
Sbjct  669  NQNKSLKWWGTEIDHCPLATCPTEPGVVVQGCPVFK  704



>ref|XP_008349335.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=756

 Score =   367 bits (943),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY  QLVGTLV+G+VNLAV WWML +IENICD ++ +PNSPWTCPK+RVTFDAS
Sbjct  542  KIPPRCMYTXQLVGTLVAGIVNLAVAWWMLENIENICDVESRNPNSPWTCPKYRVTFDAS  601

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGGLYRNL+WLFL+GA+LP P+  +SK+FP+KKWIPLIN+PVI+YGF
Sbjct  602  VIWGLIGPRRLFGPGGLYRNLMWLFLVGALLPFPICSMSKIFPDKKWIPLINMPVITYGF  661

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG IFNY VFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  662  AGMPPATPTNIASWLITGGIFNYXVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  721

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   ELKWWG+ELDHCPLA+CP APGI VEGCPVF
Sbjct  722  NPKHELKWWGTELDHCPLATCPIAPGIHVEGCPVF  756



>ref|XP_010542186.1| PREDICTED: oligopeptide transporter 3 [Tarenaya hassleriana]
Length=727

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 189/215 (88%), Gaps = 5/215 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGTL++GVVNL V WWML SI++ICD +   P+SPWTCPK+RVTFDAS
Sbjct  518  KIPPRCMYTAQLVGTLLAGVVNLGVAWWMLESIQDICDIEGEHPDSPWTCPKYRVTFDAS  577

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGG+YRNLVWLFLIGAVLPVPVWVLSK+FP++KW     +PV+ +G 
Sbjct  578  VIWGLIGPKRLFGPGGMYRNLVWLFLIGAVLPVPVWVLSKIFPDQKW-----MPVVHFGI  632

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            +GMPPATPTNI SW+VTG+IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  633  SGMPPATPTNIASWLVTGMIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  692

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            NE   LKWWG+++DHCPLASCPTAPGI V+GCPVF
Sbjct  693  NEGHNLKWWGTQVDHCPLASCPTAPGIKVKGCPVF  727



>ref|XP_010039443.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
Length=697

 Score =   354 bits (909),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR M+ AQLV +LVSG VNLAV WWM+GSIENICD + L  +SPWTCPKF+V FD S
Sbjct  483  KIPPRCMFTAQLVASLVSGTVNLAVAWWMIGSIENICDVEGLHRDSPWTCPKFKVAFDYS  542

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLF P GLYRNLVWLFL+GA+LP+P+WVLSK+FPEKKWI  INIP++S+GF
Sbjct  543  VIWGLIGPRRLFIPDGLYRNLVWLFLVGALLPLPIWVLSKIFPEKKWIRHINIPLLSFGF  602

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AG+PPA+PTNI SWI+TG+ FNYF+ +YRK WWQKYNYVLSAALDAGTAFM V L+FALQ
Sbjct  603  AGIPPASPTNIASWIITGMFFNYFMLRYRKRWWQKYNYVLSAALDAGTAFMGVFLYFALQ  662

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N+  +LKWWG+++DHCPLA+CPT PG+VV+GCPVF
Sbjct  663  NQKTDLKWWGTQIDHCPLATCPTEPGVVVKGCPVF  697



>gb|KCW45990.1| hypothetical protein EUGRSUZ_L00158 [Eucalyptus grandis]
Length=745

 Score =   354 bits (909),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR M+ AQLV +LVSG VNLAV WWM+GSIENICD + L  +SPWTCPKF+V FD S
Sbjct  531  KIPPRCMFTAQLVASLVSGTVNLAVAWWMIGSIENICDVEGLHRDSPWTCPKFKVAFDYS  590

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLF P GLYRNLVWLFL+GA+LP+P+WVLSK+FPEKKWI  INIP++S+GF
Sbjct  591  VIWGLIGPRRLFIPDGLYRNLVWLFLVGALLPLPIWVLSKIFPEKKWIRHINIPLLSFGF  650

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AG+PPA+PTNI SWI+TG+ FNYF+ +YRK WWQKYNYVLSAALDAGTAFM V L+FALQ
Sbjct  651  AGIPPASPTNIASWIITGMFFNYFMLRYRKRWWQKYNYVLSAALDAGTAFMGVFLYFALQ  710

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N+  +LKWWG+++DHCPLA+CPT PG+VV+GCPVF
Sbjct  711  NQKTDLKWWGTQIDHCPLATCPTEPGVVVKGCPVF  745



>ref|XP_010436532.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=726

 Score =   349 bits (895),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 181/215 (84%), Gaps = 11/215 (5%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDAS
Sbjct  523  KIPPRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGTHPNSPWTCPKYRVTFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP+RLFGPGG+YRNLVWLFLIGAV           FP KKWIPLINIPVISYGF
Sbjct  583  VIWGLIGPRRLFGPGGMYRNLVWLFLIGAV-----------FPNKKWIPLINIPVISYGF  631

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQ
Sbjct  632  AGMPPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQ  691

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N   +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  692  NAGHDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  726



>ref|XP_010939248.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=729

 Score =   347 bits (889),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+G+VNLAV WWML +IENICDTD L  +SPWTCPK+RVTFDAS
Sbjct  515  KIPPRCMYTAQLVGTIVAGIVNLAVAWWMLENIENICDTDVLPSDSPWTCPKYRVTFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLF  GGLYRNLVWLFLIGAVLPVP+W+LSKM+P+KKWIPLINIPVISYGF
Sbjct  575  VIWGLIGPSRLFAHGGLYRNLVWLFLIGAVLPVPIWLLSKMYPKKKWIPLINIPVISYGF  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            AGMPPATPTNI SW++TG +FN+FVF++RK WW+KYNYVLSAALDAGTAFM VLLF ALQ
Sbjct  635  AGMPPATPTNIASWLITGTVFNFFVFRFRKEWWRKYNYVLSAALDAGTAFMGVLLFLALQ  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            N+  ++ WWG+E+DHCPLASCPT PGI V+GCPVF
Sbjct  695  NQDIDVHWWGTEVDHCPLASCPTEPGIAVKGCPVF  729



>gb|AAO72613.1| Isp-4-like protein [Oryza sativa Japonica Group]
Length=446

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+GVVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDAS
Sbjct  269  KIPPRCMYTAQLVGTVVAGVVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDAS  328

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP RLFG  GLYRNLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGF
Sbjct  329  VIWGLIGPARLFGRHGLYRNLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGF  388

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFA  368
            AGMPPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFA
Sbjct  389  AGMPPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFA  446



>emb|CDP04527.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   320 bits (821),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 174/216 (81%), Gaps = 12/216 (6%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+  QLVG+LV+ + NL + WWML SI NICD +AL P+SPWTCPKFRV FD +
Sbjct  475  KIPPRSMFTVQLVGSLVASLANLGMGWWMLESIPNICDVEALHPDSPWTCPKFRVMFDTT  534

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            V+WGLIGP+RLFGP GLYRN++WLF +GA+LP+PVW+LS+ FP+KKWI LINIP+I+ GF
Sbjct  535  VVWGLIGPERLFGPHGLYRNMIWLFPLGALLPIPVWILSRKFPDKKWISLINIPLITCGF  594

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
             G+PPA PTNI SWI            YRKGWWQKYNYVLS+ALDAGTAFM VLLFFALQ
Sbjct  595  TGIPPAAPTNIASWI------------YRKGWWQKYNYVLSSALDAGTAFMGVLLFFALQ  642

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N  K LKWWG+E DHCPLASCPTAPGI V GCPV K
Sbjct  643  NSGKNLKWWGTEPDHCPLASCPTAPGITVAGCPVVK  678



>ref|XP_010087657.1| Oligopeptide transporter 3 [Morus notabilis]
 gb|EXB29550.1| Oligopeptide transporter 3 [Morus notabilis]
Length=724

 Score =   321 bits (822),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 175/215 (81%), Gaps = 16/215 (7%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR MY AQLVGT+V+G VNLAV WWML SI++ICD + L P+SPWTCPK+RVTFDAS
Sbjct  526  KIPPRCMYTAQLVGTIVAGTVNLAVAWWMLESIDDICDVEGLHPDSPWTCPKYRVTFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+W+LSKM          N+   S+  
Sbjct  586  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWLLSKM----------NVSRNSHQH  635

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            +        NI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFMAVLLFFALQ
Sbjct  636  SEF------NIASWLITGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMAVLLFFALQ  689

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
            NE+K LKWWG+ LDHCPLA+CPTAPGI V+GCPVF
Sbjct  690  NENKNLKWWGTSLDHCPLATCPTAPGIKVDGCPVF  724



>gb|KDP35952.1| hypothetical protein JCGZ_09924 [Jatropha curcas]
Length=254

 Score =   288 bits (738),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 165/214 (77%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SI NIC  D L PNSPWTCP  RV FDAS
Sbjct  40   KIPPRSMFLVQFIGTILAGTINLAVAWWLLNSIHNICQDDLLPPNSPWTCPGDRVFFDAS  99

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y+ + W FL GAV P  VWVL K FP++ WIPLIN+PV+    
Sbjct  100  VIWGLVGPKRIFGSLGNYQAMNWFFLGGAVGPFIVWVLHKSFPKQSWIPLINLPVLLGST  159

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++ 
Sbjct  160  GNMPPATAVNYNSWIIVGTIFNFFVFRYRKHWWQRYNYILSAALDAGVAFMAVLLYFSVG  219

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ L WWG+E +HC LA+CPTA GIVV+GCPV
Sbjct  220  MENRSLNWWGTEGEHCDLATCPTAKGIVVDGCPV  253



>ref|XP_012074611.1| PREDICTED: oligopeptide transporter 4-like [Jatropha curcas]
Length=611

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 165/214 (77%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SI NIC  D L PNSPWTCP  RV FDAS
Sbjct  397  KIPPRSMFLVQFIGTILAGTINLAVAWWLLNSIHNICQDDLLPPNSPWTCPGDRVFFDAS  456

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y+ + W FL GAV P  VWVL K FP++ WIPLIN+PV+    
Sbjct  457  VIWGLVGPKRIFGSLGNYQAMNWFFLGGAVGPFIVWVLHKSFPKQSWIPLINLPVLLGST  516

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++ 
Sbjct  517  GNMPPATAVNYNSWIIVGTIFNFFVFRYRKHWWQRYNYILSAALDAGVAFMAVLLYFSVG  576

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ L WWG+E +HC LA+CPTA GIVV+GCPV
Sbjct  577  MENRSLNWWGTEGEHCDLATCPTAKGIVVDGCPV  610



>ref|XP_010919977.1| PREDICTED: oligopeptide transporter 4-like [Elaeis guineensis]
Length=356

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+LGSI+NICD   LSPNSPWTCP  RV FDAS
Sbjct  142  KIPPRSMFIVQFIGTIIAGTINLGVAWWLLGSIKNICDDQLLSPNSPWTCPSDRVFFDAS  201

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y  L W FL GA+ P+ VW   K FP + WIPLIN+PV+    
Sbjct  202  VIWGLVGPRRIFGPLGNYGALNWFFLGGALGPIIVWTFHKFFPAQTWIPLINLPVLLGAT  261

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWIV G +FN+FV++YRK WW++YNY+LSAALDAG AFM V L+F L 
Sbjct  262  ASMPPATAVNYNSWIVVGTVFNFFVYRYRKKWWERYNYILSAALDAGVAFMGVFLYFTLN  321

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+  L WWG+  +HC LA+CPTA G+ V+GCPVF
Sbjct  322  LENVTLDWWGTAGEHCELATCPTAKGVQVDGCPVF  356



>gb|ABK94821.1| unknown [Populus trichocarpa]
Length=436

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 166/215 (77%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SIENIC  D L  NSPWTCP  RV FDAS
Sbjct  219  KIPPRSMFLVQFIGTILAGTINLAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDAS  278

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y+ + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  279  VIWGLVGPKRIFGTLGNYQAMNWFFLGGALGPVIVWLLHKSFPKQSWIPLINLPVLLGAT  338

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+F+F+Y+K WWQ+YNYVLSAALDAG AFMAVLL+F++ 
Sbjct  339  AMMPPATPVNYNAWIIVGTIFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVG  398

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E + L WWG+  +HC LA+CPTA GI+V+GCP F
Sbjct  399  IEDRTLNWWGTNGEHCELATCPTAKGIMVDGCPDF  433



>ref|XP_010254620.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=738

 Score =   295 bits (754),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 168/215 (78%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G +NL V WW+L SIENIC  D L PNSPWTCP  RV FDAS
Sbjct  524  KIPPRSMFIVQLIGTIIAGTINLGVAWWLLDSIENICQDDLLPPNSPWTCPGDRVFFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  584  VIWGLVGPKRIFGTLGNYGALNWFFLGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFM VL++F+L 
Sbjct  644  AMMPPATALNYNAWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMGVLIYFSLT  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+++L WWG++ +HCPLA+CPTA G+VVEGCP +
Sbjct  704  MENRDLNWWGTDGEHCPLATCPTAKGVVVEGCPAY  738



>gb|KJB58811.1| hypothetical protein B456_009G227200 [Gossypium raimondii]
Length=741

 Score =   292 bits (748),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 162/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+V Q +GT+++G VNLAV WW+L ++ENIC    L PNSPWTCP  RV FDAS
Sbjct  527  KIPPRSMFVVQSIGTVIAGTVNLAVAWWLLTTVENICQDHLLPPNSPWTCPGDRVFFDAS  586

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FGP G Y  L W FL GAV PV VW+  K FP +KWIPLIN+PV+    
Sbjct  587  VIWGLVGPKRIFGPLGNYSALNWFFLGGAVGPVVVWLFHKAFPNQKWIPLINLPVLLGAT  646

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   W++ G IFNY+VFKYRKGWWQ+YNYVLSAALDAG AFM VLL+F L 
Sbjct  647  AAMPPATSLNFNCWLIIGFIFNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLT  706

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 + WWGS+ +HC LASCPTA GIVV+GCPVF
Sbjct  707  MHGISISWWGSDGEHCDLASCPTAKGIVVDGCPVF  741



>gb|KDO67987.1| hypothetical protein CISIN_1g020208mg [Citrus sinensis]
Length=329

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 165/214 (77%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDAS
Sbjct  115  KIPPRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDAS  174

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W F+ GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  175  VIWGLVGPKRIFGSQGNYPAMNWFFVGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGAT  234

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++ 
Sbjct  235  GMMPPATAVNYNSWIIVGTIFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVG  294

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  295  MEDKGLSWWGTEGEHCDLATCPTAKGILVDGCPV  328



>ref|XP_009398499.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 164/215 (76%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+++G +NL V WW+LGSIENIC    L PNSPWTCP  RV FDAS
Sbjct  524  KIPPKSMFLVQFIGTIIAGTINLGVAWWLLGSIENICHPGLLPPNSPWTCPSDRVFFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y +L W FL+GA+ P+ VW+  K FP + WIPLIN+PV+    
Sbjct  584  VIWGLVGPRRIFGPKGNYGSLNWFFLVGALGPIIVWLFHKAFPRQSWIPLINLPVLLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI  G  FN+FVF+YRK WW++YNY+LSAALDAG AFM VLL+FAL 
Sbjct  644  GMMPPATPLNFSAWIAVGTAFNFFVFRYRKKWWERYNYILSAALDAGVAFMGVLLYFALS  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+K + WWG+E +HCPLASCPTA G+ V+GCP F
Sbjct  704  MENKSITWWGAEGEHCPLASCPTAKGVQVDGCPQF  738



>ref|XP_006351838.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=738

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 165/214 (77%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT++SG +N++V WW+L SIENIC  D L PNSPWTCP  RV FDAS
Sbjct  524  KIPPRSMFLVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPNSPWTCPGDRVFFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y ++ W FL GA+ PV VW+L KMFP + WIPLIN+PV+    
Sbjct  584  VIWGLVGPKRIFGTLGNYSSMNWFFLGGAIGPVIVWLLHKMFPTQSWIPLINLPVLLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +W++ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L 
Sbjct  644  GAMPPATPLNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLG  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+K + WWG+  +HC LA+CPTA GI V+GCP 
Sbjct  704  MENKGVTWWGTNGEHCKLATCPTAKGIAVDGCPT  737



>ref|XP_009612437.1| PREDICTED: oligopeptide transporter 4 [Nicotiana tomentosiformis]
Length=737

 Score =   289 bits (740),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 165/213 (77%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT++SG +N++V WW+L SIENIC  D L P+SPWTCP  RV FDAS
Sbjct  523  KIPPRSMFLVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y ++ W FL GAV PV VW+L K+FP K WIPLIN+PV+    
Sbjct  583  VIWGLVGPKRIFGSLGNYSSMNWFFLGGAVGPVIVWLLHKVFPTKSWIPLINLPVLLGAT  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +W++ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L 
Sbjct  643  GAMPPATPLNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLG  702

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E+K L WWG+  +HC LA+CPTA GI V+GCP
Sbjct  703  MENKGLTWWGTNGEHCELATCPTAKGIAVDGCP  735



>ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicotiana sylvestris]
Length=738

 Score =   289 bits (739),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 165/213 (77%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT++SG +N++V WW+L SIENIC  D L P+SPWTCP  RV FDAS
Sbjct  524  KIPPRSMFLVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y ++ W FL GAV PV VW+L K+FP K WIPLIN+PV+    
Sbjct  584  VIWGLVGPKRIFGSLGNYSSMNWFFLGGAVGPVIVWLLHKVFPTKSWIPLINLPVLLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +W++ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L 
Sbjct  644  GAMPPATPLNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLG  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E+K L WWG+  +HC LA+CPTA GI V+GCP
Sbjct  704  MENKGLTWWGTNGEHCELATCPTAKGIAVDGCP  736



>gb|KJB32168.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=528

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDAS
Sbjct  314  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDAS  373

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  374  VIWGLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGAT  433

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++ 
Sbjct  434  GMMPPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVG  493

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  494  MENRSVTWWGTEGEHCKLATCPTAKGIMVDGCPV  527



>emb|CDO97359.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+V+G +N++V WW+L SI+NIC  D L  +SPWTCP  RV FDAS
Sbjct  162  KIPPRSMFLVQFIGTIVAGTINVSVAWWLLHSIKNICQDDLLPQDSPWTCPGDRVFFDAS  221

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ P+ VW+  K FP++ WIPLIN+PV+    
Sbjct  222  VIWGLVGPKRIFGTLGNYTEMNWFFLGGALGPIIVWLFHKAFPKQSWIPLINLPVLLGAT  281

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F + 
Sbjct  282  GAMPPATPLNYNAWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFTVG  341

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++E+ WWG++ + C LA+CPTA GI V+GCPV
Sbjct  342  MENREVTWWGTKGEQCDLATCPTAKGITVDGCPV  375



>ref|XP_004231372.1| PREDICTED: oligopeptide transporter 4 [Solanum lycopersicum]
Length=735

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 165/213 (77%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT++SG +N++V WW+L SIENIC  D L P+SPWTCP  RV FDAS
Sbjct  521  KIPPRSMFLVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDAS  580

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y ++ W FL GA+ PV VW+L KMFP + WIPLIN+PV+    
Sbjct  581  VIWGLVGPKRIFGTLGNYSSMNWFFLGGAIGPVIVWLLHKMFPTQSWIPLINLPVLLGAT  640

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +W++ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L 
Sbjct  641  GAMPPATPLNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLG  700

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E+K + WWG+  +HC LA+CPTA GI V+GCP
Sbjct  701  MENKGVTWWGTNGEHCKLATCPTAKGIAVDGCP  733



>gb|KEH36459.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=552

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L S+ENIC  D L   SPWTCP  RV FDAS
Sbjct  338  KIPPRSMFLVQFIGTMLAGTINIGVAWWLLNSVENICHDDLLPEGSPWTCPGDRVFFDAS  397

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W F+ GA+ P+ VW+L K FP + WI LIN+PV+    
Sbjct  398  VIWGLVGPKRIFGSKGNYSAMNWFFIGGAIGPIIVWLLHKAFPRQSWIALINLPVLLGAT  457

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  SWI  G IFN+FVF+YRK WWQ+YNYVLSAALD G AFM VLL+F+L 
Sbjct  458  AMMPPATPLNYNSWIFVGTIFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLS  517

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ + WWG+E +HCPLASCPTA GI V+GCPV
Sbjct  518  LENRSISWWGTEGEHCPLASCPTAKGIAVDGCPV  551



>ref|XP_007018304.1| Oligopeptide transporter 2 [Theobroma cacao]
 gb|EOY15529.1| Oligopeptide transporter 2 [Theobroma cacao]
Length=738

 Score =   288 bits (737),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 163/215 (76%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+V Q +GT+++G +NLAV WW+L ++ENIC    L PNSPWTCP  RV +DAS
Sbjct  524  KIPPRSMFVVQAMGTIIAGTINLAVAWWLLTTVENICQDQLLPPNSPWTCPGDRVFYDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FGP G Y  L W FL GA+ PV VW+  K FP +KWI LIN+PV+    
Sbjct  584  VIWGLVGPKRIFGPLGNYAALNWFFLGGALGPVVVWLFHKAFPNQKWISLINLPVLLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G+IFNY+VFKYRKGWWQ+YNYVLSAALDAG AFM VLL+F L 
Sbjct  644  AAMPPATSLNFNCWIIVGVIFNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLT  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             +   + WWG+E +HC LASCPTA GIVV+GCPV+
Sbjct  704  MQGISISWWGAEGEHCDLASCPTAKGIVVDGCPVY  738



>ref|XP_009366376.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=734

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P SM++ Q +GT+V+G VN+ V WW+L SIENIC    L PNSPWTCP  RV FDAS
Sbjct  520  KIPPISMFIVQCIGTIVAGTVNIGVAWWLLSSIENICQDQLLPPNSPWTCPGDRVFFDAS  579

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y+ L W FLIGA+ P+ VW+L K FP +KWI LIN+PV+    
Sbjct  580  VIWGLVGPKRIFGSLGNYKALNWFFLIGALGPLLVWLLHKAFPSQKWIKLINLPVLLGAT  639

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WIV G IFNYFVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  640  AAMPPATTVNFNCWIVVGTIFNYFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLT  699

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
               K + WWG+  +HC LA+CPTA GIVV+GCPV+
Sbjct  700  MNEKSISWWGTNGEHCDLATCPTAKGIVVDGCPVY  734



>ref|XP_002313213.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
 gb|EEE87168.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
Length=752

 Score =   287 bits (735),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 166/215 (77%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SIENIC  D L  NSPWTCP  RV FDAS
Sbjct  535  KIPPRSMFLVQFIGTILAGTINLAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDAS  594

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y+ + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  595  VIWGLVGPKRIFGTLGNYQAMNWFFLGGALGPVIVWLLHKSFPKQSWIPLINLPVLLGAT  654

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+F+F+Y+K WWQ+YNYVLSAALDAG AFMAVLL+F++ 
Sbjct  655  AMMPPATPVNYNAWIIVGTIFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVG  714

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E + L WWG+  +HC LA+CPTA GI+V+GCP F
Sbjct  715  IEDRTLNWWGTNGEHCELATCPTAKGIMVDGCPDF  749



>ref|XP_002518328.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF44088.1| Oligopeptide transporter, putative [Ricinus communis]
Length=754

 Score =   287 bits (734),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 162/213 (76%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SI NIC  D L PNSPWTCP  RV FDAS
Sbjct  540  KIPPRSMFLVQFIGTMLAGTINLAVAWWLLNSITNICQDDLLPPNSPWTCPGDRVFFDAS  599

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y+ + W FL GAV P+ VW+L K FP K WIPLIN+PV+    
Sbjct  600  VIWGLVGPRRIFGSLGNYQAMNWFFLGGAVGPIIVWLLHKSFPRKSWIPLINLPVLLGST  659

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L 
Sbjct  660  GMMPPATAVNYNSWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLG  719

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E++ L WWG++ +HC LASCPTA GI V GCP
Sbjct  720  IENRSLTWWGTDGEHCDLASCPTAKGIDVAGCP  752



>ref|XP_006472993.1| PREDICTED: oligopeptide transporter 2-like [Citrus sinensis]
Length=742

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -3

Query  889  RSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWG  710
            R+M+V Q +GT+++G VNL V WW+L ++ENIC    L PNSPWTCP  RV +DASVIWG
Sbjct  532  RAMFVVQFIGTIIAGTVNLGVAWWLLTTVENICQDQLLPPNSPWTCPGDRVFYDASVIWG  591

Query  709  LIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMP  530
            LIGPKR+FG  G+Y  L W FL+G + P  VW+L K FP+ KWI LIN+PV+    A MP
Sbjct  592  LIGPKRIFGRMGIYSALNWFFLLGTLGPFVVWLLQKAFPKHKWITLINLPVLLGATAQMP  651

Query  529  PATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHK  350
            PAT  N   WIV G IFNYF+FKYRKGWWQ+YNYV+SAALDAG AFM VLL+F L  E++
Sbjct  652  PATTVNFNCWIVVGTIFNYFIFKYRKGWWQRYNYVVSAALDAGLAFMGVLLYFTLTMENR  711

Query  349  ELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             + WWGS  +HC LASCPT  G+VVEGCPV+
Sbjct  712  SINWWGSAGEHCDLASCPTTKGVVVEGCPVY  742



>ref|XP_010029951.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56909.1| hypothetical protein EUGRSUZ_I02585 [Eucalyptus grandis]
Length=746

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 167/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDAS
Sbjct  532  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDAS  591

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G YR + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  592  VIWGLVGPRRIFGTLGNYRQMNWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGAT  651

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +W++ G+IFN+F+F+YRK WWQ+YNYVLSAALDAGTAFMAVLL+F++ 
Sbjct  652  GMMPPATPLNYNAWVLAGVIFNFFIFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFSVG  711

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ + WWG+  +HC LA+CPTA GI V+GCPV
Sbjct  712  MENRSITWWGTNGEHCELAACPTAKGIEVDGCPV  745



>ref|XP_011087976.1| PREDICTED: oligopeptide transporter 4 [Sesamum indicum]
Length=744

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 165/215 (77%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN+AV WW+L SI NIC  D L P+SPWTCP  RV FDAS
Sbjct  530  KIPPRSMFIVQFLGTIIAGTVNIAVAWWLLTSITNICQDDLLPPDSPWTCPGDRVFFDAS  589

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y ++ W FL GA+ PV VW+  K FP++ WIPLIN+PV+    
Sbjct  590  VIWGLVGPKRIFGSLGNYSSMNWFFLGGALGPVLVWLFHKAFPKQSWIPLINLPVLLGAT  649

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAV L+F+L 
Sbjct  650  GIMPPATPLNYNAWIIIGTIFNFFVFRYRKSWWQRYNYILSAALDAGVAFMAVALYFSLG  709

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+KE+ WWG+  +HC LA+CPTA GI V+GCPV+
Sbjct  710  MENKEIHWWGTSGEHCKLATCPTAKGIQVDGCPVY  744



>ref|XP_010030910.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56910.1| hypothetical protein EUGRSUZ_I02586 [Eucalyptus grandis]
Length=742

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G VN+AV WW+L S+ NIC  D L  +SPWTCP  RV FDAS
Sbjct  528  KIPPRSMFLVQLIGTILAGTVNIAVAWWLLNSVTNICQDDLLPLDSPWTCPSDRVFFDAS  587

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL GP+R+FG  G YR + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  588  VIWGLAGPRRIFGALGDYREINWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGAT  647

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAALDAGTAFMAVLL+FA+ 
Sbjct  648  AMMPPATPLNYNAWVLVGTIFNFFVFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFAVG  707

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+K + WWG+  +HC LA+CPTA GI V+GCP+
Sbjct  708  MENKSITWWGTNGEHCELAACPTAKGIEVDGCPI  741



>ref|XP_011003045.1| PREDICTED: oligopeptide transporter 4 [Populus euphratica]
Length=749

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SIENIC  D L  NSPWTCP  RV FDAS
Sbjct  535  KIPPRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICQDDLLPVNSPWTCPGDRVFFDAS  594

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y+ + W FL GA+ PV +W+L K FP++ WIPLIN+PV+    
Sbjct  595  VIWGLVGPKRIFGTLGNYQAMNWFFLGGALGPVIIWLLHKSFPKQSWIPLINLPVLLGAT  654

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+F+F+Y+K WWQ+YNYVLSAALDAG AFMAVLL+F++ 
Sbjct  655  AMMPPATPVNYNAWIIVGTIFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVG  714

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E + L WWG+  +HC LA+CPTA GI+V+GCPV
Sbjct  715  IEDRSLNWWGTNGEHCELATCPTAKGIMVDGCPV  748



>ref|XP_006433764.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
 gb|ESR47004.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
Length=742

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -3

Query  889  RSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWG  710
            R+M+V Q +GT+++G VNL V WW+L ++ENIC    L PNSPWTCP  RV +DASVIWG
Sbjct  532  RAMFVVQFIGTIIAGTVNLGVAWWLLTTVENICQDQLLPPNSPWTCPGDRVFYDASVIWG  591

Query  709  LIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMP  530
            LIGPKR+FG  G+Y  L W FL+G + P  VW+L K FP+ KWI LIN+PV+    A MP
Sbjct  592  LIGPKRIFGRMGIYSALNWFFLLGTLGPFVVWLLHKAFPKHKWITLINLPVLLGATAQMP  651

Query  529  PATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHK  350
            PAT  N   WIV G IFNYF+FKYRKGWWQ+YNYV+SAALDAG AFM VLL+F L  E++
Sbjct  652  PATTVNFNCWIVVGTIFNYFIFKYRKGWWQRYNYVVSAALDAGLAFMGVLLYFTLTMENR  711

Query  349  ELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             + WWGS  +HC LASCPT  G+VVEGCPV+
Sbjct  712  SIDWWGSAGEHCDLASCPTTKGVVVEGCPVY  742



>gb|EYU18387.1| hypothetical protein MIMGU_mgv1a0036351mg, partial [Erythranthe 
guttata]
Length=569

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 162/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN+AV WW+L SI NIC  D L P+SPWTCP  RV FDAS
Sbjct  355  KIPPRSMFIVQFLGTIIAGTVNIAVAWWLLTSITNICQDDLLPPDSPWTCPGDRVFFDAS  414

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y ++ W FL GA+ PV VW L K FP++ WIPLIN+PV+    
Sbjct  415  VIWGLVGPKRIFGSLGNYSSMNWFFLGGAIGPVLVWFLHKAFPKQSWIPLINLPVLLGAT  474

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAV L+F L 
Sbjct  475  GAMPPATPLNYNAWIIIGTIFNFFVFRYRKIWWQRYNYILSAALDAGVAFMAVGLYFTLG  534

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E K + WWG+  +HC LA+CPTA GI V+GCP++
Sbjct  535  MEEKGIDWWGTSGEHCKLATCPTAKGIRVDGCPIY  569



>ref|XP_002963418.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
 gb|EFJ35289.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
Length=743

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -3

Query  889  RSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWG  710
            RSM+  Q +GT+V+ +VN+   WW+LGSIENICD   L PNSPWTCP  RV FDASVIWG
Sbjct  533  RSMFHVQFIGTIVAAIVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWG  592

Query  709  LIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMP  530
            LIGPKR+FG  G Y+ L W FL GA+ PV VW+ S+ FP  KWIPLIN+PVI    A MP
Sbjct  593  LIGPKRMFGSHGEYKELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMP  652

Query  529  PATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHK  350
            PAT  N  SW + G+IFNYF+F+Y KGWWQ+YNYV SAA+DAG AFM VLL+  L  E++
Sbjct  653  PATSVNYISWSIVGIIFNYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENR  712

Query  349  ELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             L WWG+ +D+CPLA CPTA GIV+ GCPV+
Sbjct  713  SLSWWGNNVDNCPLADCPTAKGIVIAGCPVY  743



>ref|XP_004485624.1| PREDICTED: oligopeptide transporter 4-like [Cicer arietinum]
Length=740

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 163/213 (77%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L SIENIC  D L P SPWTCP  RV FDAS
Sbjct  526  KIPPRSMFLVQFIGTILAGTINIGVAWWLLNSIENICHDDLLPPGSPWTCPGDRVFFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ P+ VW+  + FP++ WIPLIN+PV+    
Sbjct  586  VIWGLVGPKRIFGSKGNYSAMNWFFLGGAIGPIIVWLFHRAFPKQSWIPLINLPVLLGAT  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNYVLSAALD G AFM VLL+F+L 
Sbjct  646  AMMPPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLG  705

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E++ + WWG++ +HCPLASCPTA GIVV+GCP
Sbjct  706  LENRSISWWGNDGEHCPLASCPTAEGIVVDGCP  738



>gb|KHG09371.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=753

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  NSPWTCP  RV FDAS
Sbjct  539  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDAS  598

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  599  VIWGLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGAT  658

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++ 
Sbjct  659  GMMPPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVG  718

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  719  MENRSVTWWGTEGEHCELATCPTAKGIMVDGCPV  752



>ref|XP_010933427.1| PREDICTED: oligopeptide transporter 4-like [Elaeis guineensis]
Length=764

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 164/215 (76%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+++G +NLAV WW+LGSIENIC +D L  NSPWTCP  RV FDAS
Sbjct  550  KIPPKSMFLVQFIGTIIAGTINLAVAWWLLGSIENICQSDLLPENSPWTCPGDRVFFDAS  609

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y  L W FL+GA+ P+ VW+  ++FP + WIPLIN+PV+    
Sbjct  610  VIWGLVGPRRIFGPLGNYGALNWFFLVGALGPIIVWIFHRLFPSQTWIPLINLPVLFGAT  669

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  +W+  G +FN+FVF+YRK WW++YNY+LSAALDAG AFM V L+FAL 
Sbjct  670  ANMPPATAVNYTAWVTVGTVFNFFVFRYRKRWWERYNYILSAALDAGVAFMGVFLYFALN  729

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+  + WWG+  +HC LA+CPTA G+ V+GCPVF
Sbjct  730  MENTSINWWGTGGEHCDLATCPTAKGVQVDGCPVF  764



>ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2 [Cucumis sativus]
 gb|KGN60282.1| hypothetical protein Csa_3G893320 [Cucumis sativus]
Length=742

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P SM++ Q +GTL++G VN+AV WW+L SIENIC    L PNSPWTCP  RV FDAS
Sbjct  528  KIPPISMFIVQCIGTLIAGTVNMAVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFFDAS  587

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W F+ GA+ P+ VW+L K FP+ KWI LIN+PV+    
Sbjct  588  VIWGLVGPKRIFGSLGNYAALNWFFIGGAIGPILVWLLQKTFPKHKWISLINLPVLLGST  647

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F L 
Sbjct  648  AIMPPATAVNFNCWIIVGTIFNFFVFRYRKEWWQRYNYVLSAALDAGLAFMGVLLYFTLT  707

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E K L WWGS+ +HC LA+CPTA GIVV+GCPVF
Sbjct  708  MEDKGLTWWGSDGEHCELANCPTAKGIVVDGCPVF  742



>ref|XP_012074612.1| PREDICTED: oligopeptide transporter 4-like [Jatropha curcas]
Length=552

 Score =   280 bits (717),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 160/209 (77%), Gaps = 0/209 (0%)
 Frame = -3

Query  886  SMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGL  707
            S ++   +GT+++G +NLAV WW+L SI NIC  D L PNSPWTCP  RV FDASVIWGL
Sbjct  343  SSHLFTFIGTILAGTINLAVAWWLLNSIHNICQDDLLPPNSPWTCPGDRVFFDASVIWGL  402

Query  706  IGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPP  527
            +GPKR+FG  G Y+ + W FL GAV P  VWVL K FP++ WIPLIN+PV+      MPP
Sbjct  403  VGPKRIFGSLGNYQAMNWFFLGGAVGPFIVWVLHKSFPKQSWIPLINLPVLLGSTGSMPP  462

Query  526  ATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKE  347
            AT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++  E++ 
Sbjct  463  ATAVNYNSWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSVGMENRS  522

Query  346  LKWWGSELDHCPLASCPTAPGIVVEGCPV  260
            L WWG+E +HC LA+CPTA GIVV+GCPV
Sbjct  523  LNWWGTEGEHCDLATCPTAKGIVVDGCPV  551



>ref|XP_008800083.1| PREDICTED: oligopeptide transporter 4-like [Phoenix dactylifera]
Length=748

 Score =   285 bits (729),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 165/215 (77%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q VGT+++G +NLAV WW+LGS+ENIC+   L  NSPWTCP  RV FDAS
Sbjct  534  KIPPKSMFIVQFVGTIIAGTINLAVAWWLLGSVENICNDQLLPANSPWTCPGDRVFFDAS  593

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y  L W F+ GA+ P+ VW+  K+FP + WIPLIN+PV+    
Sbjct  594  VIWGLVGPRRIFGPLGNYGALNWFFVGGALGPIIVWIFHKIFPGQTWIPLINLPVLLGAT  653

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWIV G +FN+FV++YRK WW++YNY+LSAALDAG AFM V+L+FAL 
Sbjct  654  AAMPPATSVNYNSWIVVGTVFNFFVYRYRKKWWERYNYILSAALDAGVAFMGVVLYFALS  713

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+  + WWG+  +HCPLA+CPTA G+ V+GCPVF
Sbjct  714  LENVSIDWWGTAGEHCPLATCPTARGVQVDGCPVF  748



>gb|AES90550.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=718

 Score =   284 bits (727),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 163/215 (76%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L S++NIC+ D L   SPWTCP  RV FDAS
Sbjct  504  KIPPRSMFLVQFIGTVLAGTINIGVAWWLLDSVKNICNKDLLPKGSPWTCPSDRVFFDAS  563

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            V+WGL+GPKR+FG  G Y  L W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  564  VVWGLVGPKRIFGSLGEYSTLNWFFLGGAIGPILVWLLHKAFPKQSWIPLINLPVLLGAT  623

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+ AL 
Sbjct  624  GMMPPATALNYNSWIIVGTIFNFFIFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYLALG  683

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+  L WWG+  +HCPLA+CPTA GIVV+GCPVF
Sbjct  684  LENVSLNWWGTAGEHCPLAACPTAKGIVVDGCPVF  718



>gb|KJB58809.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=482

 Score =   278 bits (710),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 161/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L S+ENIC  + L  NSPWTCP  +V FDAS
Sbjct  264  KIPPRSMFLVQFIGTMLAGTINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDAS  323

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+    
Sbjct  324  VIWGLVGPKRIFGSLGEYSTLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGAT  383

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VL++ AL 
Sbjct  384  GNMPPATPLNYTSWIIVGTIFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALG  443

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E K L WWG+  D    HC LA+CPTA GI+VEGCP+F
Sbjct  444  VESKSLHWWGASPDVVPEHCDLATCPTAKGILVEGCPIF  482



>ref|XP_003593303.1| Oligopeptide transporter [Medicago truncatula]
 gb|ABN05713.1| Peptidase aspartic, active site; Oligopeptide transporter OPT 
superfamily [Medicago truncatula]
 gb|AES63554.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=729

 Score =   284 bits (727),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L S+ENIC  D L   SPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTMLAGTINIGVAWWLLNSVENICHDDLLPEGSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W F+ GA+ P+ VW+L K FP + WI LIN+PV+    
Sbjct  575  VIWGLVGPKRIFGSKGNYSAMNWFFIGGAIGPIIVWLLHKAFPRQSWIALINLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  SWI  G IFN+FVF+YRK WWQ+YNYVLSAALD G AFM VLL+F+L 
Sbjct  635  AMMPPATPLNYNSWIFVGTIFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLS  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ + WWG+E +HCPLASCPTA GI V+GCPV
Sbjct  695  LENRSISWWGTEGEHCPLASCPTAKGIAVDGCPV  728



>ref|XP_002283691.1| PREDICTED: oligopeptide transporter 2 [Vitis vinifera]
Length=740

 Score =   284 bits (727),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+V Q +GT+++G VN+ V WW+L SIENIC    L PNSPWTCP  RV +DAS
Sbjct  526  KIPPRSMFVVQFIGTIIAGTVNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FL+GA+ PV VW+L K FP +KWI L+N+PV+    
Sbjct  586  VIWGLVGPRRIFGDLGDYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGAT  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  646  GAMPPATTLNFNAWIFVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLT  705

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
              ++ + WWG+E +HC LASCPTA GIVV+GCPV
Sbjct  706  MANRSISWWGAEGEHCGLASCPTAKGIVVDGCPV  739



>ref|XP_008219191.1| PREDICTED: oligopeptide transporter 2-like [Prunus mume]
Length=729

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P SM++ Q +GTL++G VN+ V WW+L +IENIC    L PNSPWTCP  RV FDAS
Sbjct  515  KIPPISMFIVQCIGTLIAGTVNVGVAWWLLSTIENICQDQLLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y+ L W FLIGA+ P+ VW+L K FP KKWI LIN+PV+    
Sbjct  575  VIWGLVGPRRIFGSLGNYKALNWFFLIGALGPLLVWLLHKAFPSKKWIKLINLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WIV G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  635  AVMPPATTVNFNCWIVVGAIFNFFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLT  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
               K + WWG+  +HC LA+CPTA GIVV+GCPV+
Sbjct  695  MNEKSISWWGTNGEHCELATCPTAKGIVVDGCPVY  729



>emb|CAN81605.1| hypothetical protein VITISV_025060 [Vitis vinifera]
Length=739

 Score =   284 bits (727),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+V Q +GT+++G VN+ V WW+L SIENIC    L PNSPWTCP  RV +DAS
Sbjct  525  KIPPRSMFVVQFIGTIIAGTVNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDAS  584

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FL+GA+ PV VW+L K FP +KWI L+N+PV+    
Sbjct  585  VIWGLVGPRRIFGDLGDYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGAT  644

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  645  GAMPPATTLNFNAWIFVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLT  704

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
              ++ + WWG+E +HC LASCPTA GIVV+GCPV
Sbjct  705  MANRSISWWGAEGEHCGLASCPTAKGIVVDGCPV  738



>ref|XP_007042780.1| Oligopeptide transporter 4 [Theobroma cacao]
 gb|EOX98611.1| Oligopeptide transporter 4 [Theobroma cacao]
Length=941

 Score =   288 bits (736),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 165/214 (77%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SIENIC  D L  +SPWTCP  RV FDAS
Sbjct  727  KIPPRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICHDDLLPADSPWTCPGDRVFFDAS  786

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G YR + W F+ GAV PV VW+L K FP++ WIPLIN+PV+    
Sbjct  787  VIWGLVGPKRIFGSLGNYRAMNWFFVGGAVGPVIVWLLHKTFPKQSWIPLINLPVLLGAT  846

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++ 
Sbjct  847  GMMPPATPLNYNAWIIVGTIFNFFIFRYRKHWWQRYNYILSAALDAGVAFMAILLYFSVG  906

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ L WWG+  +HC LA+CPTA GI VEGCPV
Sbjct  907  MENRSLTWWGTGGEHCELATCPTAKGIAVEGCPV  940



>gb|KJB32170.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=754

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDAS
Sbjct  540  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDAS  599

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  600  VIWGLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGAT  659

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++ 
Sbjct  660  GMMPPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVG  719

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  720  MENRSVTWWGTEGEHCKLATCPTAKGIMVDGCPV  753



>ref|XP_010030911.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=739

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDAS
Sbjct  525  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDAS  584

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y+ + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  585  VIWGLVGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGAT  644

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAALDAGTAFMAVLL+F++ 
Sbjct  645  GMMPPATPLNYNAWVLVGTIFNFFVFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFSVG  704

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+K + WWG+  +HC LA+CPTA GI V+GCP+
Sbjct  705  MENKSITWWGTNGEHCELAACPTAKGIEVDGCPI  738



>emb|CBI35438.3| unnamed protein product [Vitis vinifera]
Length=693

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L +I+NIC  + L P+SPWTCP  RV FDAS
Sbjct  479  KIPPRSMFLVQFIGTILAGTINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDAS  538

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y ++ W FL GA+ PV VWV  K FP++ WIPLIN+PV+    
Sbjct  539  VIWGLVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGAT  598

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            + MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAA+DAG AFMAVLL+F+L 
Sbjct  599  SMMPPATSLNYNSWILVGTIFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLG  658

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG++ +HC LA+CPTA GIVV+GCPV
Sbjct  659  IEEKGLTWWGTDGEHCKLATCPTAKGIVVDGCPV  692



>ref|XP_006486776.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=736

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 165/214 (77%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDAS
Sbjct  522  KIPPRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDAS  581

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W F+ GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  582  VIWGLVGPKRIFGSQGNYPAMNWFFVGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGAT  641

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++ 
Sbjct  642  GMMPPATAVNYNSWIIVGTIFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVG  701

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  702  MEDKGLSWWGTEGEHCDLATCPTAKGILVDGCPV  735



>ref|XP_002971556.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
 gb|EFJ27305.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
Length=743

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -3

Query  889  RSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWG  710
            RSM+  Q +GT+V+ +VN+   WW+LGSIENICD   L PNSPWTCP  RV FDASVIWG
Sbjct  533  RSMFHVQFIGTIVAAIVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWG  592

Query  709  LIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMP  530
            LIGPKR+FG  G Y+ L W FL GA+ PV VW+ S+ FP  KWIPLIN+PVI    A MP
Sbjct  593  LIGPKRMFGSHGEYKELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMP  652

Query  529  PATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHK  350
            PAT  N  SW + G+IF+YF+F+Y KGWWQ+YNYV SAA+DAG AFM VLL+  L  E++
Sbjct  653  PATSVNYISWSIVGIIFSYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENR  712

Query  349  ELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             L WWG+ +D+CPLA CPTA GIV+ GCPV+
Sbjct  713  SLSWWGNNVDNCPLADCPTAKGIVIAGCPVY  743



>gb|KJB58808.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 162/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VNL V WW+L ++ENIC  D L  NSPWTCP  RV FDAS
Sbjct  536  KIPPRSMFLVQFIGTVLAGTVNLGVAWWLLTTVENICHRDLLPANSPWTCPGDRVFFDAS  595

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G+Y +L W FL G + PV VW+L K FP + WIPLIN+PV+    
Sbjct  596  VIWGLVGPKRIFGSQGVYSSLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGAT  655

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFM VLL+FAL 
Sbjct  656  GNMPPATPLNYTSWILIGTIFNFFVFRYRKRWWQRYNYILSAALDAGVAFMTVLLYFALG  715

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E+K L WWG+  D    HC LASCPTA GI  EGCP+F
Sbjct  716  IENKSLNWWGASPDFFPEHCDLASCPTAKGISAEGCPIF  754



>ref|XP_008466130.1| PREDICTED: oligopeptide transporter 2 [Cucumis melo]
Length=741

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 160/215 (74%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P SM++ Q +GTL++G VN+AV WW+L SIENIC    L PNSPWTCP  RV FDAS
Sbjct  527  KIPPISMFIVQCIGTLIAGTVNMAVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFFDAS  586

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W F+ GA+ P+ VW+L K FP  KWI LIN+PV+    
Sbjct  587  VIWGLVGPKRIFGSLGNYAALNWFFVGGAIGPLLVWLLQKAFPNHKWISLINLPVLLGST  646

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F L 
Sbjct  647  AIMPPATAVNFNCWIIVGTIFNFFVFRYRKEWWQRYNYVLSAALDAGLAFMGVLLYFTLT  706

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E K L WWGS+ +HC LA+CPTA GIVV+GCPVF
Sbjct  707  MEDKGLTWWGSDGEHCDLANCPTAKGIVVDGCPVF  741



>ref|XP_003608353.1| Oligopeptide transporter [Medicago truncatula]
Length=739

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 163/215 (76%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L S++NIC+ D L   SPWTCP  RV FDAS
Sbjct  525  KIPPRSMFLVQFIGTVLAGTINIGVAWWLLDSVKNICNKDLLPKGSPWTCPSDRVFFDAS  584

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            V+WGL+GPKR+FG  G Y  L W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  585  VVWGLVGPKRIFGSLGEYSTLNWFFLGGAIGPILVWLLHKAFPKQSWIPLINLPVLLGAT  644

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+ AL 
Sbjct  645  GMMPPATALNYNSWIIVGTIFNFFIFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYLALG  704

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+  L WWG+  +HCPLA+CPTA GIVV+GCPVF
Sbjct  705  LENVSLNWWGTAGEHCPLAACPTAKGIVVDGCPVF  739



>ref|XP_008338986.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=733

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 160/215 (74%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P SM++ Q +GT+++G VN+ V W +L SIENIC    L PNSPWTCP  RV FDAS
Sbjct  519  KIPPISMFIVQCIGTIIAGTVNIXVAWXLLSSIENICQDQLLPPNSPWTCPGDRVFFDAS  578

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y+ L W FLIGA+ P+ VW+L K FP +KWI LIN+PV+    
Sbjct  579  VIWGLVGPKRIFGSLGNYKALNWFFLIGALGPLLVWLLHKAFPSQKWIKLINLPVLLGAT  638

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WIV G IFNYFVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  639  AAMPPATTVNFNCWIVVGTIFNYFVFRYRKQWWQRYNYVLSAALDAGVAFMGVLLYFSLT  698

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
               K + WWG+  +HC LA+CPTA GIVV+GCPV+
Sbjct  699  TYEKSISWWGTNGEHCDLATCPTAKGIVVDGCPVY  733



>gb|KJB32169.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=753

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDAS
Sbjct  539  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDAS  598

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  599  VIWGLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGAT  658

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++ 
Sbjct  659  GMMPPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVG  718

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  719  MENRSVTWWGTEGEHCKLATCPTAKGIMVDGCPV  752



>ref|XP_007225210.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
 gb|EMJ26409.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
Length=729

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 160/215 (74%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P SM++ Q +GTL++G VNL V WW+L +IENIC    L PNSPWTCP  RV FDAS
Sbjct  515  KIPPISMFIVQCIGTLIAGTVNLGVAWWLLSTIENICQDQLLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y+ L W FLIGA  P+ VW+L K FP KKWI LIN+PV+    
Sbjct  575  VIWGLVGPRRIFGSLGNYKALNWFFLIGASGPLLVWLLHKAFPSKKWIKLINLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WIV G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  635  AVMPPATTVNFNCWIVVGAIFNFFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLT  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
               K + WWG+  +HC LA+CPTA GIVV+GCP++
Sbjct  695  MNEKSISWWGTNGEHCELATCPTAKGIVVDGCPLY  729



>ref|XP_010112260.1| Oligopeptide transporter 4 [Morus notabilis]
 gb|EXC33016.1| Oligopeptide transporter 4 [Morus notabilis]
Length=742

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 164/214 (77%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L ++ENIC  + L  NSPWTCP  RV FDAS
Sbjct  528  KIPPRSMFIVQFLGTILAGTINLAVAWWLLTTVENICQDNLLPTNSPWTCPGDRVFFDAS  587

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GAV PV +W+L K FP++ WIPLIN+PV+    
Sbjct  588  VIWGLVGPKRIFGSQGNYAAMNWFFLGGAVGPVIIWLLHKAFPKQTWIPLINLPVLLGAT  647

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++ 
Sbjct  648  AMMPPATSLNFNSWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSVG  707

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG++ +HC LA+CPTA GI+ +GCP+
Sbjct  708  LEDKSLTWWGTDGEHCELATCPTAKGIIKDGCPL  741



>ref|XP_007159179.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris]
 gb|ESW31173.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris]
Length=738

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 164/215 (76%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N  V WW+L S+ NIC  D L  +SPWTCP   V FDAS
Sbjct  524  KIPPRSMFLVQFIGTMLAGSINTGVAWWLLNSVHNICHRDLLPEDSPWTCPSDHVFFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y+ L W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  584  VIWGLVGPRRIFGSHGNYQALNWFFLGGAIGPILVWLLHKAFPKQSWIPLINLPVLLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  +WI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+ 
Sbjct  644  GMMPPATALNYNAWIIIGTIFNFFVFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYFAVG  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+K + WWG++ +HCPLA+CPTA GIVV+GCPV+
Sbjct  704  LENKSISWWGNDGEHCPLATCPTAKGIVVDGCPVY  738



>ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=744

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L +I+NIC  + L P+SPWTCP  RV FDAS
Sbjct  530  KIPPRSMFLVQFIGTILAGTINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDAS  589

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y ++ W FL GA+ PV VWV  K FP++ WIPLIN+PV+    
Sbjct  590  VIWGLVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGAT  649

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            + MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAA+DAG AFMAVLL+F+L 
Sbjct  650  SMMPPATSLNYNSWILVGTIFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLG  709

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG++ +HC LA+CPTA GIVV+GCPV
Sbjct  710  IEEKGLTWWGTDGEHCKLATCPTAKGIVVDGCPV  743



>ref|XP_003528403.1| PREDICTED: oligopeptide transporter 4-like [Glycine max]
Length=746

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L SI NIC  D L   SPWTCP  RV FDAS
Sbjct  532  KIPPRSMFLVQFIGTMLAGTINICVAWWLLNSINNICHKDLLPEGSPWTCPSDRVFFDAS  591

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP R+FG  G Y+ L W F  GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  592  VIWGLVGPLRIFGSHGDYQALNWFFFGGAIGPILVWILHKSFPKQSWIPLINLPVLLGAT  651

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+F L 
Sbjct  652  GMMPPATPLNYNAWIIVGTIFNFFIFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYFTLG  711

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+  L WWG+  +HCPLA+CPTA GIVV+GCPV+
Sbjct  712  LENTSLNWWGTAGEHCPLATCPTAKGIVVDGCPVY  746



>emb|CAN61122.1| hypothetical protein VITISV_038682 [Vitis vinifera]
Length=583

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT ++G +N+AV WW+L +I+NIC  + L P+SPWTCP  RV FDAS
Sbjct  369  KIPPRSMFLVQFIGTXLAGTINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDAS  428

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y ++ W FL GA+ PV VWV  K FP++ WIPLIN+PV+    
Sbjct  429  VIWGLVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGAT  488

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            + MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAA+DAG AFMAVLL+F+L 
Sbjct  489  SMMPPATSLNYNSWILVGTIFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLG  548

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA+CPTA GIVV GCPV
Sbjct  549  IEEKGLTWWGTXGEHCKLATCPTAKGIVVXGCPV  582



>ref|XP_008803571.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =   283 bits (724),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 162/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+LGSI NIC +D L  NSPWTCP  RV FDAS
Sbjct  549  KIPPRSMFLVQFIGTIIAGTINLAVAWWLLGSITNICQSDLLPENSPWTCPSDRVFFDAS  608

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y  L W F +GA+ P+ VW+  ++FP + WIPLIN+PV+    
Sbjct  609  VIWGLVGPRRIFGPLGNYAALNWFFAVGALGPIIVWIFHRLFPSQTWIPLINLPVLFGAT  668

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  +W+  G +FN+FVF+YRK WW++YNY+LSAALDAG AFM VLL+F L 
Sbjct  669  AYMPPATALNYTAWVTVGTVFNFFVFRYRKKWWERYNYILSAALDAGVAFMGVLLYFTLN  728

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+  L WWG+  +HC LA+CPTA G+ V+GCPVF
Sbjct  729  LENTSLNWWGTGGEHCDLATCPTAKGVRVDGCPVF  763



>gb|EMS45133.1| Oligopeptide transporter 4 [Triticum urartu]
Length=681

 Score =   281 bits (718),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 163/218 (75%), Gaps = 3/218 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q  GTLV+G VNL+V WW+LGS+ENIC    L P+SPWTCP  RV FDAS
Sbjct  464  KIPPRSMFIVQFAGTLVAGTVNLSVAWWLLGSVENICQDQLLPPDSPWTCPGDRVFFDAS  523

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FGP G Y  + W FLIGA  PV V++  ++FP ++WI +IN+PV+    
Sbjct  524  VIWGLVGPKRIFGPHGNYEAVNWFFLIGAAGPVIVYIFHRIFPSQRWILMINLPVLIGAT  583

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L 
Sbjct  584  ANMPPATAVNYNSWLLIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLT  643

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E++ + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  644  MENRTVNWWGTAGEHCPLASCPTAKGVDLGPDSVCPVF  681



>gb|KCW56911.1| hypothetical protein EUGRSUZ_I02587 [Eucalyptus grandis]
Length=739

 Score =   282 bits (722),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 164/214 (77%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDAS
Sbjct  525  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDAS  584

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y+ + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  585  VIWGLVGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGAT  644

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MP ATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+ 
Sbjct  645  GMMPAATPLNYSAWILVGTIFNFFIFRYRKQWWQRYNYVLSAALDAGVAFMAVLLYFAVN  704

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+K L WWG+  +HC LA+CPTA GI V+GCPV
Sbjct  705  IENKSLTWWGTNGEHCELAACPTAKGIEVDGCPV  738



>gb|AAM64614.1| Isp4-like protein [Arabidopsis thaliana]
Length=729

 Score =   282 bits (721),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  695  MEEKSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_002866614.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42873.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score =   281 bits (720),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  695  MEEKSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|NP_201246.1| oligopeptide transporter 4 [Arabidopsis thaliana]
 sp|Q9FME8.1|OPT4_ARATH RecName: Full=Oligopeptide transporter 4; Short=AtOPT4 [Arabidopsis 
thaliana]
 dbj|BAB09872.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAM20694.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAN15658.1| Isp4-like protein [Arabidopsis thaliana]
 dbj|BAE99084.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AED97890.1| oligopeptide transporter 4 [Arabidopsis thaliana]
Length=729

 Score =   281 bits (720),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  695  MEEKSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_010444374.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  695  MEEKSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_006394156.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
 gb|ESQ31442.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
Length=729

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKRSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA+CPTA G++V+GCPV
Sbjct  695  MEEKTLDWWGTRGEHCDLATCPTARGVIVDGCPV  728



>ref|XP_010461766.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  695  MEEKSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>emb|CBI19305.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   281 bits (718),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 166/219 (76%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDAS
Sbjct  482  KIPPRSMFLVQLIGTILAGTVNLGVALWLLDSIDNICQDNLLPANSPWTCPSDRVFFDAS  541

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP++ WIPLIN+PV+    
Sbjct  542  VIWGLVGPKRVFGSLGNYGALNWFFLGGLLGPVAVWLLHKKFPKQSWIPLINLPVLLGAT  601

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++ +L 
Sbjct  602  ASMPPATPVNYNAWILIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYVSLG  661

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E+K L WWG++ D    HCPLASCPTA G++V+GCPVF
Sbjct  662  IENKNLHWWGADPDIDPEHCPLASCPTAKGVIVDGCPVF  700



>ref|XP_010484229.1| PREDICTED: oligopeptide transporter 4 [Camelina sativa]
Length=729

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  695  MEEKSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_010104576.1| Oligopeptide transporter 2 [Morus notabilis]
 gb|EXC01177.1| Oligopeptide transporter 2 [Morus notabilis]
Length=724

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 159/215 (74%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P SM+V Q VGT+++G VN+ V WW+L ++ENIC    L PNSPWTCP  RV FDAS
Sbjct  510  KIPPISMFVVQCVGTIIAGTVNIGVAWWLLHTVENICQDQLLPPNSPWTCPGDRVFFDAS  569

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FLIG + P+ VW+L K FP +KWI  +N+PV+    
Sbjct  570  VIWGLVGPKRIFGSEGNYSQLNWFFLIGVMGPLLVWLLHKAFPSQKWIKFVNLPVLFGAT  629

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G +FN+FVF+YRK WWQKYNYVLSAALDAG AFM V+L+F L 
Sbjct  630  AVMPPATTVNFNCWIIVGTVFNFFVFRYRKQWWQKYNYVLSAALDAGLAFMGVVLYFTLT  689

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E + L WWG++ +HC LA+CPTA GIVV+GCPVF
Sbjct  690  MEDRSLSWWGADGEHCELATCPTAKGIVVDGCPVF  724



>ref|XP_006280078.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
 gb|EOA12976.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
Length=729

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  695  MEEKSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_002967106.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
 gb|EFJ31705.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
Length=739

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 163/217 (75%), Gaps = 1/217 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+  Q+VGT+++  VN+ V WW+L  I+NICDT+ L  +SPWTCP  RV FDAS
Sbjct  523  KIPPRSMFTVQIVGTIIAATVNMGVAWWLLNGIDNICDTEKLPASSPWTCPSDRVFFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FLIG + P+PVW+LS+  P+ +++  +NIPVI    
Sbjct  583  VIWGLVGPKRIFGSLGEYSQLSWFFLIGILAPIPVWILSRALPKVEFLRYVNIPVILGAT  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  +WI  G++FNYFV+KYRK WW++YNYVLSAALDAG+AFMAV+L+F+L 
Sbjct  643  GYMPPATSVNYTTWITLGVVFNYFVYKYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLG  702

Query  361  NEHKELKWWG-SELDHCPLASCPTAPGIVVEGCPVFK  254
             E   L WWG S+ DHCPLA CPT PGIVV+GCPV+ 
Sbjct  703  LEDVSLTWWGTSDRDHCPLAKCPTQPGIVVDGCPVYS  739



>emb|CBI19303.3| unnamed protein product [Vitis vinifera]
Length=859

 Score =   284 bits (726),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+V Q +GT+++G VN+ V WW+L SIENIC    L PNSPWTCP  RV +DAS
Sbjct  645  KIPPRSMFVVQFIGTIIAGTVNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDAS  704

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FL+GA+ PV VW+L K FP +KWI L+N+PV+    
Sbjct  705  VIWGLVGPRRIFGDLGDYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGAT  764

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  765  GAMPPATTLNFNAWIFVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLT  824

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
              ++ + WWG+E +HC LASCPTA GIVV+GCPV
Sbjct  825  MANRSISWWGAEGEHCGLASCPTAKGIVVDGCPV  858



>ref|XP_002960906.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
 gb|EFJ38445.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
Length=739

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 163/217 (75%), Gaps = 1/217 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+  Q+VGT+++  VN+ V WW+L  I+NICDT+ L  +SPWTCP  RV FDAS
Sbjct  523  KIPPRSMFTVQIVGTIIAATVNMGVAWWLLNGIDNICDTEKLPASSPWTCPSDRVFFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FLIG + P+PVW+LS+  P+ +++  +NIPVI    
Sbjct  583  VIWGLVGPKRIFGSLGEYSQLSWFFLIGILAPIPVWILSRALPKVEFLRYVNIPVILGAT  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  +WI  G++FNYFV+KYRK WW++YNYVLSAALDAG+AFMAV+L+F+L 
Sbjct  643  GYMPPATSVNYTTWITLGVVFNYFVYKYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLG  702

Query  361  NEHKELKWWG-SELDHCPLASCPTAPGIVVEGCPVFK  254
             E   L WWG S+ DHCPLA CPT PGIVV+GCPV+ 
Sbjct  703  LEDVSLTWWGTSDRDHCPLAKCPTQPGIVVDGCPVYS  739



>ref|XP_010520694.1| PREDICTED: oligopeptide transporter 4 [Tarenaya hassleriana]
Length=756

 Score =   282 bits (721),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VNL+V WW L SIENIC  D L P+SPWTCP  RV FDAS
Sbjct  542  KIPPRSMFLVQFIGTILAGTVNLSVAWWQLSSIENICQEDLLPPDSPWTCPGDRVFFDAS  601

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W F+ GA+ P+ VW+L K FP + WIPLIN+PV+    
Sbjct  602  VIWGLVGPKRIFGSQGNYAAMNWFFVGGALGPIIVWMLHKSFPNQSWIPLINLPVLLGAT  661

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            + MPPAT  N  SWI+ G +FN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+F L 
Sbjct  662  SMMPPATAVNYNSWILVGTVFNFFVFRYRKQWWQRYNYVLSAALDAGVAFMAVLLYFTLG  721

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E   L WWG++ +HC LA CPTA GI V+GCPV
Sbjct  722  MEGIRLSWWGTDGEHCNLAKCPTAEGISVDGCPV  755



>ref|XP_003545740.1| PREDICTED: oligopeptide transporter 4 [Glycine max]
Length=736

 Score =   281 bits (719),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 161/213 (76%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L   SPWTCP  RV FDAS
Sbjct  522  KIPPRSMFLVQFIGTMLAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDAS  581

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GAV P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  582  VIWGLVGPKRIFGSQGNYSAMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGAT  641

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+FAL 
Sbjct  642  GMMPPATPLNYNAWIFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFALG  701

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E+K L WWG++ +HCPLA CPTA G++V+GCP
Sbjct  702  LENKSLNWWGNDGEHCPLAVCPTAKGVIVDGCP  734



>ref|XP_002283674.1| PREDICTED: oligopeptide transporter 4-like [Vitis vinifera]
Length=754

 Score =   281 bits (720),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 166/219 (76%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDAS
Sbjct  536  KIPPRSMFLVQLIGTILAGTVNLGVALWLLDSIDNICQDNLLPANSPWTCPSDRVFFDAS  595

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP++ WIPLIN+PV+    
Sbjct  596  VIWGLVGPKRVFGSLGNYGALNWFFLGGLLGPVAVWLLHKKFPKQSWIPLINLPVLLGAT  655

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++ +L 
Sbjct  656  ASMPPATPVNYNAWILIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYVSLG  715

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E+K L WWG++ D    HCPLASCPTA G++V+GCPVF
Sbjct  716  IENKNLHWWGADPDIDPEHCPLASCPTAKGVIVDGCPVF  754



>ref|XP_007148333.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
 gb|ESW20327.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
Length=738

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 163/213 (77%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L  +SPWTCP  RV FDAS
Sbjct  524  KIPPRSMFLVQFIGTMLAGTINIGVAWWLLNSIKNICHDDLLPADSPWTCPGDRVFFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+P++    
Sbjct  584  VIWGLVGPKRIFGSQGNYSAMNWFFLGGALGPVIVWLLHKAFPKQSWIPLINLPILLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+F L 
Sbjct  644  GMMPPATPLNYNAWILVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFTLG  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E++ L WWG++ +HCPLA+CPTA GI+V+GCP
Sbjct  704  LENRSLNWWGNDGEHCPLAACPTAKGIIVDGCP  736



>gb|EMT05383.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=570

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 164/218 (75%), Gaps = 3/218 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+V Q VGT+V+G +NL+V WW+LGS+ENIC  + LS NSPWTCP  RV FDAS
Sbjct  353  KIPPRSMFVVQFVGTIVAGTINLSVAWWLLGSVENICHIEKLSANSPWTCPNDRVFFDAS  412

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y  + + FLIGA  P  V++  ++FP+KKWI LIN+PV+    
Sbjct  413  VIWGLVGPRRIFGPLGNYAAINYFFLIGAASPFVVYIFHRIFPDKKWILLINLPVLINAT  472

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+YRK WWQ+YNY+ SAA+DAG AFMAVLL+FAL 
Sbjct  473  ASMPPATAVNYNSWLLVGTIFNFFVFRYRKRWWQRYNYIFSAAMDAGVAFMAVLLYFALT  532

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             +++ + WWG+  +HCPLA CPT+ G+ +     CPVF
Sbjct  533  MQNRSIVWWGTAGEHCPLAICPTSKGVDLGPESVCPVF  570



>gb|KHN33580.1| Oligopeptide transporter 4 [Glycine soja]
Length=773

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 161/213 (76%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L   SPWTCP  RV FDAS
Sbjct  559  KIPPRSMFLVQFIGTMLAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDAS  618

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GAV P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  619  VIWGLVGPKRIFGSQGNYSAMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGAT  678

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+FAL 
Sbjct  679  GMMPPATPLNYNAWIFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFALG  738

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E+K L WWG++ +HCPLA CPTA G++V+GCP
Sbjct  739  LENKSLNWWGNDGEHCPLAVCPTAKGVIVDGCP  771



>ref|XP_001767301.1| predicted protein [Physcomitrella patens]
 gb|EDQ67982.1| predicted protein [Physcomitrella patens]
Length=690

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 157/215 (73%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR+M+ AQL+GT+++ V+NL   WW+L S+ +IC  D L  NSPWTCP   + +DAS
Sbjct  476  KIPPRAMFHAQLLGTVIAAVLNLGTAWWLLTSVPDICQQDLLPANSPWTCPGDTIFYDAS  535

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKR+FG  GLY  + W FL GA+ PVP WVL K+FP+KKWI  I  PV+    
Sbjct  536  VIWGLIGPKRMFGSLGLYNAVNWFFLFGALAPVPFWVLHKIFPDKKWITYIYTPVLIGAT  595

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SW + G IFN+ VFKYRKGWWQ+YNY+LSAALDAG AFM VLL+F LQ
Sbjct  596  GMMPPATAVNYTSWFLIGYIFNHLVFKYRKGWWQRYNYILSAALDAGLAFMGVLLYFVLQ  655

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E K + WWG  LD+CPLA+CPTAPG+   GCPVF
Sbjct  656  LEDKNMSWWGENLDNCPLAACPTAPGVTRNGCPVF  690



>gb|KCW63396.1| hypothetical protein EUGRSUZ_G01042, partial [Eucalyptus grandis]
Length=720

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN+AV WW+L SI NIC  + L P+SPWTCP  RV FDAS
Sbjct  506  KIPPRSMFLVQFIGTIIAGTVNMAVAWWLLNSITNICQIELLPPDSPWTCPNDRVFFDAS  565

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL GPKR+FG  G Y+ + W FL GAV P  VW+L K FP+K WIPLIN+PV+    
Sbjct  566  VIWGLAGPKRIFGVQGNYQAMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGAT  625

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAA+DAG AFM VLL+F L 
Sbjct  626  GNMPPATPLNYNAWVLVGTIFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLG  685

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+K L WWG+  +HC LASCPTA GI ++GCP 
Sbjct  686  MENKGLNWWGTGGEHCDLASCPTAKGISMDGCPT  719



>gb|EPS59040.1| hypothetical protein M569_15770, partial [Genlisea aurea]
Length=538

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L +I++IC  D L PNSPWTCP  RV FDAS
Sbjct  324  KIPPRSMFIVQALGTIIAGTINIGVAWWLLTTIKDICHPDLLPPNSPWTCPSDRVFFDAS  383

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y ++ W FL GA+ P  VW+L K FP + WIPLIN+PV+    
Sbjct  384  VIWGLVGPRRIFGKLGNYGSMNWFFLGGAIGPFFVWLLHKAFPRQAWIPLINLPVLLGAT  443

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSA LDAG AFMAVL++FAL 
Sbjct  444  GAMPPATPLNYNAWIIVGTIFNFFVFRYRKRWWQRYNYILSAGLDAGVAFMAVLVYFALG  503

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+  + WWG+  DHC  A+CPTA GI V+GCP++
Sbjct  504  IENVSINWWGTAGDHCTFATCPTAKGIQVDGCPIY  538



>ref|XP_007148334.1| hypothetical protein PHAVU_006G200100g [Phaseolus vulgaris]
 gb|ESW20328.1| hypothetical protein PHAVU_006G200100g [Phaseolus vulgaris]
Length=734

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 163/213 (77%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L  +SPWTCP  RV FDAS
Sbjct  520  KIPPRSMFLVQFIGTMLAGTINIGVAWWLLNSIKNICHDDLLPADSPWTCPGDRVFFDAS  579

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  580  VIWGLVGPKRIFGSQGNYSAMNWFFLGGALGPVIVWLLHKAFPKQSWIPLINLPVLLGAT  639

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+F L 
Sbjct  640  GMMPPATPLNYNAWILVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFTLG  699

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E++ L WWG++ +HCPLA+CPTA G++V+GCP
Sbjct  700  LENRSLNWWGNDGEHCPLAACPTAKGVIVDGCP  732



>ref|XP_006422647.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
 gb|ESR35887.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
Length=692

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDAS
Sbjct  478  KIPPRSMFLVQFIGTILAGTINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDAS  537

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL GPKR+FG  G Y  + W F+ GA+ PV VW+L K FP++ WI LIN+PV+    
Sbjct  538  VIWGLAGPKRIFGSQGNYPAMNWFFVGGALGPVLVWLLHKAFPKQSWIALINLPVLLGAT  597

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++ 
Sbjct  598  GMMPPATAVNYNSWIIVGTIFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVG  657

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+E +HC LA+CPTA GI+++GCPV
Sbjct  658  MEDKGLSWWGTEGEHCDLATCPTAKGILIDGCPV  691



>gb|EMT16469.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=790

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 163/218 (75%), Gaps = 3/218 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q  GTLV+G VNL+V WW+LGS+ENIC    L P+SPWTCP  RV FDAS
Sbjct  573  KIPPRSMFIVQFAGTLVAGTVNLSVAWWLLGSVENICQDQLLPPDSPWTCPGDRVFFDAS  632

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FGP G Y  + W FLIGA  PV V++  ++FP ++WI +IN+PV+    
Sbjct  633  VIWGLVGPKRIFGPHGNYEAVNWFFLIGAAGPVIVYIFHRIFPSQRWILMINLPVLIGAT  692

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L 
Sbjct  693  ANMPPATAVNYNSWLLIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLT  752

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E++ + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  753  MENRTVNWWGTAGEHCPLASCPTAKGVDLGPDSVCPVF  790



>ref|XP_010065749.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=756

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN+AV WW+L SI NIC  + L P+SPWTCP  RV FDAS
Sbjct  542  KIPPRSMFLVQFIGTIIAGTVNMAVAWWLLNSITNICQIELLPPDSPWTCPNDRVFFDAS  601

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL GPKR+FG  G Y+ + W FL GAV P  VW+L K FP+K WIPLIN+PV+    
Sbjct  602  VIWGLAGPKRIFGVQGNYQAMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGAT  661

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAA+DAG AFM VLL+F L 
Sbjct  662  GNMPPATPLNYNAWVLVGTIFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLG  721

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+K L WWG+  +HC LASCPTA GI ++GCP 
Sbjct  722  MENKGLNWWGTGGEHCDLASCPTAKGISMDGCPT  755



>gb|KJB32171.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=951

 Score =   284 bits (727),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDAS
Sbjct  737  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDAS  796

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    
Sbjct  797  VIWGLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGAT  856

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++ 
Sbjct  857  GMMPPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVG  916

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  917  MENRSVTWWGTEGEHCKLATCPTAKGIMVDGCPV  950



>ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=735

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 162/216 (75%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDAS
Sbjct  520  KIPPRSMFLVQLIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDAS  579

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP K WI LIN+PV+    
Sbjct  580  VIWGLVGPKRIFGRLGNYSALNWFFLGGLIGPVLVWLLQKAFPTKTWISLINLPVLLGAT  639

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G+IFNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  640  AAMPPATSVNFNCWIIVGVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLT  699

Query  361  NEHKEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 +  WWG+  ++CPLASCPTAPGI VEGCPVF
Sbjct  700  MNGISIDHWWGANGENCPLASCPTAPGIQVEGCPVF  735



>ref|XP_003547106.1| PREDICTED: oligopeptide transporter 4-like [Glycine max]
Length=737

 Score =   280 bits (716),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 162/213 (76%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L   SPWTCP  RV FDAS
Sbjct  523  KIPPRSMFLVQFIGTILAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDAS  582

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  583  VIWGLVGPKRIFGSQGNYSAMNWFFLGGALGPIIVWLLHKAFPKQSWIPLINLPVLLGAT  642

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM V+L+F+L 
Sbjct  643  GMMPPATPLNYNAWIFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVMLYFSLG  702

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E+K L WWG++ +HCPLA+CPTA GI+V+GCP
Sbjct  703  LENKSLNWWGNDGEHCPLAACPTAKGIIVDGCP  735



>ref|XP_009130453.1| PREDICTED: oligopeptide transporter 4 [Brassica rapa]
Length=729

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L +I NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKRSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG++ +HC LA CPTA G++V+GCPV
Sbjct  695  MEDKSLDWWGTQGEHCDLARCPTARGVIVKGCPV  728



>ref|XP_006422648.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
 gb|ESR35888.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
Length=736

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDAS
Sbjct  522  KIPPRSMFLVQFIGTILAGTINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDAS  581

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL GPKR+FG  G Y  + W F+ GA+ PV VW+L K FP++ WI LIN+PV+    
Sbjct  582  VIWGLAGPKRIFGSQGNYPAMNWFFVGGALGPVLVWLLHKAFPKQSWIALINLPVLLGAT  641

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++ 
Sbjct  642  GMMPPATAVNYNSWIIVGTIFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVG  701

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+E +HC LA+CPTA GI+++GCPV
Sbjct  702  MEDKGLSWWGTEGEHCDLATCPTAKGILIDGCPV  735



>ref|XP_011627879.1| PREDICTED: oligopeptide transporter 4 isoform X4 [Amborella trichopoda]
Length=459

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L SIENIC+  AL   SPWTCP  RV FDAS
Sbjct  245  KIPPRSMFLVQFIGTVIAGTINLGVAWWLLDSIENICNKAALPKGSPWTCPGDRVFFDAS  304

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FGP G Y  L W FL GA+ PV VW+L K FP + WIPLIN+PV+    
Sbjct  305  VIWGLVGPKRIFGPLGAYPALNWFFLGGALGPVLVWLLHKAFPSQTWIPLINLPVLLGAT  364

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MP AT  N  +W+  G +FN+FVF+YRK WWQ+YNYVLSA LDAG AFM VLL+F+L 
Sbjct  365  AYMPAATALNYNAWVAVGTVFNFFVFRYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFSLS  424

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+    WWG++ +HC  A CPTA G++ +GCPV
Sbjct  425  MENNSFNWWGTDGEHCDFAVCPTAKGVIAKGCPV  458



>gb|EMT13287.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=521

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 161/218 (74%), Gaps = 3/218 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q VGT+V+G VNL V WW+LGS+ENIC    L PNSPWTCP  RV FDAS
Sbjct  304  KIPPKSMFIVQFVGTVVAGTVNLIVGWWLLGSVENICQDQLLPPNSPWTCPNDRVFFDAS  363

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP R+FG  G Y  L W FL GA  PV V++L ++FP  KWI LINIPV++   
Sbjct  364  VIWGLVGPNRIFGSNGNYIALNWFFLFGAAGPVIVYILHRIFPTHKWILLINIPVLTGAT  423

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPA+  N  SW++ G+IFN+FVF+YRK WWQ+YNY+LSA LDAG AFM VLL+F L 
Sbjct  424  ALMPPASTLNFNSWLLYGIIFNFFVFRYRKKWWQRYNYILSAGLDAGAAFMGVLLYFTLT  483

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E++ +KWWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  484  MENRTIKWWGTGGEHCPLASCPTAKGVDLGPDSVCPVF  521



>dbj|BAJ90957.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =   279 bits (714),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 162/218 (74%), Gaps = 3/218 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q  GTLV+G VNL+V WW+LGS+ENIC    L P+SPWTCP  RV FDAS
Sbjct  532  KIPPRSMFIVQFAGTLVAGTVNLSVAWWLLGSVENICQDQLLPPDSPWTCPGDRVFFDAS  591

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FLIGA  PV V++  ++FP ++WI +IN+PV+    
Sbjct  592  VIWGLVGPKRIFGSHGNYEAVNWFFLIGAAGPVIVYIFHRIFPRQRWILMINLPVLIGAT  651

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L 
Sbjct  652  ANMPPATAVNYNSWLLIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLT  711

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E++ + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  712  MENRTVNWWGTAGEHCPLASCPTAKGVDLGPDSACPVF  749



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =   279 bits (713),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 159/215 (74%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN++V W++L ++ENIC  + L PNSPWTCP  RV FDAS
Sbjct  520  KIPPRSMFLVQFIGTIIAGTVNVSVAWYLLTTVENICQKELLPPNSPWTCPGDRVFFDAS  579

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FL GA+ P+ VW+L K FP +KWI  IN+PV+    
Sbjct  580  VIWGLVGPRRIFGNLGNYPELNWFFLFGALGPLIVWILHKAFPNQKWISQINLPVLLGST  639

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G+IFNYFVFKYRK WWQ+YNYVLSAALDAG AFM VLL+F L 
Sbjct  640  AAMPPATSVNFNCWIIIGVIFNYFVFKYRKSWWQRYNYVLSAALDAGLAFMGVLLYFTLS  699

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 + WWGS  ++CPLASCPTA G+ VEGCP F
Sbjct  700  MNDISISWWGSNGENCPLASCPTAEGVEVEGCPAF  734



>ref|XP_010029956.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=743

 Score =   279 bits (714),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDAS
Sbjct  529  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPDDRVFFDAS  588

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y+ + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  589  VIWGLVGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGAT  648

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MP ATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+ 
Sbjct  649  GMMPAATPLNYNAWILVGTIFNFFIFRYRKQWWQRYNYVLSAALDAGAAFMAVLLYFAVN  708

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+K + WWG+  +HC LA+CPTA GI  +GCPV
Sbjct  709  IENKSITWWGTNGEHCELAACPTAKGIEGDGCPV  742



>ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =   279 bits (714),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+ +G +N+AV WW+L SI NIC+ + L  +SPWTCP  RV FDAS
Sbjct  532  KIPPRSMFLVQFIGTIFAGTINIAVAWWLLNSIHNICEDNLLPADSPWTCPGDRVFFDAS  591

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y+ + W F+ GA+ P+ VW+  K FP+K WIPLIN+PV+    
Sbjct  592  VIWGLVGPKRIFGDLGTYKAMNWFFIGGAIGPIIVWLFHKAFPKKSWIPLINLPVLLGAT  651

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  +WI+ G IFN FVF+YRK WWQ+YNY+LSAALDAG AFM VLL+F+L 
Sbjct  652  AYMPPATTVNYNAWIIVGTIFNLFVFRYRKQWWQRYNYILSAALDAGVAFMGVLLYFSLG  711

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LASCPTA GI V+GCP+
Sbjct  712  VEDKSLTWWGTNGEHCNLASCPTAKGIAVDGCPI  745



>gb|KHG27446.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=755

 Score =   279 bits (714),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 161/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L S+ENIC  + L  NSPWTCP  +V FDAS
Sbjct  537  KIPPRSMFLVQFIGTMLAGTINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDAS  596

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+    
Sbjct  597  VIWGLVGPKRIFGSLGEYSTLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGAT  656

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VL++ AL 
Sbjct  657  GNMPPATPLNYTSWIIVGTIFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALG  716

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E K L WWG+  D    HC LA+CPTA GI+VEGCP+F
Sbjct  717  VESKSLHWWGASPDVVPEHCDLATCPTAKGILVEGCPIF  755



>gb|KJB58807.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   279 bits (713),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 161/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L S+ENIC  + L  NSPWTCP  +V FDAS
Sbjct  536  KIPPRSMFLVQFIGTMLAGTINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDAS  595

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+    
Sbjct  596  VIWGLVGPKRIFGSLGEYSTLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGAT  655

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VL++ AL 
Sbjct  656  GNMPPATPLNYTSWIIVGTIFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALG  715

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E K L WWG+  D    HC LA+CPTA GI+VEGCP+F
Sbjct  716  VESKSLHWWGASPDVVPEHCDLATCPTAKGILVEGCPIF  754



>ref|XP_011624487.1| PREDICTED: oligopeptide transporter 4, partial [Amborella trichopoda]
Length=359

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L SIENIC+  AL   SPWTCP  RV FDAS
Sbjct  145  KIPPRSMFLVQFIGTVIAGTINLGVAWWLLESIENICNKAALPKGSPWTCPGDRVFFDAS  204

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FGP G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+    
Sbjct  205  VIWGLVGPKRIFGPLGAYPALNWFFLGGVLGPVLVWLLHKAFPSQTWIPLINLPVLLGAT  264

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  +W+  G +FN+FVF+YRK WWQ+YNYVLSA LDAG AFM VLL+F L 
Sbjct  265  NYMPPATALNYNAWVAVGTVFNFFVFRYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFLLS  324

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+    WWG++ +HC  A CPTA G++ +GCPV 
Sbjct  325  MENNSFNWWGTDGEHCDFAVCPTAKGVIAKGCPVL  359



>emb|CDP19591.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VNL V WW+L ++E+IC  D ++ NSPWTCP  RV FDAS
Sbjct  376  KIPPRSMFLVQFLGTIIAGTVNLGVAWWLLHTVEDICHPD-MASNSPWTCPGDRVFFDAS  434

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FGP G Y  L W FL G + P+ +W+L K FP++ WIPLIN+PVI    
Sbjct  435  VIWGLVGPKRIFGPHGNYSALNWFFLGGLLGPLAIWLLHKQFPKQSWIPLINLPVILGAT  494

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWIV G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA LL+F + 
Sbjct  495  ASMPPATALNYNSWIVVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAFLLYFTVG  554

Query  361  NEHKELKWWGSEL-DHCPLASCPTAPGIVVEGCPVFK  254
             E++ + WWG+   +HC LA+CPTA GI V+GCP F 
Sbjct  555  MENRSISWWGNNNPEHCDLATCPTAKGISVDGCPTFH  591



>ref|XP_010244695.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=743

 Score =   278 bits (712),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 162/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+++G +N+AV  W+L SI NICD   L P+SPWTCP  RV FDAS
Sbjct  529  KIPPKSMFLVQFIGTIMAGTINIAVAMWLLNSIPNICDDQILPPDSPWTCPSDRVFFDAS  588

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL GA+ P+ VW+L K FP++ WIP IN+PV+    
Sbjct  589  VIWGLVGPKRIFGTLGNYTALNWFFLGGALGPLLVWLLHKTFPKQTWIPQINLPVLLGAT  648

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  649  AMMPPATTVNYTSWVLVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGVAFMGVLLYFSLN  708

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E K L WWG+  +HC LASCPTA GIVV+GCPVF
Sbjct  709  MEGKGLDWWGAGGEHCDLASCPTAKGIVVDGCPVF  743



>gb|KCW56912.1| hypothetical protein EUGRSUZ_I02589 [Eucalyptus grandis]
Length=770

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDAS
Sbjct  556  KIPPRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPDDRVFFDAS  615

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y+ + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  616  VIWGLVGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGAT  675

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MP ATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+ 
Sbjct  676  GMMPAATPLNYNAWILVGTIFNFFIFRYRKQWWQRYNYVLSAALDAGAAFMAVLLYFAVN  735

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+K + WWG+  +HC LA+CPTA GI  +GCPV
Sbjct  736  IENKSITWWGTNGEHCELAACPTAKGIEGDGCPV  769



>emb|CDY46800.1| BnaC02g43080D [Brassica napus]
Length=729

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L +I NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP+  WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  695  MEDKSLDWWGTRGEHCDLARCPTARGVIVKGCPV  728



>emb|CDY31321.1| BnaA02g34200D [Brassica napus]
Length=729

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L +I NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP+  WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  695  MEDKSLDWWGTRGEHCDLARCPTARGVIVKGCPV  728



>gb|EMS64171.1| Oligopeptide transporter 4 [Triticum urartu]
Length=648

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 160/218 (73%), Gaps = 3/218 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q  GTLV+G VNL+  WW+LGS+ENIC    LSP+SPWTCP  RV FDAS
Sbjct  431  KIPPRSMFIVQFAGTLVAGTVNLSTAWWLLGSVENICQDQLLSPDSPWTCPGDRVFFDAS  490

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FLIGA  PV V++  ++FP  KWI +IN+PV+    
Sbjct  491  VIWGLVGPKRIFGTHGNYEAVNWFFLIGAAGPVIVYIFHRIFPSHKWILMINLPVLIGAT  550

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MP AT  N  SW++ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L 
Sbjct  551  AQMPAATAMNYNSWLLIGTIFNFFVFRYRKMWWQRYNYILSAALDAGVAFMAVLLYFTLT  610

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E++ + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  611  MENRTVDWWGTGGEHCPLASCPTAKGVDLGPDSVCPVF  648



>gb|KGN53886.1| hypothetical protein Csa_4G179700 [Cucumis sativus]
Length=738

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+++G +NL V WW+L SI NIC  + L PNSPWTCP  RV FDAS
Sbjct  524  KIPPKSMFLVQFIGTILAGTINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKR+FG  G Y  + W FL GA+ P+ VW+L + FP++ WIPLIN+PV+    
Sbjct  584  VIWGLIGPKRIFGSHGFYGTMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+ +F+YRK WWQ+YNY+LSAALD G AFMAVLL+F++ 
Sbjct  644  AMMPPATPVNYNAWILIGTIFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVG  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E + ++WWG+  +HC LA+CPTA G+VV+ CPV
Sbjct  704  MEERSVEWWGTAGEHCDLAACPTAKGVVVDSCPV  737



>ref|XP_004147543.1| PREDICTED: oligopeptide transporter 4 [Cucumis sativus]
Length=738

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+++G +NL V WW+L SI NIC  + L PNSPWTCP  RV FDAS
Sbjct  524  KIPPKSMFLVQFIGTILAGTINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKR+FG  G Y  + W FL GA+ P+ VW+L + FP++ WIPLIN+PV+    
Sbjct  584  VIWGLIGPKRIFGSHGFYGTMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+ +F+YRK WWQ+YNY+LSAALD G AFMAVLL+F++ 
Sbjct  644  AMMPPATPVNYNAWILIGTIFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVG  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E + ++WWG+  +HC LA+CPTA G+VV+ CPV
Sbjct  704  MEERSVEWWGTAGEHCDLAACPTAKGVVVDSCPV  737



>ref|XP_008454451.1| PREDICTED: oligopeptide transporter 4 [Cucumis melo]
Length=738

 Score =   277 bits (709),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+++G +NL V WW+L SI NIC  + L PNSPWTCP  RV FDAS
Sbjct  524  KIPPKSMFLVQFIGTILAGTINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGPKR+FG  G Y  + W FL GA+ P+ VW+L + FP++ WIPLIN+PV+    
Sbjct  584  VIWGLIGPKRIFGSHGFYGTMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGAT  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+ +F+YRK WWQ+YNY+LSAALD G AFMAVLL+F++ 
Sbjct  644  AMMPPATPVNYNAWILIGTIFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVG  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E + ++WWG+  +HC LA+CPTA G+VV+ CPV
Sbjct  704  MEERSVEWWGTAGEHCDLAACPTAKGVVVDSCPV  737



>ref|XP_010065750.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW63397.1| hypothetical protein EUGRSUZ_G01043 [Eucalyptus grandis]
Length=752

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 159/214 (74%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+AV WW+L SI NIC    L P+SPWTCP  RV FDAS
Sbjct  538  KIPPRSMFLVQFIGTIIAGTINMAVAWWLLNSITNICQDQLLPPDSPWTCPGDRVFFDAS  597

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GAV P  VW+L K FP+K WIPLIN+PV+    
Sbjct  598  VIWGLVGPKRIFGVQGNYPAMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGAT  657

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAA+DAG AFM VLL+F L 
Sbjct  658  GNMPPATPLNYNAWVLVGTIFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLG  717

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E++ L WWG+  +HC LASCPTA GI  +GCP+
Sbjct  718  MENRGLNWWGTGGEHCDLASCPTAKGISADGCPM  751



>ref|XP_009413226.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=746

 Score =   277 bits (709),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 164/215 (76%), Gaps = 1/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G +N+ V  WMLGSI+NICD   L PNSPWTCP  RV FDAS
Sbjct  533  KIPPRSMFLVQLIGTIIAGTINITVAHWMLGSIDNICDRARLPPNSPWTCPGDRVFFDAS  592

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y +L W FL GA+ PV VW L + FP + WIPL+N+PV+    
Sbjct  593  VIWGLVGPRRIFGPLGNYGSLNWFFLGGAIGPVLVWGLHRAFPARSWIPLVNLPVLLGAT  652

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPA+P N  +W+V G +FNY V++ RK WW+++NY+LSAA+DAG AFM VLL+FAL 
Sbjct  653  GIMPPASPINFTAWVVVGTVFNYAVYRRRKKWWERFNYILSAAMDAGVAFMGVLLYFALN  712

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E+  + WWG++ +HCPLA+CPTA G+ VEGCPVF
Sbjct  713  MENTSIDWWGTD-EHCPLATCPTAKGVQVEGCPVF  746



>gb|KFK28135.1| hypothetical protein AALP_AA8G476800 [Arabis alpina]
Length=990

 Score =   281 bits (719),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 162/219 (74%), Gaps = 0/219 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDAS
Sbjct  515  KIPPRSMFLVQFIGTILAGTINITVAWWQLTSIKNICQEELLPPNSPWTCPGDRVFFDAS  574

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP++ WIPL+N+PV+    
Sbjct  575  VIWGLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKRTWIPLVNLPVLLGAT  634

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+F++ 
Sbjct  635  AMMPPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAALDAGVAFMAVLLYFSVG  694

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK*AS  245
             E K L WWG+  +HC LA CPTA G++V+GCP+   A+
Sbjct  695  MEEKSLDWWGTRGEHCDLARCPTARGVIVDGCPILHLAN  733



>ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
 gb|EOA37544.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
Length=735

 Score =   276 bits (707),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 161/216 (75%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDAS
Sbjct  520  KIPPRSMFLVQLIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDAS  579

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP K WI  IN+PV+    
Sbjct  580  VIWGLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGAT  639

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G+IFNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  640  AAMPPATSVNFNCWIIVGVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLT  699

Query  361  NEHKEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 +  WWG+  ++CPLASCPTAPGI VEGCPVF
Sbjct  700  MNGISIDHWWGANGENCPLASCPTAPGIQVEGCPVF  735



>ref|XP_003570148.1| PREDICTED: oligopeptide transporter 4-like [Brachypodium distachyon]
Length=753

 Score =   276 bits (707),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 162/219 (74%), Gaps = 3/219 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q VGTLV+G VNL+V WW+LGSIENIC    L P+SPWTCP  RV FDAS
Sbjct  535  KIPPRSMFLVQFVGTLVAGTVNLSVAWWLLGSIENICQDTLLPPDSPWTCPGDRVFFDAS  594

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP R+FGP G Y  L   FLIGA  PV V+V  ++FP +KWI LIN+PV+    
Sbjct  595  VIWGLVGPMRIFGPRGNYEALNLFFLIGAAGPVIVYVFHRIFPNQKWILLINLPVLIGAT  654

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  +W++ G  FN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L 
Sbjct  655  ASMPPATAVNYNAWLLIGTFFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLS  714

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVFK  254
             E++ + WWG+  +HCPLA+CPTA G+ +     CPVF+
Sbjct  715  MENRSIDWWGTAGEHCPLATCPTAKGVDLGPDSLCPVFR  753



>ref|XP_003522744.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 2-like 
[Glycine max]
Length=730

 Score =   276 bits (706),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q+VGTL++G +++ V WW+LGS++NIC+ D L  +SPWTCP  +V FDAS
Sbjct  516  KIPPRSMFIVQVVGTLIAGTMDVGVAWWLLGSVKNICNQDLLPADSPWTCPGDKVFFDAS  575

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FLIGA+ P+ +W+L K F ++ WI LI++PV+    
Sbjct  576  VIWGLVGPKRIFGTLGNYPKLNWFFLIGALGPLVIWLLQKAFRKQTWISLIHLPVLLGAT  635

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPA+  N  +WI  G IFNYFVFKYRK WWQ+YNYVL AALDAG AFM VLL+FA+ 
Sbjct  636  ANMPPASSVNFNAWITVGTIFNYFVFKYRKNWWQRYNYVLPAALDAGLAFMTVLLYFAVN  695

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E K + WWG++ D C LA CPTA G+V EGCPVF
Sbjct  696  VEEKGIVWWGNDGDQCKLAKCPTAKGVVTEGCPVF  730



>ref|NP_001266848.1| uncharacterized protein LOC101027225 [Zea mays]
 gb|ACN36454.1| unknown [Zea mays]
Length=370

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 162/217 (75%), Gaps = 3/217 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q VGT+V+G VN+   WW+LGSI+ IC +D+L P+SPWTCP  RV FDAS
Sbjct  155  KIPPKSMFLVQFVGTIVAGTVNIGTAWWLLGSIDGIC-SDSLPPDSPWTCPNDRVFFDAS  213

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y  L W FLIGA  PV V+ L + FP ++WIPLIN+PV+    
Sbjct  214  VIWGLVGPRRIFGPDGNYGALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPVLFGAT  273

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G +FN+FVF+YRK WW +YNY+LSAALDAG AFM V+L+F+L 
Sbjct  274  AYMPPATAVNYNSWLLVGTVFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVLYFSLT  333

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEG--CPVF  257
             ++K + WWG+  +HCPLA CPTA G+ +    CPVF
Sbjct  334  MQNKSIDWWGTAGEHCPLARCPTAKGVDLGDGVCPVF  370



>gb|KHN33579.1| Oligopeptide transporter 4 [Glycine soja]
Length=666

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 159/213 (75%), Gaps = 0/213 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L   SPWTCP   V FDAS
Sbjct  452  KIPPRSMFLVQFIGTILAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPNDLVFFDAS  511

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  + W FL GAV P+ VW+L K FP++ WIPLIN+PV+    
Sbjct  512  VIWGLVGPKRIFGSQGNYGAMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGAT  571

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPA P N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALD+G  FM V+L+F+L 
Sbjct  572  GIMPPARPLNYNAWIFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVVFMTVMLYFSLG  631

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCP  263
             E+K L WWG++ +HCPLA+CPTA GI+V+GCP
Sbjct  632  LENKSLNWWGNDGEHCPLAACPTAKGIIVDGCP  664



>ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=736

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 162/216 (75%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDAS
Sbjct  521  KIPPRSMFLVQLIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDAS  580

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WI  IN+PV+    
Sbjct  581  VIWGLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTRTWISQINLPVLLGAT  640

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G+IFNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  641  AAMPPATSVNFNCWIIVGVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLT  700

Query  361  NEHKEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 +  WWG++ ++CPLA+CPTAPGI VEGCPVF
Sbjct  701  MNGISIDHWWGAKGENCPLAACPTAPGIQVEGCPVF  736



>ref|XP_007018306.1| Oligopeptide transporter 4 [Theobroma cacao]
 gb|EOY15531.1| Oligopeptide transporter 4 [Theobroma cacao]
Length=752

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 159/219 (73%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VNL V WW+L S+++IC  D L  NSPWTCP  RV FDAS
Sbjct  534  KIPPRSMFLVQFIGTVLAGTVNLGVAWWLLTSVDSICHKDLLPKNSPWTCPGDRVFFDAS  593

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+    
Sbjct  594  VIWGLVGPKRIFGSLGQYSTLNWFFLGGLLGPVVVWLLHKAFPSQSWIPLINLPVLLGAT  653

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPA+P N  SWI+ G IFN+FVF+Y+K WWQ+YNY+LSAALDAG AFM VLL+FAL 
Sbjct  654  GNMPPASPLNYTSWILVGTIFNFFVFRYQKQWWQRYNYILSAALDAGVAFMTVLLYFALG  713

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E+K L WWGS  D    HC LA CPTA GI V+GCP F
Sbjct  714  LENKSLNWWGSSPDYIPEHCDLAGCPTAKGISVDGCPTF  752



>ref|XP_012068072.1| PREDICTED: oligopeptide transporter 2 [Jatropha curcas]
 gb|KDP41518.1| hypothetical protein JCGZ_15925 [Jatropha curcas]
Length=730

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GTL+SG VN  V WW+L S++NIC    L P+SPWTCP  RV +DAS
Sbjct  516  KIPPRSMFLVQCIGTLISGTVNTGVAWWLLTSVKNICQDSLLPPDSPWTCPSDRVFYDAS  575

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FL GA+ PV VW+L K FP++KWIPLIN+PV+    
Sbjct  576  VIWGLVGPRRIFGHLGNYSALNWFFLGGAIGPVIVWLLHKAFPKQKWIPLINLPVLLGAT  635

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A +PPAT  N   WI+ G  FNYFVFKY K WWQ+YNYVLSAALDAG AFM V+L+F L 
Sbjct  636  AILPPATTVNFNCWILVGTTFNYFVFKYHKKWWQRYNYVLSAALDAGLAFMGVILYFTLT  695

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E K + WWG++ +HCPLASCPTA GI V+GC V
Sbjct  696  MEGKFISWWGNDGEHCPLASCPTAEGIAVDGCVV  729



>emb|CDP04528.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 156/216 (72%), Gaps = 34/216 (16%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PR M+ AQLVGTLV+G+ NL + WWML SI NICD +AL P SPWTCP+FR+TFD +
Sbjct  456  KIPPRCMFTAQLVGTLVAGLANLGIGWWMLRSIPNICDVEALHPESPWTCPRFRLTFDTT  515

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            V+WGLIGP+RLFGP GLYRN+VWLF +GA+LP+PVW+LS++FP+KKWI LINIP+I+ GF
Sbjct  516  VVWGLIGPERLFGPKGLYRNMVWLFPVGALLPLPVWILSRIFPDKKWISLINIPLITCGF  575

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
                                              KYNYVLS+ALDAGTAFM VL+FFALQ
Sbjct  576  ----------------------------------KYNYVLSSALDAGTAFMGVLVFFALQ  601

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  254
            N  K LKWWG+E DHCPLASCPTA GIV  GCP FK
Sbjct  602  NSGKNLKWWGTEPDHCPLASCPTAAGIVAAGCPAFK  637



>ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camelina sativa]
Length=735

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 162/216 (75%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDAS
Sbjct  520  KIPPRSMFLVQLIGTVIAGTVNVSVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDAS  579

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WI  IN+PV+    
Sbjct  580  VIWGLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTRTWISQINLPVLLGAT  639

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G+IFNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  640  AAMPPATSVNFNCWIIVGVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLT  699

Query  361  NEHKEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 +  WWG++ ++CPLA+CPTAPGI VEGCPVF
Sbjct  700  MNGISIDHWWGAKGENCPLAACPTAPGIQVEGCPVF  735



>gb|AFW63465.1| hypothetical protein ZEAMMB73_812110 [Zea mays]
Length=482

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 162/217 (75%), Gaps = 3/217 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q VGT+V+G VN+   WW+LGSI+ IC +D+L P+SPWTCP  RV FDAS
Sbjct  267  KIPPKSMFLVQFVGTIVAGTVNIGTAWWLLGSIDGIC-SDSLPPDSPWTCPNDRVFFDAS  325

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y  L W FLIGA  PV V+ L + FP ++WIPLIN+PV+    
Sbjct  326  VIWGLVGPRRIFGPDGNYGALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPVLFGAT  385

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G +FN+FVF+YRK WW +YNY+LSAALDAG AFM V+L+F+L 
Sbjct  386  AYMPPATAVNYNSWLLVGTVFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVLYFSLT  445

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEG--CPVF  257
             ++K + WWG+  +HCPLA CPTA G+ +    CPVF
Sbjct  446  MQNKSIDWWGTAGEHCPLARCPTAKGVDLGDGVCPVF  482



>emb|CBI19304.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   274 bits (700),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 161/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GTL++G VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDAS
Sbjct  531  KIPPRSMFLVQLIGTLIAGSVNLFVAMWLLDSIDNICQEELLPENSPWTCPGQRVFFDAS  590

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+ P+R+FG  G Y  L W FL G + PV VW+L  +FP + WIPL+N+PV+    
Sbjct  591  VIWGLVAPQRIFGTLGNYGALNWFFLGGLLGPVAVWILHILFPSQSWIPLVNLPVLIGAT  650

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++F + 
Sbjct  651  ASMPPATPVNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYFTVG  710

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E K L WWG+  D    HCPLASCPTA G++V+GCP F
Sbjct  711  IEEKNLYWWGANPDIDPEHCPLASCPTAKGVIVDGCPRF  749



>ref|XP_002527347.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF35019.1| Oligopeptide transporter, putative [Ricinus communis]
Length=744

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 159/219 (73%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L SI+ IC    L  NSPWTCP  RV FDAS
Sbjct  526  KIPPRSMFLVQFIGTIIAGTINLGVAWWLLDSIDYICQDQLLPSNSPWTCPGSRVFFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+  K FP + WIPLIN+PV+    
Sbjct  586  VIWGLVGPKRIFGSLGEYSALNWFFLGGLLGPVVVWLFHKKFPNQTWIPLINLPVLFGAT  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVL++F L 
Sbjct  646  AIMPPATAVNFNSWILVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGVAFMAVLIYFTLG  705

Query  361  NEHKELKWWGS----ELDHCPLASCPTAPGIVVEGCPVF  257
             E+  + WWGS    + +HCPLASCPTA GI+ +GCP+F
Sbjct  706  LENVNMHWWGSDPNIDPEHCPLASCPTAKGIISDGCPIF  744



>ref|XP_002283680.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=757

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 161/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GTL++G VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDAS
Sbjct  539  KIPPRSMFLVQLIGTLIAGSVNLFVAMWLLDSIDNICQEELLPENSPWTCPGQRVFFDAS  598

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+ P+R+FG  G Y  L W FL G + PV VW+L  +FP + WIPL+N+PV+    
Sbjct  599  VIWGLVAPQRIFGTLGNYGALNWFFLGGLLGPVAVWILHILFPSQSWIPLVNLPVLIGAT  658

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++F + 
Sbjct  659  ASMPPATPVNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYFTVG  718

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E K L WWG+  D    HCPLASCPTA G++V+GCP F
Sbjct  719  IEEKNLYWWGANPDIDPEHCPLASCPTAKGVIVDGCPRF  757



>ref|XP_002306519.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
 gb|EEE93515.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
Length=747

 Score =   273 bits (699),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 160/219 (73%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L S+E+IC  + L+ NSPWTCP  RV FDAS
Sbjct  529  KIPPRSMFLVQFIGTIIAGTINLGVAWWLLNSVEHICQDNLLAANSPWTCPSDRVFFDAS  588

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FL G + P  VW+L K FP + WIPLIN+PV+    
Sbjct  589  VIWGLVGPRRIFGSLGEYAALNWFFLGGLLGPFIVWLLHKAFPGQSWIPLINLPVLLGAT  648

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVL++  + 
Sbjct  649  ASMPPATAINYNSWILVGTIFNFFIFRYRKAWWQRYNYVLSAALDAGVAFMAVLIYVTVG  708

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E+K L WWGS+ D    HC LA+CPTA GI V+GCP F
Sbjct  709  LENKNLYWWGSDPDVFPEHCSLATCPTAKGISVDGCPTF  747



>ref|XP_002301110.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
 gb|EEE80383.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
Length=724

 Score =   273 bits (698),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 158/215 (73%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+V Q +GTL++G +N AV WW+L  IENIC  + L PNSPWTCP  RV +DAS
Sbjct  510  KIPPRSMFVVQCIGTLINGTLNTAVAWWLLTGIENICQDELLPPNSPWTCPGDRVFYDAS  569

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP R+FG  G Y  L W FL G + PV VW L ++FP++KWI LIN+PV+    
Sbjct  570  VIWGLIGPARIFGRLGNYTALNWFFLGGVLGPVLVWGLHRLFPKQKWIKLINLPVLLGST  629

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WIV  + FNYF+FK+ K WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  630  AAMPPATTVNFNCWIVVAITFNYFIFKFHKVWWQRYNYVLSAALDAGLAFMGVLLYFSLT  689

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             +   L WWG+  +HCPLA+CPTA G++V+GCPV+
Sbjct  690  MKEISLNWWGAAGEHCPLATCPTAKGVIVDGCPVY  724



>gb|EEE57620.1| hypothetical protein OsJ_08019 [Oryza sativa Japonica Group]
Length=748

 Score =   273 bits (699),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 162/218 (74%), Gaps = 4/218 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+V+G VNL V WW+LGSI +IC  D+L  +SPWTCP  RV FDAS
Sbjct  532  KIPPKSMFLVQFIGTIVAGTVNLGVAWWLLGSIHDICQ-DSLPADSPWTCPNDRVFFDAS  590

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP R+FGP G Y  L W FLIGA  PV V++  KMFP KKWI L N+PV+    
Sbjct  591  VIWGLIGPIRIFGPHGNYSALNWFFLIGAAGPVIVYIFHKMFPNKKWITLTNLPVLIGAT  650

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L 
Sbjct  651  ASMPPATAVNYNSWLLFGTIFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLS  710

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E++ + WWG+  +HCPLA+CPTA G+ +     CPVF
Sbjct  711  MENRSIDWWGTAGEHCPLATCPTAKGVDLGPTSVCPVF  748



>emb|CDP19592.1| unnamed protein product [Coffea canephora]
Length=707

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VNL V WW+L ++++IC  D  S NSPWTCP  RV FDAS
Sbjct  492  KIPPRSMFLVQFLGTIIAGTVNLGVAWWLLHTVKDICHQDRTS-NSPWTCPGDRVFFDAS  550

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FGP G Y  L W FL G + P+ +W+L K FP++ WIPLIN+PVI    
Sbjct  551  VIWGLVGPKRIFGPHGNYSALNWFFLGGLLGPLAIWLLHKQFPKQTWIPLINLPVILGAT  610

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL F + 
Sbjct  611  AYMPPATALNYNSWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLHFTVG  670

Query  361  NEHKELKWWGSEL-DHCPLASCPTAPGIVVEGCPVFK  254
             E++ + WWG+   +HC LA+CPTA GI V+GCP F 
Sbjct  671  MENRSISWWGNNNPEHCDLATCPTAKGISVDGCPTFH  707



>dbj|BAD08158.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=751

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 162/218 (74%), Gaps = 4/218 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+V+G VNL V WW+LGSI +IC  D+L  +SPWTCP  RV FDAS
Sbjct  535  KIPPKSMFLVQFIGTIVAGTVNLGVAWWLLGSIHDICQ-DSLPADSPWTCPNDRVFFDAS  593

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP R+FGP G Y  L W FLIGA  PV V++  KMFP KKWI L N+PV+    
Sbjct  594  VIWGLIGPIRIFGPHGNYSALNWFFLIGAAGPVIVYIFHKMFPNKKWITLTNLPVLIGAT  653

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L 
Sbjct  654  ASMPPATAVNYNSWLLFGTIFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLS  713

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E++ + WWG+  +HCPLA+CPTA G+ +     CPVF
Sbjct  714  MENRSIDWWGTAGEHCPLATCPTAKGVDLGPTSVCPVF  751



>ref|XP_006856596.1| PREDICTED: oligopeptide transporter 4 isoform X1 [Amborella trichopoda]
 gb|ERN18063.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
Length=732

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L SIENIC+  AL   SPWTCP  RV FDAS
Sbjct  518  KIPPRSMFLVQFIGTVIAGTINLGVAWWLLDSIENICNKAALPKGSPWTCPGDRVFFDAS  577

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FGP G Y  L W FL GA+ PV VW+L K FP + WIPLIN+PV+    
Sbjct  578  VIWGLVGPKRIFGPLGAYPALNWFFLGGALGPVLVWLLHKAFPSQTWIPLINLPVLLGAT  637

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MP AT  N  +W+  G +FN+FVF+YRK WWQ+YNYVLSA LDAG AFM VLL+F+L 
Sbjct  638  AYMPAATALNYNAWVAVGTVFNFFVFRYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFSLS  697

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+    WWG++ +HC  A CPTA G++ +GCPV
Sbjct  698  MENNSFNWWGTDGEHCDFAVCPTAKGVIAKGCPV  731



>ref|XP_011016978.1| PREDICTED: oligopeptide transporter 2 [Populus euphratica]
Length=738

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 158/215 (73%), Gaps = 0/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+V Q +GTL++G +N AV WW+L  IENIC  + L PNSPWTCP  RV +DAS
Sbjct  524  KIPPRSMFVVQCIGTLINGTLNTAVAWWLLTGIENICQDELLPPNSPWTCPGDRVFYDAS  583

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP R+FG  G Y  L W FL G + PV VW L ++FP++KWI LIN+PV+    
Sbjct  584  VIWGLIGPARIFGRLGNYTALNWFFLGGVLGPVLVWGLHRLFPKQKWIKLINLPVLLGST  643

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WIV  + FNYFVFK+ K WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  644  AAMPPATTVNFNCWIVVAITFNYFVFKFHKVWWQRYNYVLSAALDAGLAFMGVLLYFSLT  703

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             +   L WWG+  +HCPLA+CPTA G++V+GCPV+
Sbjct  704  MKEISLNWWGAAGEHCPLATCPTAKGVIVDGCPVY  738



>ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68794.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDAS
Sbjct  519  KIPPRSMFLVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDAS  578

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + P+ VW+L K FP K WI  IN+PV+    
Sbjct  579  VIWGLVGPKRIFGRLGNYPALNWFFLGGLIGPLLVWLLQKAFPTKTWISQINLPVLLGAT  638

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G+IFNYFVFK+ K WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  639  AAMPPATSVNFNCWIIVGVIFNYFVFKHCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLT  698

Query  361  NEHKELK-WWGSELDHCPLASCPTAPGIVVEGCPVF  257
               K ++ WWG++ ++CPLASCPTAPGI VEGCPVF
Sbjct  699  MNGKSIEHWWGAKGENCPLASCPTAPGIHVEGCPVF  734



>ref|XP_006364982.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=755

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 159/216 (74%), Gaps = 2/216 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q VGT+++G VNL V WW+LGSI+NIC  D  S NSPWTCP   V FDAS
Sbjct  541  KIPPRSMFLVQFVGTIIAGTVNLTVAWWLLGSIDNICHQDKFS-NSPWTCPGDHVFFDAS  599

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+ PKR+FG  G Y  L W FL G + PV VW+L K FP++ WIPLIN+PV+    
Sbjct  600  VIWGLVSPKRIFGHLGNYSALNWFFLGGLLGPVLVWLLHKSFPKQTWIPLINLPVLLGAT  659

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F + 
Sbjct  660  AFMPPATALNYNSWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTVG  719

Query  361  NEHKELKWWG-SELDHCPLASCPTAPGIVVEGCPVF  257
             E + + WWG S+ +HC LA+CPTA GI + GCP F
Sbjct  720  MEDRSINWWGNSDPEHCDLATCPTAKGITINGCPTF  755



>ref|XP_011078507.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=754

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -3

Query  892  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  713
            PRSM++ QLVGT+V+G +N+ + W++L ++ NIC  + L PNSPW CP  RV FDASVIW
Sbjct  543  PRSMFIVQLVGTIVAGTINIGIAWYLLTTVNNICQDELLPPNSPWMCPNDRVFFDASVIW  602

Query  712  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  533
            GL+GPKR+FG  G Y  L W FL GAV PV VW+L K FP K WI LIN+PV+    A M
Sbjct  603  GLVGPKRIFGDLGNYSALNWCFLGGAVAPVFVWLLHKAFPSKTWIKLINLPVLLGATAAM  662

Query  532  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  353
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAALDAG AFM V+L+F L  E+
Sbjct  663  PPATTLNFNSWILVGTIFNLFVFRYRKRWWQRYNYVLSAALDAGLAFMGVVLYFCLGVEN  722

Query  352  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
              + WWGS  ++C LASCPTA G+ V+GCPV
Sbjct  723  VSISWWGSNGEYCDLASCPTAKGVAVDGCPV  753



>gb|EYU21027.1| hypothetical protein MIMGU_mgv1a026700mg [Erythranthe guttata]
Length=735

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -3

Query  892  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  713
            PRSM++ QLVGTL++G+VN+AV W++L +IENIC  + L PNS WTCP  RV +DASVIW
Sbjct  524  PRSMFIVQLVGTLIAGLVNIAVAWYLLTNIENICQDELLPPNSQWTCPNDRVFYDASVIW  583

Query  712  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  533
            GL+GPKR FG  G Y  L W FL GAV P  VW+L K  P +KWI  +N+P++    A M
Sbjct  584  GLVGPKRFFGTLGNYNALNWFFLGGAVGPFFVWILHKALPSQKWIKSVNLPILLGATAAM  643

Query  532  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  353
            PPAT  N  SW++ G IFN FVF+YRK WWQ+YNYVLSAALDAG AFM V L+F L  E 
Sbjct  644  PPATTLNFNSWMLVGTIFNLFVFRYRKAWWQRYNYVLSAALDAGLAFMGVALYFTLGIEE  703

Query  352  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
              L WWGS+ +HC LA+CPTA G++V+GCPV
Sbjct  704  VTLTWWGSKGEHCDLATCPTARGVIVDGCPV  734



>gb|EEC73829.1| hypothetical protein OsI_08562 [Oryza sativa Indica Group]
Length=757

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 162/218 (74%), Gaps = 4/218 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+V+G VNL V WW+LGSI +IC  D+L  +SPWTCP  RV FDAS
Sbjct  541  KIPPKSMFLVQFIGTIVAGTVNLGVAWWLLGSIHDICQ-DSLPADSPWTCPNDRVFFDAS  599

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGLIGP R+FGP G Y  L W FLIGA  PV V++  KMFP KKWI LIN+PV+    
Sbjct  600  VIWGLIGPIRIFGPHGNYSALNWFFLIGAAGPVIVYIFHKMFPNKKWITLINLPVLIGAT  659

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L 
Sbjct  660  ASMPPATAVNYNSWLLFGTIFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLS  719

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E++ + WWG+  +HC LA+CPTA G+ +     CPVF
Sbjct  720  MENRSIDWWGTAGEHCALATCPTAKGVDLGPTSVCPVF  757



>ref|NP_172464.1| oligopeptide transporter 2 [Arabidopsis thaliana]
 sp|O04514.2|OPT2_ARATH RecName: Full=Oligopeptide transporter 2; Short=AtOPT2 [Arabidopsis 
thaliana]
 gb|AEE28515.1| oligopeptide transporter 2 [Arabidopsis thaliana]
Length=734

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 161/216 (75%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDAS
Sbjct  519  KIPPRSMFLVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDAS  578

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP K WI  IN+PV+    
Sbjct  579  VIWGLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGAT  638

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G+IFNYFVFKY K WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  639  AAMPPATSVNFNCWIIVGVIFNYFVFKYCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLT  698

Query  361  NEHKELK-WWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 +  WWG++ ++CPLASCPTAPG++V+GCPVF
Sbjct  699  MNGISINHWWGAKGENCPLASCPTAPGVLVDGCPVF  734



>gb|KDP41519.1| hypothetical protein JCGZ_15926 [Jatropha curcas]
Length=441

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 158/219 (72%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L SI++IC    L  NSPWTCP  +V FDAS
Sbjct  223  KIPPRSMFLVQFIGTIIAGTINLGVAWWLLTSIDHICQDTLLPSNSPWTCPSDQVFFDAS  282

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FL G + PV VWV  K FP + WIPLIN+PV+    
Sbjct  283  VIWGLVGPRRIFGSLGEYPALNWCFLGGFLGPVIVWVFHKAFPSQSWIPLINLPVLLGAT  342

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPA+  N  SWI+ G IFN+F+F+YRKGWWQ+YNYVLSAALDAG AFMAVL++  L 
Sbjct  343  AMMPPASSINYTSWILIGTIFNFFIFRYRKGWWQRYNYVLSAALDAGVAFMAVLIYLTLG  402

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
              +  + WWG++ D    HCPLASCPTA GI ++GCP F
Sbjct  403  LGNVNIHWWGADPDIDPEHCPLASCPTAKGINIDGCPTF  441



>gb|ABE65610.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
Length=734

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 161/216 (75%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDAS
Sbjct  519  KIPPRSMFLVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDAS  578

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + PV VW+L K FP K WI  IN+PV+    
Sbjct  579  VIWGLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGAT  638

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G+IFNYFVFKY K WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  639  AAMPPATSVNFNCWIIVGVIFNYFVFKYCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLT  698

Query  361  NEHKELK-WWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 +  WWG++ ++CPLASCPTAPG++V+GCPVF
Sbjct  699  MNGISINHWWGAKGENCPLASCPTAPGVLVDGCPVF  734



>ref|XP_007200086.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
 gb|EMJ01285.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
Length=743

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 161/214 (75%), Gaps = 1/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VNLAV  W+L SI NIC  D  S +SPWTCP  RV FDAS
Sbjct  530  KIPPRSMFLVQFIGTILAGTVNLAVAHWLLNSITNICVDDPHS-DSPWTCPGDRVFFDAS  588

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL GPKR+FG  G+Y  + W FL GAV PV VWVL K +P++ WI LIN+PV+    
Sbjct  589  VIWGLAGPKRIFGTLGIYGAINWFFLGGAVGPVIVWVLHKAYPKQNWIRLINLPVLLGAT  648

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+ ++ 
Sbjct  649  ASMPPATALNYNSWIIVGTIFNFFVFRYRKKWWQRYNYVLSAALDAGLAFMAVLLYLSVG  708

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+K + WWG+  +HC LA+CPTA GIVV+GCPV
Sbjct  709  MENKSVAWWGTNGEHCTLATCPTAKGIVVDGCPV  742



>emb|CDY69955.1| BnaCnng66090D [Brassica napus]
Length=732

 Score =   271 bits (692),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 159/216 (74%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDAS
Sbjct  517  KIPPRSMFLVQFIGTIIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDAS  576

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G V PV VW+L K FP + WI  IN+PV+    
Sbjct  577  VIWGLVGPKRIFGSLGNYPALNWFFLGGLVGPVLVWLLQKAFPTRTWISQINLPVLLGAT  636

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G++FNYFVFK  K WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  637  AAMPPATSVNFNCWIIVGVVFNYFVFKNYKKWWQRYNYVLSAALDAGLAFMGVLLYFSLT  696

Query  361  NEHKEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 +  WWG+E ++CPLASCPTAPG+ VEGCPVF
Sbjct  697  MNGISIGHWWGAEGENCPLASCPTAPGVHVEGCPVF  732



>ref|XP_009118291.1| PREDICTED: oligopeptide transporter 2 [Brassica rapa]
Length=732

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 159/216 (74%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDAS
Sbjct  517  KIPPRSMFLVQFIGTIIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDAS  576

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G V PV VW+L K FP + WI  IN+PV+    
Sbjct  577  VIWGLVGPKRIFGRLGNYPALNWFFLGGLVGPVLVWLLQKAFPTRTWISQINLPVLLGAT  636

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   WI+ G++FNYFVFK  K WWQ+YNYVLSAALDAG AFM VLL+F+L 
Sbjct  637  AAMPPATSVNFNCWIIVGVVFNYFVFKNYKKWWQRYNYVLSAALDAGLAFMGVLLYFSLT  696

Query  361  NEHKEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  257
                 +  WWG+E ++CPLASCPTAPG+ VEGCPVF
Sbjct  697  MNGISIGHWWGAEGENCPLASCPTAPGVHVEGCPVF  732



>ref|XP_009615073.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana tomentosiformis]
Length=753

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 162/216 (75%), Gaps = 2/216 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VNL+V WW+L SI+NIC  D  S NSPWTCP   V FDAS
Sbjct  539  KIPPRSMFLVQFLGTIIAGTVNLSVAWWLLDSIDNICHQDKFS-NSPWTCPGDHVFFDAS  597

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+ PKR+FG  G Y  L W FL G + PV VW+L K+FP++ WIPLIN+PV+    
Sbjct  598  VIWGLVSPKRIFGHLGNYSALNWFFLGGMIGPVVVWLLHKLFPKQTWIPLINLPVLLGAT  657

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G +FN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++ 
Sbjct  658  AWMPPATALNYNSWILVGTVFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFSVG  717

Query  361  NEHKELKWWG-SELDHCPLASCPTAPGIVVEGCPVF  257
             E++ + WWG ++ +HC LA CPTA GI V+GCP F
Sbjct  718  MENRSINWWGNNDPEHCDLAYCPTAKGISVDGCPTF  753



>ref|XP_004238028.1| PREDICTED: oligopeptide transporter 4-like [Solanum lycopersicum]
Length=755

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 159/216 (74%), Gaps = 2/216 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q VGT+++G VNL V WW+L SI+NIC  D  S NSPWTCP   V FDAS
Sbjct  541  KIPPRSMFLVQFVGTIIAGTVNLTVAWWLLDSIDNICHQDKFS-NSPWTCPGDHVFFDAS  599

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+ PKR+FG  G Y  L W FL G + PV VW+L K FP++ WIPLIN+PV+    
Sbjct  600  VIWGLVSPKRIFGHLGNYSALNWFFLGGLLGPVLVWLLHKSFPKQTWIPLINLPVLLGAT  659

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F + 
Sbjct  660  AMMPPATALNYNSWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTVG  719

Query  361  NEHKELKWWG-SELDHCPLASCPTAPGIVVEGCPVF  257
             E + + WWG ++ +HC LA+CPTA GI ++GCP F
Sbjct  720  MEDRSINWWGNTDPEHCDLATCPTAKGISIDGCPTF  755



>ref|XP_004953568.1| PREDICTED: oligopeptide transporter 4-like isoform X2 [Setaria 
italica]
Length=754

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 163/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+V+G VNL   WW+LGSI++IC +D+L P SPWTCP  RV FDAS
Sbjct  538  KIPPKSMFLVQFIGTIVAGTVNLGTAWWLLGSIKDIC-SDSLPPESPWTCPSDRVFFDAS  596

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FLIGA  PV V+ L +M+P ++WIPLIN+PV+    
Sbjct  597  VIWGLVGPRRIFGSAGNYGALNWFFLIGAAGPVIVYALHRMYPNQRWIPLINLPVLLGAT  656

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+Y+K WW +YNY+LSAALDAG AFM V+L+F+L 
Sbjct  657  ASMPPATAVNYNSWLLIGTIFNFFVFRYQKKWWTRYNYILSAALDAGVAFMGVVLYFSLT  716

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E+K + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  717  MENKTIDWWGTAGEHCPLASCPTAKGMDLGPDSVCPVF  754



>ref|XP_008237085.1| PREDICTED: oligopeptide transporter 4-like [Prunus mume]
Length=747

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 160/214 (75%), Gaps = 1/214 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G VNLAV +W+L SI NIC  D  S +SPWTCP  RV FDAS
Sbjct  534  KIPPRSMFLVQFIGTILAGTVNLAVAYWLLNSITNICVDDPQS-DSPWTCPSDRVFFDAS  592

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL GPKR+FG  G+Y  + W FL GAV PV VWVL K +P++ WI LIN+PV+    
Sbjct  593  VIWGLAGPKRIFGTLGIYGAMNWFFLGGAVGPVIVWVLHKAYPKQNWIRLINLPVLLGAT  652

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
              MPPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+ ++ 
Sbjct  653  GSMPPATALNYNSWIIVGTIFNFFVFRYRKKWWQRYNYVLSAALDAGLAFMAVLLYLSVG  712

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPV  260
             E+  + WWG+  +HC LA+CPTA GIVV+GCPV
Sbjct  713  MENISVAWWGTNGEHCDLATCPTAKGIVVDGCPV  746



>ref|XP_008466652.1| PREDICTED: oligopeptide transporter 4-like [Cucumis melo]
Length=743

 Score =   269 bits (687),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 160/218 (73%), Gaps = 4/218 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G +N++V WW+L S++ IC   A S NSPWTCP  RV FDAS
Sbjct  527  KIPPRSMFLVQLIGTVIAGTINVSVAWWLLSSVDQICHQSA-SSNSPWTCPGDRVFFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + P  V++L ++FP + WIPLIN+PV+    
Sbjct  586  VIWGLVGPKRIFGSQGNYPALNWFFLAGILGPSLVYLLHRIFPNQSWIPLINLPVLFGAT  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPA P N  SWI+ G IFNYF+F+YRK WWQ+YNY+LSAALDAG AFMA+L+ F   
Sbjct  646  ASMPPAAPINYNSWILVGTIFNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFTFG  705

Query  361  NEHKELKWWGS---ELDHCPLASCPTAPGIVVEGCPVF  257
              +  + WWGS   + DHC LASCPTA G+VV+GCPVF
Sbjct  706  VRNVHMNWWGSNPIDTDHCLLASCPTAKGVVVDGCPVF  743



>ref|XP_004953567.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Setaria 
italica]
Length=797

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 163/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q +GT+V+G VNL   WW+LGSI++IC +D+L P SPWTCP  RV FDAS
Sbjct  581  KIPPKSMFLVQFIGTIVAGTVNLGTAWWLLGSIKDIC-SDSLPPESPWTCPSDRVFFDAS  639

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FLIGA  PV V+ L +M+P ++WIPLIN+PV+    
Sbjct  640  VIWGLVGPRRIFGSAGNYGALNWFFLIGAAGPVIVYALHRMYPNQRWIPLINLPVLLGAT  699

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+Y+K WW +YNY+LSAALDAG AFM V+L+F+L 
Sbjct  700  ASMPPATAVNYNSWLLIGTIFNFFVFRYQKKWWTRYNYILSAALDAGVAFMGVVLYFSLT  759

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  257
             E+K + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  760  MENKTIDWWGTAGEHCPLASCPTAKGMDLGPDSVCPVF  797



>ref|XP_008646108.1| PREDICTED: oligopeptide transporter 4-like [Zea mays]
 gb|AFW72904.1| hypothetical protein ZEAMMB73_956147 [Zea mays]
Length=758

 Score =   269 bits (687),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 160/217 (74%), Gaps = 3/217 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q VGT+V+G +N+   WW+LGSI  IC +D+L P+SPWTCP  RV FDAS
Sbjct  543  KIPPKSMFLVQFVGTIVAGTINIGTAWWLLGSIHGIC-SDSLPPDSPWTCPNDRVFFDAS  601

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP R+FGPGG Y  + W FLIGA  PV V+ L ++FP + WIPLIN+PV+    
Sbjct  602  VIWGLVGPMRIFGPGGNYGAVNWFFLIGAAGPVIVYALHRVFPSQSWIPLINLPVLFGAT  661

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G IFN+FVF+YRK WW +YNY+LSA LDAG AFM VLL+F+L 
Sbjct  662  ASMPPATAVNYNSWLLVGTIFNFFVFRYRKRWWTRYNYILSAGLDAGVAFMGVLLYFSLT  721

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEG--CPVF  257
             ++K + WWG+  +HCPLA CPTA G+ +    CPVF
Sbjct  722  MQNKSIDWWGTAGEHCPLAKCPTAKGVDLGDGVCPVF  758



>ref|XP_008677393.1| PREDICTED: oligopeptide transporter 4 isoform X1 [Zea mays]
 gb|ACN26883.1| unknown [Zea mays]
 gb|AFW63464.1| oligopeptide transporter 4 [Zea mays]
Length=760

 Score =   268 bits (686),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 162/217 (75%), Gaps = 3/217 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ Q VGT+V+G VN+   WW+LGSI+ IC +D+L P+SPWTCP  RV FDAS
Sbjct  545  KIPPKSMFLVQFVGTIVAGTVNIGTAWWLLGSIDGIC-SDSLPPDSPWTCPNDRVFFDAS  603

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y  L W FLIGA  PV V+ L + FP ++WIPLIN+PV+    
Sbjct  604  VIWGLVGPRRIFGPDGNYGALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPVLFGAT  663

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++ G +FN+FVF+YRK WW +YNY+LSAALDAG AFM V+L+F+L 
Sbjct  664  AYMPPATAVNYNSWLLVGTVFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVLYFSLT  723

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEG--CPVF  257
             ++K + WWG+  +HCPLA CPTA G+ +    CPVF
Sbjct  724  MQNKSIDWWGTAGEHCPLARCPTAKGVDLGDGVCPVF  760



>gb|EMS53301.1| Oligopeptide transporter 4 [Triticum urartu]
Length=636

 Score =   266 bits (679),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -3

Query  871  QLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKR  692
            Q VGT+V+G VNL V WW+LGS+ENIC    L PNSPWTCP  RV FDASVIWGL+GP R
Sbjct  429  QFVGTVVAGTVNLIVGWWLLGSVENICQDQLLPPNSPWTCPNDRVFFDASVIWGLVGPNR  488

Query  691  LFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTN  512
            +FG  G Y  L W FLIGA  PV V++L + FP  KWI LINIPV++   A MPPAT  N
Sbjct  489  IFGSNGNYIALNWFFLIGAAGPVIVYILHRTFPTHKWILLINIPVLTGATALMPPATTVN  548

Query  511  IGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWG  332
              SW++ G+IFN+FVF+YRK WWQ+YNY+LSA LDAG AFM VLL+F L  E++ + WWG
Sbjct  549  FNSWLLYGIIFNFFVFRYRKKWWQRYNYILSAGLDAGAAFMGVLLYFTLTMENRTINWWG  608

Query  331  SELDHCPLASCPTAPGIVV---EGCPVF  257
            +  +HCPLASCPTA G+ +     CPVF
Sbjct  609  TGGEHCPLASCPTAKGVDLGPDSVCPVF  636



>ref|XP_006472404.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=755

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 157/219 (72%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L S+E+IC    L  NSPWTCP  RV FDAS
Sbjct  536  KIPPRSMFLVQFIGTIIAGTINLIVAWWLLNSVEHICQPGLLPKNSPWTCPNDRVFFDAS  595

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W FL G + P  VW+L K FP + WIPLIN+PV+    
Sbjct  596  VIWGLVGPRRIFGSQGNYGALNWFFLGGLLGPCAVWLLHKKFPNQSWIPLINLPVLLGAT  655

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VLL+ +L 
Sbjct  656  AYMPPATALNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGTAFMTVLLYVSLG  715

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E   L WWGS  D    HC LA+CPTA G+ V+GCPVF
Sbjct  716  LEGVNLHWWGSNPDIDPEHCDLATCPTAKGVAVDGCPVF  754



>ref|XP_004136414.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 gb|KGN60283.1| hypothetical protein Csa_3G893330 [Cucumis sativus]
Length=743

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 159/218 (73%), Gaps = 4/218 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ QL+GT+++G +N++V WW+L S++ IC     S NSPWTCP  RV FDAS
Sbjct  527  KIPPRSMFLVQLIGTVIAGTINVSVAWWLLSSVDQICHQSP-SSNSPWTCPGDRVFFDAS  585

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y  L W FL G + P  V++L ++FP + WIPLIN+PV+    
Sbjct  586  VIWGLVGPKRIFGSQGNYPALNWFFLAGLLGPSLVYLLHRIFPNQSWIPLINLPVLFGAT  645

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPATP N  SWI+ G +FNYF+F+YRK WWQ+YNY+LSAALDAG AFMA+L+ FA  
Sbjct  646  ASMPPATPINYNSWILVGTVFNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFAFG  705

Query  361  NEHKELKWWGS---ELDHCPLASCPTAPGIVVEGCPVF  257
                 + WWGS   + DHC LASCPTA G+V +GCPVF
Sbjct  706  VRDVHMNWWGSNPIDTDHCLLASCPTAKGVVADGCPVF  743



>gb|ERN09040.1| hypothetical protein AMTR_s03508p00001080 [Amborella trichopoda]
Length=368

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 147/205 (72%), Gaps = 0/205 (0%)
 Frame = -3

Query  874  AQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPK  695
             Q +GT+++G +NL V WW+L SIENIC+  AL   SPWTCP  RV FDASVIWGL+GPK
Sbjct  163  GQFIGTVIAGTINLGVAWWLLESIENICNKAALPKGSPWTCPGDRVFFDASVIWGLVGPK  222

Query  694  RLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPT  515
            R+FGP G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+      MPPAT  
Sbjct  223  RIFGPLGAYPALNWFFLGGVLGPVLVWLLHKAFPSQTWIPLINLPVLLGATNYMPPATAL  282

Query  514  NIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWW  335
            N  +W+  G +FN+FVF+YRK WWQ+YNYVLSA LDAG AFM VLL+F L  E+    WW
Sbjct  283  NYNAWVAVGTVFNFFVFRYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFLLSMENNSFNWW  342

Query  334  GSELDHCPLASCPTAPGIVVEGCPV  260
            G++ +HC  A CPTA G++ +GCPV
Sbjct  343  GTDGEHCDFAVCPTAKGVIAKGCPV  367



>ref|XP_007137663.1| hypothetical protein PHAVU_009G145300g [Phaseolus vulgaris]
 gb|ESW09657.1| hypothetical protein PHAVU_009G145300g [Phaseolus vulgaris]
Length=733

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 164/215 (76%), Gaps = 1/215 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q++GTL++G V++ V WW+LGSI+NIC  D L  NSPWTCP   V FDAS
Sbjct  520  KIPPRSMFIVQVIGTLIAGSVDVGVAWWLLGSIKNICKQDLLPENSPWTCPGDHVFFDAS  579

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G Y+ L W FLIGAV PV +W L K+FP++ WI LI++PV+    
Sbjct  580  VIWGLVGPKRIFGTLGKYQKLNWFFLIGAVGPVVIWALRKLFPKQHWISLIHLPVLLGAT  639

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPA+  N  SWIV G IFNYFVFKYRK WWQ+YNYVL+AALDAG AFM VLL+FA+ 
Sbjct  640  ANMPPASTVNFNSWIVVGTIFNYFVFKYRKNWWQRYNYVLAAALDAGLAFMTVLLYFAVT  699

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEGCPVF  257
             E K ++WWG+  +HCPLA CPTA G+V + CP+F
Sbjct  700  MEGKGIEWWGTG-EHCPLAKCPTAKGVVADACPLF  733



>dbj|BAD94325.1| hypothetical protein [Arabidopsis thaliana]
Length=308

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 156/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++AQ+ GTLV+ VV     WW++  I ++CDT  L  +S WTCP  RV FDAS
Sbjct  92   KIPPRSMFMAQVAGTLVAVVVYTGTAWWLMEEIPHLCDTSLLPSDSQWTCPMDRVFFDAS  151

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y N+ W FL+GA+ P+ VW+ +KMFP + WI  I+IPV+    
Sbjct  152  VIWGLVGPRRVFGDLGEYSNVNWFFLVGAIAPLLVWLATKMFPAQTWIAKIHIPVLVGAT  211

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SW++   IF +F+FKYR+ WW KYNYVLS  LDAG+AFM +LLF AL 
Sbjct  212  AMMPPATAVNFTSWLIVAFIFGHFIFKYRRVWWTKYNYVLSGGLDAGSAFMTILLFLALG  271

Query  361  NEHKELKWWGS--ELDHCPLASCPTAPGIVVEGCPVF  257
             +  E++WWG+  + D CPLASCPTA G+VV+GCPVF
Sbjct  272  RKGIEVQWWGNSGDRDTCPLASCPTAKGVVVKGCPVF  308



>gb|KHG27447.1| Oligopeptide transporter 2 -like protein [Gossypium arboreum]
Length=237

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 144/198 (73%), Gaps = 0/198 (0%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM+V Q +GT+++G VNLAV WW+L ++EN+C    L PNSPWTCP  RV FDAS
Sbjct  40   KIPPRSMFVVQSIGTVIAGTVNLAVAWWLLTTVENVCQDHLLPPNSPWTCPCDRVFFDAS  99

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+F P G Y  L W FL GA+ PV VW+  K FP +KWIPL N+PV+    
Sbjct  100  VIWGLVGPKRIFSPLGNYSALNWFFLGGALGPVVVWLFHKAFPNQKWIPLTNLPVLLGAT  159

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N   W++ G IFNY+VFKYRKGWWQ+YNYVLSAALDAG AFM VLL+F L 
Sbjct  160  AAMPPATSLNFNCWLIIGFIFNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLT  219

Query  361  NEHKELKWWGSELDHCPL  308
                 + WWGS+ +HC L
Sbjct  220  MHGISISWWGSDGEHCDL  237



>ref|XP_006433763.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
 gb|ESR47003.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
Length=728

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 157/219 (72%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+++G +NL V WW+L S+E+IC    L  NSPWTCP  RV FDAS
Sbjct  509  KIPPRSMFLVQFIGTIIAGTINLIVAWWLLNSVEHICQPGLLPKNSPWTCPNDRVFFDAS  568

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FG  G Y  L W F+ G + P  VW+L K FP + WIPLIN+PV+    
Sbjct  569  VIWGLVGPRRIFGSQGNYGALNWFFVGGLLGPCAVWLLHKKFPNQSWIPLINLPVLLGAT  628

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VLL+ +L 
Sbjct  629  AYMPPATALNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGTAFMTVLLYVSLG  688

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E   L WWGS  D    HC LA+CPTA G+ V+GCPVF
Sbjct  689  LEGVNLHWWGSNPDIDPEHCDLATCPTAKGVAVDGCPVF  727



>gb|EAY75055.1| hypothetical protein OsI_02950 [Oryza sativa Indica Group]
Length=755

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 161/217 (74%), Gaps = 3/217 (1%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  P+SM++ QLVGT+V+  VNL V +W+LGSI NIC    L  +SPWTCP  RV FDAS
Sbjct  537  KIPPKSMFLVQLVGTVVASTVNLVVAYWLLGSIPNICQDALLPADSPWTCPNDRVFFDAS  596

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GP+R+FGP G Y    W FL GAV PV V++L + FP K WIP+IN+PV+    
Sbjct  597  VIWGLVGPRRIFGPLGNYGAFNWFFLAGAVGPVIVYLLHRAFPSKTWIPMINLPVLIGAT  656

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            + MPPAT  N  SW++ G+IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L 
Sbjct  657  SYMPPATAVNYNSWLIIGIIFNFFVFRYRKLWWKRYNYILSAALDAGVAFMAVLLYFSLS  716

Query  361  NEHKELKWWGSELDHCPLASCPTAPGIVVEG---CPV  260
             E++ + WWG+  +HCPLASCPTA GI +     CPV
Sbjct  717  MENRSISWWGTAGEHCPLASCPTAKGINLGADSVCPV  753



>ref|XP_010064240.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=748

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 162/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  901  KFLPRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDAS  722
            K  PRSM++ Q +GT+V+G VNL V WW+L SI NIC  + L PNSPWTCP  RV FDAS
Sbjct  530  KIPPRSMFLVQFIGTIVAGTVNLGVAWWLLDSITNICHKNVLPPNSPWTCPSDRVFFDAS  589

Query  721  VIWGLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGF  542
            VIWGL+GPKR+FG  G+Y+ L W FL G + PV VW+L K F ++ WIPLIN+PV+    
Sbjct  590  VIWGLVGPKRIFGSEGVYKALNWFFLGGLLGPVAVWLLHKSFRKQSWIPLINLPVLLGAT  649

Query  541  AGMPPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQ  362
            A MPPAT  N  SWIV G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAV+++FA  
Sbjct  650  AAMPPATALNYNSWIVVGTIFNFFIFRYRKRWWQRYNYILSAALDAGVAFMAVVIYFAFG  709

Query  361  NEHKELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  257
             E + L WWGS  D    HC LA+CPTA GI ++GCPVF
Sbjct  710  IEDRNLHWWGSNPDVDPEHCGLATCPTAKGISIDGCPVF  748



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2131933200072