BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1889

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010324853.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    310   4e-97   Solanum lycopersicum
ref|NP_001233907.1|  delta-1-pyrroline-5-carboxylate synthase           311   4e-97   Solanum lycopersicum
gb|AEN04068.1|  delta-1-pyrroline-5-carboxylate synthetase              311   5e-97   Solanum torvum [berenjena cimarrona]
ref|XP_006355262.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    309   2e-96   Solanum tuberosum [potatoes]
ref|XP_009588946.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    305   2e-95   Nicotiana tomentosiformis
ref|XP_009772171.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    305   2e-95   Nicotiana sylvestris
ref|XP_009588945.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    306   4e-95   Nicotiana tomentosiformis
ref|XP_009772170.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    306   4e-95   Nicotiana sylvestris
gb|ADL61840.1|  delta 1-pyrroline-5-carboxylate synthetase              305   5e-95   Nicotiana tabacum [American tobacco]
ref|XP_009760161.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    301   7e-95   Nicotiana sylvestris
ref|XP_009760160.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    301   7e-95   Nicotiana sylvestris
gb|ABO70348.1|  pyrroline-5-carboxylate synthetase                      305   7e-95   Apocynum venetum
gb|AAC84137.1|  pyrroline-5-carboxylate synthetase                      288   9e-95   Cichorium intybus [radicchio]
ref|XP_011085010.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    304   2e-94   Sesamum indicum [beniseed]
ref|XP_009615343.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    300   2e-94   Nicotiana tomentosiformis
ref|XP_006346827.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    303   6e-94   Solanum tuberosum [potatoes]
ref|XP_004240687.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    303   6e-94   Solanum lycopersicum
ref|XP_010321953.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    302   7e-94   Solanum lycopersicum
sp|O04015.1|P5CS_ACTDE  RecName: Full=Delta-1-pyrroline-5-carboxy...    301   2e-93   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009615342.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    300   4e-93   Nicotiana tomentosiformis
ref|XP_009615341.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    300   6e-93   Nicotiana tomentosiformis
emb|CDP00143.1|  unnamed protein product                                300   6e-93   Coffea canephora [robusta coffee]
gb|EYU19949.1|  hypothetical protein MIMGU_mgv1a002084mg                298   9e-93   Erythranthe guttata [common monkey flower]
gb|EYU19950.1|  hypothetical protein MIMGU_mgv1a002084mg                298   3e-92   Erythranthe guttata [common monkey flower]
ref|XP_010263774.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    298   5e-92   Nelumbo nucifera [Indian lotus]
gb|AHF58596.1|  delta 1-pyrroline-5-carboxylate synthetase 2            297   7e-92   Chrysanthemum lavandulifolium
gb|AHJ08569.1|  P5CS1                                                   296   3e-91   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_006486420.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    293   2e-90   Citrus sinensis [apfelsine]
gb|KJB74060.1|  hypothetical protein B456_011G269700                    292   3e-90   Gossypium raimondii
ref|XP_006435608.1|  hypothetical protein CICLE_v10030839mg             293   4e-90   
gb|KHG12117.1|  Delta-1-pyrroline-5-carboxylate synthase                291   4e-90   Gossypium arboreum [tree cotton]
gb|KDO69189.1|  hypothetical protein CISIN_1g005131mg                   292   4e-90   Citrus sinensis [apfelsine]
gb|KJB74059.1|  hypothetical protein B456_011G269700                    292   6e-90   Gossypium raimondii
gb|ACI62865.1|  delta 1-pyrroline-5-carboxylate synthetase              292   8e-90   Gossypium arboreum [tree cotton]
ref|XP_007009200.1|  Pyrroline-5-carboxylate synthetase isoform 2       288   9e-90   
gb|EYU35248.1|  hypothetical protein MIMGU_mgv1a002086mg                291   1e-89   Erythranthe guttata [common monkey flower]
gb|ABZ79407.2|  pyrroline-5-carboxylate synthetase                      291   7e-89   Gossypium arboreum [tree cotton]
gb|ABG74923.1|  pyrroline-5-carboxylate synthetase                      289   8e-89   Aegiceras corniculatum
ref|XP_011624153.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    289   8e-89   Amborella trichopoda
gb|AGE00987.1|  delta-1-pyrroline-5-carboxylate synthetase              283   8e-89   Morus alba
ref|XP_010658318.1|  PREDICTED: pyrroline-5-carboxylate synthetas...    289   9e-89   Vitis vinifera
ref|XP_007009202.1|  Pyrroline-5-carboxylate synthetase isoform 4       288   1e-88   
ref|XP_008441400.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    288   2e-88   Cucumis melo [Oriental melon]
gb|KCW65598.1|  hypothetical protein EUGRSUZ_G02990                     281   2e-88   Eucalyptus grandis [rose gum]
gb|ADK37758.1|  delta 1-pyrroline-5-carboxylate synthetase              288   2e-88   Jatropha curcas
ref|XP_009351358.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    288   2e-88   Pyrus x bretschneideri [bai li]
ref|XP_008233492.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    288   2e-88   Prunus mume [ume]
ref|XP_007009203.1|  Pyrroline-5-carboxylate synthetase isoform 5       287   2e-88   
ref|XP_012088529.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    288   3e-88   
ref|XP_007009199.1|  Pyrroline-5-carboxylate synthetase isoform 1       288   3e-88   
ref|XP_009343959.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    286   9e-88   Pyrus x bretschneideri [bai li]
ref|XP_004138450.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    286   9e-88   Cucumis sativus [cucumbers]
ref|XP_008372068.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    286   1e-87   Malus domestica [apple tree]
gb|AGW51410.1|  pyrroline-5-carboxylate synthetase                      286   1e-87   Salicornia bigelovii
gb|AFV15798.1|  gamma-glutamyl phosphate reductase                      286   1e-87   Carica papaya [mamon]
ref|XP_007220615.1|  hypothetical protein PRUPE_ppa002098mg             285   3e-87   Prunus persica
gb|AGC51785.1|  delta1-pyrroline-5-carboxylate synthase                 285   3e-87   Manihot esculenta [manioc]
gb|KCW65597.1|  hypothetical protein EUGRSUZ_G02990                     281   6e-87   Eucalyptus grandis [rose gum]
ref|XP_004307578.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    283   1e-86   Fragaria vesca subsp. vesca
ref|NP_001268134.1|  pyrroline-5-carboxylate synthetase                 284   2e-86   Vitis vinifera
gb|KCW65596.1|  hypothetical protein EUGRSUZ_G02990                     280   2e-86   Eucalyptus grandis [rose gum]
ref|XP_010691515.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    283   2e-86   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF19677.1|  pyrroline-5-carboxylate synthetase                      283   2e-86   Euonymus japonicus [Japanese spindletree]
ref|NP_001238153.1|  delta-pyrroline-5-carboxylate synthetase           282   3e-86   Glycine max [soybeans]
emb|CAX46385.1|  hypothetical protein                                   282   3e-86   Glycine max [soybeans]
ref|XP_004503180.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    282   3e-86   
ref|XP_007163470.1|  hypothetical protein PHAVU_001G236900g             282   3e-86   Phaseolus vulgaris [French bean]
gb|KHN07602.1|  Delta-1-pyrroline-5-carboxylate synthase                282   3e-86   Glycine soja [wild soybean]
gb|AEV46825.1|  delta-1-pyrroline-5-carboxylate synthetase              282   3e-86   Boehmeria nivea [Chinese silk-plant]
ref|XP_010108393.1|  Delta-1-pyrroline-5-carboxylate synthase           283   4e-86   
gb|ABY89287.1|  pyrroline-5-carboxylate synthetase                      282   5e-86   Phaseolus vulgaris [French bean]
gb|AEO51062.1|  pyrroline-5-carboxylate synthetase                      281   8e-86   Malus hupehensis
ref|XP_011076783.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    281   1e-85   Sesamum indicum [beniseed]
emb|CBH32076.1|  hypothetical protein                                   281   1e-85   Glycine max [soybeans]
ref|XP_002524230.1|  delta 1-pyrroline-5-carboxylate synthetase, ...    281   1e-85   Ricinus communis
ref|XP_003519362.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    281   1e-85   Glycine max [soybeans]
gb|AFW04294.1|  delta-pyrroline-5-carboxylate synthetase                280   2e-85   Lespedeza potaninii
emb|CDP06570.1|  unnamed protein product                                281   2e-85   Coffea canephora [robusta coffee]
gb|KCW65595.1|  hypothetical protein EUGRSUZ_G02990                     280   2e-85   Eucalyptus grandis [rose gum]
ref|XP_009412561.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    280   2e-85   
gb|AAS89034.1|  delta-1-pyrroline-5-carboxylate synthetase              280   2e-85   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055723.1|  Os05g0455500                                       280   3e-85   
dbj|BAA19916.1|  deltal-pyrroline-5-carboxylate synthetase              280   3e-85   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010067456.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    280   3e-85   Eucalyptus grandis [rose gum]
emb|CAX46386.1|  hypothetical protein                                   279   5e-85   Glycine max [soybeans]
gb|AEN04066.1|  delta-1-pyrroline-5-carboxylate synthetase              279   6e-85   Cucurbita maxima x Cucurbita moschata
ref|XP_007141843.1|  hypothetical protein PHAVU_008G230300g             278   8e-85   Phaseolus vulgaris [French bean]
gb|ABX54880.2|  delta-pyrroline-5-carboxylate synthetase                278   9e-85   Eucalyptus camaldulensis
ref|XP_009419714.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    278   9e-85   Musa acuminata subsp. malaccensis [pisang utan]
gb|AET97457.1|  delta1-pyrroline-5-carboxylate synthetase               278   1e-84   Musa acuminata AAA Group [Cavendish banana]
gb|AGW30209.1|  P5CS                                                    278   1e-84   Nitraria tangutorum
ref|XP_003544177.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    278   2e-84   Glycine max [soybeans]
ref|XP_011077626.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    278   2e-84   Sesamum indicum [beniseed]
ref|XP_008369947.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    278   3e-84   Malus domestica [apple tree]
ref|XP_008369946.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    278   3e-84   Malus domestica [apple tree]
ref|XP_009345430.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    277   3e-84   Pyrus x bretschneideri [bai li]
gb|AES71013.2|  delta-1-pyrroline-5-carboxylate synthetase              277   3e-84   Medicago truncatula
gb|AHJ60270.1|  delta-1-pyrroline-5-carboxylate synthase 2              278   3e-84   Pyrus betulifolia
emb|CAC82184.1|  pyrroline-5-carboxylate synthetase 1                   277   3e-84   Medicago truncatula
gb|ACZ67848.1|  pyrroline-5-carboxylate synthetase                      277   3e-84   Medicago falcata [sickle alfalfa]
sp|P32296.1|P5CS_VIGAC  RecName: Full=Delta-1-pyrroline-5-carboxy...    276   3e-84   Vigna aconitifolia [moth-bean]
ref|XP_008387828.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    277   4e-84   
ref|XP_011036063.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    277   4e-84   Populus euphratica
gb|ABY76166.1|  pyrroline-5-carboxylate synthetase                      276   5e-84   Medicago sativa subsp. x varia
ref|XP_009358778.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    276   6e-84   Pyrus x bretschneideri [bai li]
ref|XP_009358777.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    276   6e-84   Pyrus x bretschneideri [bai li]
gb|AEO27874.1|  pyrroline-5-carboxylate synthetase                      276   6e-84   Cucumis melo [Oriental melon]
ref|XP_002315202.1|  VuP5CS family protein                              276   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_007026913.1|  Pyrroline-5-carboxylate synthetase isoform 3       271   1e-83   
gb|EMS59537.1|  Delta-1-pyrroline-5-carboxylate synthase                271   1e-83   Triticum urartu
emb|CBH32077.1|  hypothetical protein                                   275   1e-83   Glycine max [soybeans]
emb|CAA67069.1|  delta-1-pyrroline-5-carboxylate synthase               276   1e-83   Medicago sativa [alfalfa]
ref|XP_004961886.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    275   2e-83   Setaria italica
ref|XP_006654501.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    275   2e-83   Oryza brachyantha
gb|AGW20994.1|  delta 1-pyrroline-5-carboxylate synthetase 2            275   2e-83   Saccharum hybrid cultivar [sugarcane]
ref|XP_003600762.1|  Delta-pyrroline-5-carboxylate synthetase           276   2e-83   
gb|EMT16872.1|  Delta-1-pyrroline-5-carboxylate synthetase              275   4e-83   
emb|CDM85013.1|  unnamed protein product                                275   4e-83   Triticum aestivum [Canadian hard winter wheat]
gb|AGQ04179.1|  putative delta-1-pyrroline-5-carboxylate 1              274   5e-83   Lolium perenne [perennial ryegrass]
gb|ABV03819.1|  delta-1-pyrroline-5-carboxylate synthetase              274   5e-83   Saccharum arundinaceum
gb|AIA10349.1|  delta-1-pyrroline-5-carboxylate synthetase              274   6e-83   Saccharum hybrid cultivar GT21
ref|XP_003568327.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    273   8e-83   Brachypodium distachyon [annual false brome]
gb|ACU65227.1|  delta-1-pyrroline-5-carboxylate synthetase 2            273   2e-82   Sorghum bicolor [broomcorn]
ref|XP_004970573.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    273   2e-82   Setaria italica
gb|EYU26613.1|  hypothetical protein MIMGU_mgv1a002088mg                272   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_008240359.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    272   2e-82   Prunus mume [ume]
ref|XP_008240350.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    272   2e-82   Prunus mume [ume]
ref|XP_007208056.1|  hypothetical protein PRUPE_ppa002087mg             272   2e-82   Prunus persica
gb|ABS32296.2|  delta-1-pyrroline-5-carboxylate synthetase              272   2e-82   Saccharum officinarum [noble cane]
gb|AHM25913.1|  delta 1-pyrroline-5-carboxylate synthase                272   3e-82   Calotropis procera
gb|AGS78290.1|  pyrroline-5-carboxylate synthetase                      271   3e-82   Lolium perenne [perennial ryegrass]
gb|AGQ04180.1|  putative delta-1-pyrroline-5-carboxylate 2              271   4e-82   Lolium perenne [perennial ryegrass]
gb|AIZ77473.1|  delta1-pyrroline-5-carboxylate synthetase               271   5e-82   Triticum aestivum [Canadian hard winter wheat]
gb|AAX35536.1|  delta 1-pyrroline-5-carboxylate synthetase              271   6e-82   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007026911.1|  Pyrroline-5-carboxylate synthetase isoform 1       271   7e-82   
gb|EMT28782.1|  Delta-1-pyrroline-5-carboxylate synthetase              270   1e-81   
gb|ADU02859.1|  delta(1)-pyrroline-5-carboxylate synthetase             270   1e-81   Puccinellia chinampoensis
ref|NP_001291233.1|  delta-1-pyrroline-5-carboxylate synthase-like      270   2e-81   Populus euphratica
ref|XP_006379609.1|  hypothetical protein POPTR_0008s06060g             269   2e-81   
ref|XP_004137758.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    270   3e-81   Cucumis sativus [cucumbers]
gb|AGW20993.1|  delta 1-pyrroline-5-carboxylate synthetase 1            270   3e-81   Saccharum hybrid cultivar [sugarcane]
ref|XP_004305183.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    269   3e-81   Fragaria vesca subsp. vesca
gb|AFP89589.1|  delta-1-pyrroline-5-carboxylate synthetase              270   3e-81   Sophora davidii
ref|XP_003564608.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    269   4e-81   Brachypodium distachyon [annual false brome]
ref|XP_003516890.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    269   1e-80   Glycine max [soybeans]
gb|KHN05644.1|  Delta-1-pyrroline-5-carboxylate synthase                268   1e-80   Glycine soja [wild soybean]
gb|KJB46606.1|  hypothetical protein B456_007G377200                    268   1e-80   Gossypium raimondii
dbj|BAD97364.1|  delta1-pyrroline-5-carboxylate synthetase              267   1e-80   Triticum aestivum [Canadian hard winter wheat]
gb|KHG23088.1|  Delta-1-pyrroline-5-carboxylate synthase                267   1e-80   Gossypium arboreum [tree cotton]
ref|NP_001044802.1|  Os01g0848200                                       268   1e-80   
gb|ABM30223.1|  delta-1-pyrroline-5-carboxylate synthetase              267   2e-80   Saccharum officinarum [noble cane]
ref|XP_006645010.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    267   3e-80   Oryza brachyantha
gb|KJB76799.1|  hypothetical protein B456_012G107700                    266   3e-80   Gossypium raimondii
ref|XP_003520914.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    267   4e-80   Glycine max [soybeans]
ref|XP_010691523.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    266   4e-80   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAI22477.1|  delta 1-pyrroline-5-carboxylate synthase               266   7e-80   Vigna unguiculata
dbj|BAB33037.1|  VuP5CS                                                 266   7e-80   Vigna unguiculata
ref|XP_010105422.1|  Delta-1-pyrroline-5-carboxylate synthase           251   7e-80   
gb|AFW81700.1|  delta-pyrroline-5-carboxylate synthetase                265   9e-80   
ref|XP_009133385.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    263   1e-79   
gb|ERN08053.1|  hypothetical protein AMTR_s00012p00263260               265   1e-79   Amborella trichopoda
ref|XP_008656219.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    265   2e-79   
ref|XP_006411215.1|  hypothetical protein EUTSA_v10016322mg             264   2e-79   
gb|KJB76800.1|  hypothetical protein B456_012G107700                    265   2e-79   Gossypium raimondii
ref|XP_010654240.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    264   3e-79   Vitis vinifera
ref|XP_006411212.1|  hypothetical protein EUTSA_v10016322mg             264   3e-79   Eutrema salsugineum [saltwater cress]
ref|XP_006293364.1|  hypothetical protein CARUB_v10022685mg             265   3e-79   
gb|EEE63954.1|  hypothetical protein OsJ_18779                          264   4e-79   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79334.1|  hypothetical protein OsI_20190                          264   4e-79   Oryza sativa Indica Group [Indian rice]
gb|ABR18097.1|  unknown                                                 264   4e-79   Picea sitchensis
emb|CDY20482.1|  BnaC04g05620D                                          263   5e-79   Brassica napus [oilseed rape]
gb|AIF76244.1|  delta1-pyrroline-5-carboxylate synthetase 1             263   5e-79   Brassica napus [oilseed rape]
gb|AAK01360.1|AF314811_1  delta 1-pyrroline-5-carboxylate synthet...    263   5e-79   Brassica napus [oilseed rape]
gb|AIF76241.1|  delta1-pyrroline-5-carboxylate synthetase 1             263   5e-79   Brassica napus [oilseed rape]
ref|XP_009143283.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    263   5e-79   Brassica rapa
ref|NP_181510.1|  delta1-pyrroline-5-carboxylate synthase 1             263   6e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881679.1|  delta1-pyrroline-5-carboxylate synthase 1          263   6e-79   Arabidopsis lyrata subsp. lyrata
emb|CDY65768.1|  BnaC04g55570D                                          263   7e-79   Brassica napus [oilseed rape]
ref|NP_001189715.1|  delta1-pyrroline-5-carboxylate synthase 1          263   7e-79   Arabidopsis thaliana [mouse-ear cress]
gb|KJB16950.1|  hypothetical protein B456_002G256200                    263   8e-79   Gossypium raimondii
gb|KFK36869.1|  hypothetical protein AALP_AA4G182500                    263   8e-79   Arabis alpina [alpine rockcress]
gb|AIF76246.1|  delta1-pyrroline-5-carboxylate synthetase 1             262   1e-78   Brassica napus [oilseed rape]
gb|KJB16951.1|  hypothetical protein B456_002G256200                    263   1e-78   Gossypium raimondii
emb|CDY61781.1|  BnaC03g72600D                                          262   1e-78   Brassica napus [oilseed rape]
ref|XP_002441204.1|  hypothetical protein SORBIDRAFT_09g022310          253   1e-78   Sorghum bicolor [broomcorn]
emb|CDY07635.1|  BnaA03g18760D                                          262   1e-78   Brassica napus [oilseed rape]
ref|XP_009133384.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    262   1e-78   Brassica rapa
gb|KJB46607.1|  hypothetical protein B456_007G377200                    263   1e-78   Gossypium raimondii
ref|XP_004506632.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    263   1e-78   Cicer arietinum [garbanzo]
ref|NP_001118846.1|  delta 1-pyrroline-5-carboxylate synthase 2         260   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139148.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    262   2e-78   Brassica rapa
emb|CDX76082.1|  BnaA04g03460D                                          261   2e-78   
gb|AAL87255.1|  putative delta-1-pyrroline 5-carboxylase syntheta...    261   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147111.1|  LOC100280719                                       261   3e-78   Zea mays [maize]
ref|XP_010534556.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    261   3e-78   Tarenaya hassleriana [spider flower]
gb|AAV67896.1|  delta-1-pyrroline 5-carboxylase synthetase              261   3e-78   Chorispora bungeana
ref|XP_008654886.1|  PREDICTED: LOC100280719 isoform X1                 261   3e-78   
gb|KEH29008.1|  delta-1-pyrroline-5-carboxylate synthetase              260   6e-78   Medicago truncatula
ref|XP_011651883.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    260   6e-78   Cucumis sativus [cucumbers]
gb|AIF76243.1|  delta1-pyrroline-5-carboxylate synthetase 1             260   7e-78   Brassica napus [oilseed rape]
ref|XP_006403440.1|  hypothetical protein EUTSA_v10010150mg             257   7e-78   
ref|XP_010067457.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    260   7e-78   
ref|XP_010508967.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    260   8e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010517343.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    260   8e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010505668.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    260   9e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010931202.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    257   1e-77   
ref|XP_006290649.1|  hypothetical protein CARUB_v10016741mg             260   1e-77   Capsella rubella
ref|NP_191120.2|  delta 1-pyrroline-5-carboxylate synthase 2            260   1e-77   Arabidopsis thaliana [mouse-ear cress]
emb|CAB81586.1|  delta-1-pyrroline-5-carboxylate synthetase             260   1e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KEH29007.1|  delta-1-pyrroline-5-carboxylate synthetase              260   1e-77   Medicago truncatula
gb|AET35478.1|  delta-1-pyrroline-5-carboxylate synthetase 3            260   1e-77   Medicago truncatula
gb|KEH29006.1|  delta-1-pyrroline-5-carboxylate synthetase              260   2e-77   Medicago truncatula
ref|XP_002878042.1|  delta 1-pyrroline-5-carboxylate synthase 2         259   2e-77   
gb|ACU65226.1|  delta 1-pyrroline-5-carboxylate synthetase 1            259   2e-77   Sorghum bicolor [broomcorn]
gb|AET35479.1|  delta-1-pyrroline-5-carboxylate synthetase 3 vari...    259   2e-77   Medicago truncatula
gb|AAK01361.1|AF314812_1  delta 1-pyrroline-5-carboxylate synthet...    259   2e-77   Brassica napus [oilseed rape]
ref|XP_009116262.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    259   2e-77   Brassica rapa
ref|XP_010554640.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    259   3e-77   Tarenaya hassleriana [spider flower]
ref|XP_008785507.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    258   3e-77   Phoenix dactylifera
gb|KDO48131.1|  hypothetical protein CISIN_1g004665mg                   257   4e-77   Citrus sinensis [apfelsine]
ref|XP_008785506.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    258   4e-77   Phoenix dactylifera
ref|XP_006429189.1|  hypothetical protein CICLE_v10011176mg             257   4e-77   
ref|XP_010931197.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    257   4e-77   
ref|XP_010931199.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    256   5e-77   
emb|CDY41203.1|  BnaC08g26550D                                          258   7e-77   Brassica napus [oilseed rape]
ref|XP_010931195.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    256   1e-76   Elaeis guineensis
ref|XP_010931193.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    256   1e-76   
gb|KFK35118.1|  hypothetical protein AALP_AA5G238400                    257   1e-76   Arabis alpina [alpine rockcress]
ref|XP_007140469.1|  hypothetical protein PHAVU_008G115100g             257   1e-76   Phaseolus vulgaris [French bean]
ref|XP_010931192.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    256   1e-76   Elaeis guineensis
ref|XP_006403442.1|  hypothetical protein EUTSA_v10010150mg             257   1e-76   Eutrema salsugineum [saltwater cress]
dbj|BAA06864.1|  delta1-pyrroline-5-carboxylate synthetase              257   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001756289.1|  predicted protein                                  257   2e-76   
ref|XP_010931190.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    256   3e-76   Elaeis guineensis
ref|XP_006429184.1|  hypothetical protein CICLE_v10011176mg             256   3e-76   
gb|KDO48127.1|  hypothetical protein CISIN_1g004665mg                   256   3e-76   Citrus sinensis [apfelsine]
gb|KDO48126.1|  hypothetical protein CISIN_1g004665mg                   256   3e-76   Citrus sinensis [apfelsine]
ref|XP_006429187.1|  hypothetical protein CICLE_v10011176mg             256   4e-76   
gb|KDO48125.1|  hypothetical protein CISIN_1g004665mg                   256   5e-76   Citrus sinensis [apfelsine]
ref|XP_010088578.1|  Delta-1-pyrroline-5-carboxylate synthase           254   2e-75   
sp|O65361.1|P5CS_MESCR  RecName: Full=Delta-1-pyrroline-5-carboxy...    254   2e-75   Mesembryanthemum crystallinum
ref|XP_008777668.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    254   2e-75   
ref|XP_010427346.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    254   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010504420.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    254   3e-75   Camelina sativa [gold-of-pleasure]
gb|AAW82442.1|  pyrroline-5-carboxylate synthetase                      236   3e-75   Solanum lycopersicum
ref|XP_010516141.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    253   4e-75   Camelina sativa [gold-of-pleasure]
ref|XP_006573308.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    249   1e-73   Glycine max [soybeans]
gb|AEP83831.1|  delta 1-pyrroline-5-carboxylate synthetase              232   2e-73   Nicotiana benthamiana
gb|AFW78229.1|  hypothetical protein ZEAMMB73_284633                    243   5e-73   
ref|XP_006573310.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    246   8e-73   
ref|XP_006573309.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    246   1e-72   
gb|EMS47116.1|  Delta-1-pyrroline-5-carboxylate synthase                246   5e-72   Triticum urartu
ref|XP_007134053.1|  hypothetical protein PHAVU_010G0154000g            244   6e-72   Phaseolus vulgaris [French bean]
ref|XP_006576558.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    244   1e-71   Glycine max [soybeans]
gb|AIF76245.1|  delta1-pyrroline-5-carboxylate synthetase 1             244   1e-71   Brassica napus [oilseed rape]
gb|KHN13112.1|  Delta-1-pyrroline-5-carboxylate synthase                242   3e-71   Glycine soja [wild soybean]
gb|AIF76242.1|  delta1-pyrroline-5-carboxylate synthetase 1             242   4e-71   Brassica napus [oilseed rape]
gb|AHJ08570.1|  P5CS2                                                   240   2e-70   Helianthus tuberosus [Jerusalem artichoke]
gb|AGP25716.1|  1-pyrroline-5-carboxylate synthetase                    240   3e-70   Cicer arietinum [garbanzo]
ref|XP_004506633.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    240   3e-70   
ref|XP_009141837.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    239   5e-70   Brassica rapa
gb|AHF58595.1|  delta 1-pyrroline-5-carboxylate synthetase 1            239   5e-70   Chrysanthemum lavandulifolium
gb|KEH23002.1|  delta-1-pyrroline-5-carboxylate synthetase              238   2e-69   Medicago truncatula
ref|XP_003604847.1|  Delta-1-pyrroline-5-carboxylate synthetase         237   2e-69   
gb|AET87351.1|  delta-1-pyrroline-5-carboxylate synthetase 2            238   2e-69   Medicago truncatula
ref|XP_003604845.1|  Delta-1-pyrroline-5-carboxylate synthetase         238   3e-69   
ref|XP_003604846.1|  Delta-1-pyrroline-5-carboxylate synthetase         238   4e-69   
ref|XP_004491997.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    236   6e-69   Cicer arietinum [garbanzo]
gb|EPS66523.1|  delta-1-pyrroline-5-carboxylate synthase                226   5e-68   Genlisea aurea
ref|XP_003529108.2|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    231   9e-67   Glycine max [soybeans]
ref|XP_006583602.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    231   9e-67   Glycine max [soybeans]
gb|KHN04057.1|  Delta-1-pyrroline-5-carboxylate synthase                231   1e-66   Glycine soja [wild soybean]
ref|XP_003552201.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    230   1e-66   Glycine max [soybeans]
ref|XP_006602612.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    230   2e-66   Glycine max [soybeans]
gb|AIL24122.1|  delta 1-pyrroline-5-carboxylate synthetase 2            216   2e-65   Tamarix hispida
ref|XP_002981474.1|  hypothetical protein SELMODRAFT_444883             225   2e-64   
ref|XP_002970003.1|  hypothetical protein SELMODRAFT_410685             225   2e-64   
ref|XP_006429186.1|  hypothetical protein CICLE_v10011176mg             214   1e-60   Citrus clementina [clementine]
gb|KDO48124.1|  hypothetical protein CISIN_1g004665mg                   214   1e-60   Citrus sinensis [apfelsine]
gb|KDO48132.1|  hypothetical protein CISIN_1g004665mg                   211   1e-59   
ref|XP_006429188.1|  hypothetical protein CICLE_v10011176mg             211   1e-59   
ref|XP_010263775.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    205   9e-58   
ref|XP_009412563.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    196   3e-54   
gb|AGQ04178.1|  putative delta-1-pyrroline-5-carboxylate                182   2e-53   
ref|XP_011469823.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    193   5e-53   
ref|XP_011469822.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    191   4e-52   
dbj|BAH20244.1|  AT2G39800                                              189   6e-52   
gb|KHG25150.1|  Delta-1-pyrroline-5-carboxylate synthase                185   2e-50   
gb|ADN67595.1|  delta 1-pyrroline-5-carboxylate synthetase              148   2e-38   
gb|ABT17466.1|  delta 1-pyrroline-5-carboxylate synthetase              148   1e-37   
ref|XP_010086290.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   9e-37   
ref|XP_010200341.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   2e-36   
ref|XP_005645012.1|  pyrroline-5-carboxlyate synthetase                 146   3e-36   
ref|XP_009868497.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   3e-36   
gb|KFQ53057.1|  Delta-1-pyrroline-5-carboxylate synthase                142   3e-36   
ref|XP_009484291.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   5e-36   
ref|XP_011601187.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    145   5e-36   
ref|XP_009840015.1|  hypothetical protein, variant                      139   6e-36   
ref|NP_001086040.1|  aldehyde dehydrogenase 18 family, member A1        145   6e-36   
gb|AAI23966.1|  hypothetical protein LOC550060                          145   7e-36   
ref|NP_001017306.1|  aldehyde dehydrogenase 18 family, member A1        145   7e-36   
ref|XP_002291080.1|  gamma-glutamyl phosphate reductase                 145   8e-36   
ref|XP_011683493.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    145   8e-36   
gb|KFW96586.1|  Delta-1-pyrroline-5-carboxylate synthase                142   8e-36   
gb|KFV41999.1|  Delta-1-pyrroline-5-carboxylate synthase                142   9e-36   
ref|XP_011683492.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    145   9e-36   
gb|EOB01279.1|  Delta-1-pyrroline-5-carboxylate synthetase              142   1e-35   
ref|XP_009808263.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-35   
ref|XP_010773040.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    145   1e-35   
ref|XP_009503295.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-35   
ref|XP_009840014.1|  hypothetical protein H257_14003                    139   1e-35   
ref|XP_008880255.1|  hypothetical protein H310_14222                    139   2e-35   
ref|XP_010737632.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    144   2e-35   
gb|KDO22020.1|  hypothetical protein SPRG_12229                         138   2e-35   
ref|XP_010747082.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    144   2e-35   
ref|XP_005089398.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    144   2e-35   
ref|XP_005019770.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   3e-35   
ref|XP_008428542.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    144   3e-35   
ref|XP_004942439.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   3e-35   
ref|XP_003441257.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    144   3e-35   
ref|XP_008178037.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   3e-35   
gb|ELK00888.1|  Delta-1-pyrroline-5-carboxylate synthetase              144   3e-35   
ref|XP_007551514.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   3e-35   
dbj|BAE22034.1|  unnamed protein product                                142   3e-35   
ref|XP_005742441.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   3e-35   
emb|CAG05171.1|  unnamed protein product                                145   3e-35   
ref|XP_006925994.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   3e-35   
ref|XP_006925993.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_005795198.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_011372264.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_004559751.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_011372263.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_005927188.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_004669980.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
gb|KFQ13179.1|  Delta-1-pyrroline-5-carboxylate synthase                142   4e-35   
ref|XP_004580317.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   4e-35   
ref|XP_005048939.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   4e-35   
ref|XP_004904306.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_004838613.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_004669981.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_004838612.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   4e-35   
ref|XP_004904307.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   5e-35   
dbj|BAE28089.1|  unnamed protein product                                142   5e-35   
ref|XP_009924387.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   5e-35   
ref|XP_009924386.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   5e-35   
ref|XP_006831242.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   5e-35   
ref|XP_006831243.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   5e-35   
ref|XP_006630902.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   5e-35   
ref|XP_005919725.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   5e-35   
ref|XP_009952018.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   5e-35   
ref|XP_005919724.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   5e-35   
gb|KFW84835.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
ref|XP_011588255.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   6e-35   
gb|KFV62888.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
gb|KFP66784.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
ref|XP_009324273.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_005528915.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_006791243.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
gb|EPQ19727.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
gb|KGL72416.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
gb|KGL99398.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
ref|XP_004942436.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
gb|KFV39764.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
ref|XP_004942437.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_008297097.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
gb|KFO93637.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
ref|XP_006799025.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
gb|KFQ09771.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
gb|KFZ48099.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
ref|XP_004942438.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_005289409.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_008297014.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   6e-35   
ref|XP_008926760.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_006038141.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
gb|EMP41896.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
ref|XP_006129455.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_006129456.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
gb|KFM06734.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
ref|XP_005528914.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_009276247.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_005496399.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
gb|KFO79402.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
gb|KFO13715.1|  Delta-1-pyrroline-5-carboxylate synthase                142   6e-35   
ref|XP_010171432.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_010140694.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_010171433.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
ref|XP_008178036.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   6e-35   
gb|KFO58827.1|  Delta-1-pyrroline-5-carboxylate synthase                142   7e-35   
gb|KFQ38198.1|  Delta-1-pyrroline-5-carboxylate synthase                142   7e-35   
ref|XP_007424803.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   7e-35   
gb|KFW68374.1|  Delta-1-pyrroline-5-carboxylate synthase                142   7e-35   
ref|XP_008926759.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   7e-35   
ref|XP_010226705.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   7e-35   
ref|XP_010186028.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   7e-35   
ref|XP_005236145.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   7e-35   
ref|XP_009891035.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
gb|KFP69571.1|  Delta-1-pyrroline-5-carboxylate synthase                142   7e-35   
ref|XP_005236144.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   7e-35   
ref|XP_010406712.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   7e-35   
ref|XP_008495696.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   7e-35   
gb|KFQ98142.1|  Delta-1-pyrroline-5-carboxylate synthase                142   7e-35   
ref|XP_010140695.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_004561386.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_004561387.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_009965598.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_007424802.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   7e-35   
ref|XP_009908706.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_005438999.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_011588254.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_010580236.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_005515107.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
gb|KFQ34963.1|  Delta-1-pyrroline-5-carboxylate synthase                141   7e-35   
ref|XP_009563561.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_010713243.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_011620133.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_010186029.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_006038138.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_011620141.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_010306475.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_010226712.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_004323202.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_011588246.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_010580235.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_005438998.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
gb|KFV13589.1|  Delta-1-pyrroline-5-carboxylate synthase                142   7e-35   
ref|XP_007424804.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
ref|XP_010306476.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   7e-35   
gb|KFQ71081.1|  Delta-1-pyrroline-5-carboxylate synthase                142   8e-35   
ref|XP_009464692.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_008631542.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_003479808.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_010186030.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_005994898.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_009085331.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_005496400.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_009668847.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_009702054.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_008631543.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_008698322.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_009908705.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
gb|KFP03724.1|  Delta-1-pyrroline-5-carboxylate synthase                142   8e-35   
ref|XP_010713241.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    143   8e-35   
ref|XP_005008095.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_005994897.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_005144208.1|  PREDICTED: LOW QUALITY PROTEIN: delta-1-pyrr...    142   8e-35   
ref|XP_006218728.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_003787361.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   8e-35   
ref|XP_010280079.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_006174459.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_010280080.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_004427938.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_009980180.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_005048935.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_009082637.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_009980181.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_010713242.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_005048933.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_006218727.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_010972663.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_005048934.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_006174458.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_004370021.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
ref|XP_003441965.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   9e-35   
gb|AAD17518.1|  pyrroline-5-carboxylate synthetase short isoform        142   9e-35   
ref|XP_008944120.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    141   9e-35   
gb|KFU89512.1|  Delta-1-pyrroline-5-carboxylate synthase                142   9e-35   
ref|XP_007080172.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_006880151.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_007080174.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_004268421.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_008616498.1|  hypothetical protein SDRG_12213                    137   1e-34   
gb|EDL41838.1|  aldehyde dehydrogenase 18 family, member A1, isof...    142   1e-34   
ref|XP_005671393.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_006880150.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_005089394.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_008573459.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_004680650.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_003409266.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_005428872.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
gb|EFB16548.1|  hypothetical protein PANDA_017631                       142   1e-34   
ref|XP_006938096.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_008142329.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
gb|AAD17517.1|  pyrroline-5-carboxylate synthetase long isoform         142   1e-34   
ref|XP_007187525.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_534976.3|  PREDICTED: delta-1-pyrroline-5-carboxylate synt...    142   1e-34   
ref|XP_006938094.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_010587396.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_004701101.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|NP_001101994.1|  delta-1-pyrroline-5-carboxylate synthase           142   1e-34   
gb|ELK35705.1|  Delta-1-pyrroline-5-carboxylate synthase                142   1e-34   
ref|XP_007187524.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_007080173.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_007080171.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_001927564.2|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_010406711.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|XP_004680649.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|NP_062672.2|  delta-1-pyrroline-5-carboxylate synthase isoform 1    142   1e-34   
ref|XP_004416947.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   
ref|NP_705782.2|  delta-1-pyrroline-5-carboxylate synthase isoform 2    142   1e-34   
ref|XP_003749156.1|  PREDICTED: delta-1-pyrroline-5-carboxylate s...    142   1e-34   



>ref|XP_010324853.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X1 
[Solanum lycopersicum]
Length=691

 Score =   310 bits (795),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++VDSTRAFVK+VKR++VKVGTAVVTR+DGRLALGR+GALCEQ+QELNSQGYEVILVTS
Sbjct  1    METVDSTRAFVKNVKRLIVKVGTAVVTRADGRLALGRLGALCEQLQELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSF DLQKPQ ELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLLNSSFLDLQKPQTELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLN+ VN LLSLKVIPIFNENDAISTRRAPY
Sbjct  121  LLVTDNDFRDPDFRRQLNDTVNSLLSLKVIPIFNENDAISTRRAPY  166



>ref|NP_001233907.1| delta-1-pyrroline-5-carboxylate synthase [Solanum lycopersicum]
 sp|Q96480.1|P5CS_SOLLC RecName: Full=Delta-1-pyrroline-5-carboxylate synthase; Short=P5CS; 
Includes: RecName: Full=Glutamate 5-kinase; Short=GK; 
AltName: Full=Gamma-glutamyl kinase; Includes: RecName: Full=Gamma-glutamyl 
phosphate reductase; Short=GPR; AltName: Full=Glutamate-5-semialdehyde 
dehydrogenase; AltName: Full=Glutamyl-gamma-semialdehyde 
dehydrogenase [Solanum lycopersicum]
 gb|AAB67875.1| delta 1-pyrroline-5-carboxylate synthetase [Solanum lycopersicum]
Length=717

 Score =   311 bits (796),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++VDSTRAFVK+VKR++VKVGTAVVTR+DGRLALGR+GALCEQ+QELNSQGYEVILVTS
Sbjct  1    METVDSTRAFVKNVKRLIVKVGTAVVTRADGRLALGRLGALCEQLQELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSF DLQKPQ ELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLLNSSFLDLQKPQTELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLN+ VN LLSLKVIPIFNENDAISTRRAPY
Sbjct  121  LLVTDNDFRDPDFRRQLNDTVNSLLSLKVIPIFNENDAISTRRAPY  166



>gb|AEN04068.1| delta-1-pyrroline-5-carboxylate synthetase [Solanum torvum]
Length=717

 Score =   311 bits (796),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD+ DSTRAFVK+VKR++VKVGTAVVTR+DGRLALGR+GALCEQIQELNSQGYEVILVTS
Sbjct  1    MDTTDSTRAFVKNVKRVIVKVGTAVVTRADGRLALGRLGALCEQIQELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSF DLQKPQ ELDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLLNSSFFDLQKPQTELDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLN+ VN LLSLKV+PIFNENDAISTRRAPY
Sbjct  121  LLVTDNDFRDPDFRRQLNDTVNSLLSLKVVPIFNENDAISTRRAPY  166



>ref|XP_006355262.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Solanum 
tuberosum]
Length=717

 Score =   309 bits (792),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++VDSTR FVK+VKR++VKVGTAVVTR+DGRLALGR+GALCEQ+QELNSQGYEVILVTS
Sbjct  1    METVDSTRTFVKNVKRVIVKVGTAVVTRADGRLALGRLGALCEQLQELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSF DLQKPQ ELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLLNSSFLDLQKPQTELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLN+ VN LLSLKVIPIFNENDAISTRRAPY
Sbjct  121  LLVTDNDFRDPDFRRQLNDTVNSLLSLKVIPIFNENDAISTRRAPY  166



>ref|XP_009588946.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X2 
[Nicotiana tomentosiformis]
Length=666

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTR FV++VKR++VKVGTAVVTR+DGRLALGR+GALCEQIQELNSQGYEVILVTS
Sbjct  1    METADSTRTFVRNVKRVIVKVGTAVVTRTDGRLALGRLGALCEQIQELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSF DLQKPQ ELDGKACAAVGQNGLMALYDSLFSQLD+TSAQ
Sbjct  61   GAVGVGRQRLRYRKLLNSSFLDLQKPQSELDGKACAAVGQNGLMALYDSLFSQLDMTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLN+ VN LLSLKVIPIFNENDAISTR+APY
Sbjct  121  LLVTDNDFRDPDFRRQLNDTVNSLLSLKVIPIFNENDAISTRKAPY  166



>ref|XP_009772171.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X2 
[Nicotiana sylvestris]
Length=666

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTR FV++VKR++VKVGTAVVTR+DGRLALGR+GALCEQIQELNSQGYEVILVTS
Sbjct  1    METADSTRTFVRNVKRVIVKVGTAVVTRTDGRLALGRLGALCEQIQELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSF DLQKPQ ELDGKACAAVGQNGLMALYDSLFSQLD+TSAQ
Sbjct  61   GAVGVGRQRLRYRKLLNSSFLDLQKPQSELDGKACAAVGQNGLMALYDSLFSQLDMTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLN+ VN LLSLKVIPIFNENDAISTR+APY
Sbjct  121  LLVTDNDFRDPDFRRQLNDTVNSLLSLKVIPIFNENDAISTRKAPY  166



>ref|XP_009588945.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X1 
[Nicotiana tomentosiformis]
Length=719

 Score =   306 bits (783),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTR FV++VKR++VKVGTAVVTR+DGRLALGR+GALCEQIQELNSQGYEVILVTS
Sbjct  1    METADSTRTFVRNVKRVIVKVGTAVVTRTDGRLALGRLGALCEQIQELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSF DLQKPQ ELDGKACAAVGQNGLMALYDSLFSQLD+TSAQ
Sbjct  61   GAVGVGRQRLRYRKLLNSSFLDLQKPQSELDGKACAAVGQNGLMALYDSLFSQLDMTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLN+ VN LLSLKVIPIFNENDAISTR+APY
Sbjct  121  LLVTDNDFRDPDFRRQLNDTVNSLLSLKVIPIFNENDAISTRKAPY  166



>ref|XP_009772170.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X1 
[Nicotiana sylvestris]
Length=719

 Score =   306 bits (783),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTR FV++VKR++VKVGTAVVTR+DGRLALGR+GALCEQIQELNSQGYEVILVTS
Sbjct  1    METADSTRTFVRNVKRVIVKVGTAVVTRTDGRLALGRLGALCEQIQELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSF DLQKPQ ELDGKACAAVGQNGLMALYDSLFSQLD+TSAQ
Sbjct  61   GAVGVGRQRLRYRKLLNSSFLDLQKPQSELDGKACAAVGQNGLMALYDSLFSQLDMTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLN+ VN LLSLKVIPIFNENDAISTR+APY
Sbjct  121  LLVTDNDFRDPDFRRQLNDTVNSLLSLKVIPIFNENDAISTRKAPY  166



>gb|ADL61840.1| delta 1-pyrroline-5-carboxylate synthetase [Nicotiana tabacum]
Length=719

 Score =   305 bits (782),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTR FV++VKR++VKVGTAVVTR+DGRLALGR+GALCEQIQELNSQGYEVILVTS
Sbjct  1    METADSTRTFVRNVKRVIVKVGTAVVTRTDGRLALGRLGALCEQIQELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSF DLQKPQ ELDGKACAAVGQNGLMALYDSLFSQLD+TSAQ
Sbjct  61   GAVGVGRQRLRYRKLLNSSFLDLQKPQSELDGKACAAVGQNGLMALYDSLFSQLDMTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLN+ VN LLSLKVIPIFNENDAISTR+APY
Sbjct  121  LLVTDNDFRDPDFRRQLNDTVNSLLSLKVIPIFNENDAISTRKAPY  166



>ref|XP_009760161.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Nicotiana sylvestris]
Length=582

 Score =   301 bits (772),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS D  RAFVKDVKRI++KVGTAVVTR DGRLALGRMG+LCEQI+EL +QG+EVILVTS
Sbjct  1    MDSADPARAFVKDVKRIIIKVGTAVVTRGDGRLALGRMGSLCEQIRELTTQGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ +LDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLINSSFADLQKPQGDLDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            L+VTDNDFRDPDFR QLNE VN LL LKV+PIFNENDAISTR+APY
Sbjct  121  LMVTDNDFRDPDFRRQLNETVNSLLCLKVVPIFNENDAISTRKAPY  166



>ref|XP_009760160.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Nicotiana sylvestris]
Length=586

 Score =   301 bits (772),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS D  RAFVKDVKRI++KVGTAVVTR DGRLALGRMG+LCEQI+EL +QG+EVILVTS
Sbjct  1    MDSADPARAFVKDVKRIIIKVGTAVVTRGDGRLALGRMGSLCEQIRELTTQGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ +LDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLINSSFADLQKPQGDLDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            L+VTDNDFRDPDFR QLNE VN LL LKV+PIFNENDAISTR+APY
Sbjct  121  LMVTDNDFRDPDFRRQLNETVNSLLCLKVVPIFNENDAISTRKAPY  166



>gb|ABO70348.1| pyrroline-5-carboxylate synthetase [Apocynum venetum]
Length=718

 Score =   305 bits (781),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 160/167 (96%), Gaps = 1/167 (1%)
 Frame = +2

Query  251  MDS-VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVT  427
            MDS V++TRAFVKDVKR++VKVGTAVVTR+DGRLALGR+GALCEQI ELNSQGYEVILVT
Sbjct  1    MDSNVNATRAFVKDVKRVIVKVGTAVVTRADGRLALGRLGALCEQIHELNSQGYEVILVT  60

Query  428  SGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSA  607
            SGAVG GRQRL+YRRL++SSFADLQK Q ELDGKACAAVGQNGLMALYDSLF+QLDVTSA
Sbjct  61   SGAVGVGRQRLKYRRLVNSSFADLQKLQNELDGKACAAVGQNGLMALYDSLFTQLDVTSA  120

Query  608  QLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            QLLVTDNDFRDPDFR QLNEAVN LL+LKV+P+FNENDA+STRRAPY
Sbjct  121  QLLVTDNDFRDPDFRRQLNEAVNSLLALKVVPVFNENDAVSTRRAPY  167



>gb|AAC84137.1| pyrroline-5-carboxylate synthetase [Cichorium intybus]
Length=190

 Score =   288 bits (737),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  272  RAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVGAGR  451
            R F+KDVKRIV+KVGTAVVTR DGRLALGR+GALCEQIQ LNSQG+EVILV+SGAVGAGR
Sbjct  2    RGFLKDVKRIVIKVGTAVVTREDGRLALGRLGALCEQIQILNSQGFEVILVSSGAVGAGR  61

Query  452  QRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVTDND  631
            QRLRYR+L+HSSFADLQKPQ ELDGKACAAVGQNGLMALYD+LFSQLDVTSAQLLVTDND
Sbjct  62   QRLRYRKLVHSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSQLDVTSAQLLVTDND  121

Query  632  FRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            FR P+FR QL E V+ LLS KVIP+FNENDA+STRRAPY
Sbjct  122  FRSPEFRKQLTETVDSLLSYKVIPVFNENDAVSTRRAPY  160



>ref|XP_011085010.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Sesamum 
indicum]
Length=717

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTRAFVKDVKR+V+KVGTAVVTR+DGRLALGR+GALCEQI ELN QGYEVILVTS
Sbjct  1    MEATDSTRAFVKDVKRVVIKVGTAVVTRADGRLALGRLGALCEQIHELNYQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLINSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDP FR QLNE V  LLSLKV+PIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDPAFRKQLNETVMSLLSLKVVPIFNENDAVSTRKAPY  166



>ref|XP_009615343.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X3 [Nicotiana tomentosiformis]
Length=592

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD+ D  RAFVKDVKRI++KVGTAVVTR DGRLALGRMG+LCEQI+EL +QG+EVILVTS
Sbjct  1    MDTADPARAFVKDVKRIIIKVGTAVVTRGDGRLALGRMGSLCEQIRELTTQGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ +LDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLINSSFADLQKPQGDLDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            L+VTDNDFRDPDFR QLNE VN LL LKV+PIFNENDAISTR+APY
Sbjct  121  LMVTDNDFRDPDFRRQLNETVNSLLCLKVVPIFNENDAISTRKAPY  166



>ref|XP_006346827.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Solanum 
tuberosum]
Length=717

 Score =   303 bits (775),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS D  RAFVKDVKRI++KVGTAVVTR DGRLALGRMG+LCEQI+EL SQG+EVILVTS
Sbjct  1    MDSADPARAFVKDVKRIIIKVGTAVVTRGDGRLALGRMGSLCEQIRELTSQGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ +LDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLINSSFADLQKPQGDLDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            L+VTDNDFRDPDFR QLNE VN LL LKV+PIFNENDAISTR+APY
Sbjct  121  LMVTDNDFRDPDFRRQLNETVNSLLCLKVVPIFNENDAISTRKAPY  166



>ref|XP_004240687.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Solanum lycopersicum]
Length=717

 Score =   303 bits (775),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS D  RAFVKDVKRI++KVGTAVVTR DGRLALGRMG+LCEQI+EL SQG+EVILVTS
Sbjct  1    MDSADPARAFVKDVKRIIIKVGTAVVTRGDGRLALGRMGSLCEQIRELTSQGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ +LDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLINSSFADLQKPQGDLDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            L+VTDNDFRDPDFR QLNE VN LL LKV+PIFNENDAISTR+APY
Sbjct  121  LMVTDNDFRDPDFRRQLNETVNSLLCLKVVPIFNENDAISTRKAPY  166



>ref|XP_010321953.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Solanum lycopersicum]
Length=721

 Score =   302 bits (774),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS D  RAFVKDVKRI++KVGTAVVTR DGRLALGRMG+LCEQI+EL SQG+EVILVTS
Sbjct  1    MDSADPARAFVKDVKRIIIKVGTAVVTRGDGRLALGRMGSLCEQIRELTSQGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ +LDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLINSSFADLQKPQGDLDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            L+VTDNDFRDPDFR QLNE VN LL LKV+PIFNENDAISTR+APY
Sbjct  121  LMVTDNDFRDPDFRRQLNETVNSLLCLKVVPIFNENDAISTRKAPY  166



>sp|O04015.1|P5CS_ACTDE RecName: Full=Delta-1-pyrroline-5-carboxylate synthase; Short=P5CS; 
Includes: RecName: Full=Glutamate 5-kinase; Short=GK; 
AltName: Full=Gamma-glutamyl kinase; Includes: RecName: Full=Gamma-glutamyl 
phosphate reductase; Short=GPR; AltName: Full=Glutamate-5-semialdehyde 
dehydrogenase; AltName: Full=Glutamyl-gamma-semialdehyde 
dehydrogenase [Actinidia deliciosa]
 gb|AAC14481.1| pyrroline-5-carboxylate synthetase [Actinidia deliciosa]
Length=717

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD+VDSTRAFVK VKR+++KVGTAVVTR+DGRLALGR+GALCEQI ELNSQG+EVILVTS
Sbjct  1    MDAVDSTRAFVKGVKRVIIKVGTAVVTRADGRLALGRLGALCEQIHELNSQGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQNGL+ALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQIELDGKACAAVGQNGLLALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDP+FR QL E V  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDPEFRKQLTETVESLLNLKVIPIFNENDAVSTRKAPY  166



>ref|XP_009615342.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=719

 Score =   300 bits (769),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD+ D  RAFVKDVKRI++KVGTAVVTR DGRLALGRMG+LCEQI+EL +QG+EVILVTS
Sbjct  1    MDTADPARAFVKDVKRIIIKVGTAVVTRGDGRLALGRMGSLCEQIRELTTQGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ +LDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLINSSFADLQKPQGDLDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            L+VTDNDFRDPDFR QLNE VN LL LKV+PIFNENDAISTR+APY
Sbjct  121  LMVTDNDFRDPDFRRQLNETVNSLLCLKVVPIFNENDAISTRKAPY  166



>ref|XP_009615341.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=723

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD+ D  RAFVKDVKRI++KVGTAVVTR DGRLALGRMG+LCEQI+EL +QG+EVILVTS
Sbjct  1    MDTADPARAFVKDVKRIIIKVGTAVVTRGDGRLALGRMGSLCEQIRELTTQGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ +LDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRKLINSSFADLQKPQGDLDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            L+VTDNDFRDPDFR QLNE VN LL LKV+PIFNENDAISTR+APY
Sbjct  121  LMVTDNDFRDPDFRRQLNETVNSLLCLKVVPIFNENDAISTRKAPY  166



>emb|CDP00143.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +2

Query  263  DSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVG  442
            D TRAFVKDVKR++VKVGTA+VT++DGRLALGR+GALCEQIQELNS+GYEVILVTSGAVG
Sbjct  6    DLTRAFVKDVKRVIVKVGTAIVTQADGRLALGRLGALCEQIQELNSEGYEVILVTSGAVG  65

Query  443  AGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVT  622
            AGRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYDSLFSQLDVTSAQLLVT
Sbjct  66   AGRQRLRYRRLVNSSFADLQKPQHELDGKACAAVGQNSLMALYDSLFSQLDVTSAQLLVT  125

Query  623  DNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            DNDFRDPDFR QL+E V  LLSLKVIPI NENDA+STR+APY
Sbjct  126  DNDFRDPDFRKQLSETVKSLLSLKVIPILNENDAVSTRKAPY  167



>gb|EYU19949.1| hypothetical protein MIMGU_mgv1a002084mg [Erythranthe guttata]
Length=667

 Score =   298 bits (764),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+++DS RAFVKDVKR+V+KVGTAVVTR+DGRLALGR+G+LCEQI ELN QGYEVILVTS
Sbjct  1    MEALDSARAFVKDVKRVVIKVGTAVVTRADGRLALGRLGSLCEQIHELNMQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQNGLMALYD+LFSQLD+TSAQ
Sbjct  61   GAVGVGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSQLDMTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD +FR QLNE V  LLSLKV+PIFNENDA+STRRAPY
Sbjct  121  LLVTDNDFRDTEFRKQLNETVVSLLSLKVVPIFNENDAVSTRRAPY  166



>gb|EYU19950.1| hypothetical protein MIMGU_mgv1a002084mg [Erythranthe guttata]
Length=717

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+++DS RAFVKDVKR+V+KVGTAVVTR+DGRLALGR+G+LCEQI ELN QGYEVILVTS
Sbjct  1    MEALDSARAFVKDVKRVVIKVGTAVVTRADGRLALGRLGSLCEQIHELNMQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQNGLMALYD+LFSQLD+TSAQ
Sbjct  61   GAVGVGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSQLDMTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD +FR QLNE V  LLSLKV+PIFNENDA+STRRAPY
Sbjct  121  LLVTDNDFRDTEFRKQLNETVVSLLSLKVVPIFNENDAVSTRRAPY  166



>ref|XP_010263774.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X1 
[Nelumbo nucifera]
Length=717

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD +D TRAFVKDVKR++VKVGTAVVTR+DGRLALGR+GALCEQI+ELNS+GYEVILVTS
Sbjct  1    MDCMDPTRAFVKDVKRVIVKVGTAVVTRADGRLALGRLGALCEQIKELNSRGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL++SSFADLQKPQ ELDGKACA+VGQ+GLMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGVGRQRLRYRRLVNSSFADLQKPQVELDGKACASVGQSGLMALYDALFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QL E V  LL+L+VIPIFNENDAISTR+APY
Sbjct  121  LLVTDNDFRDPDFRMQLCETVKSLLALRVIPIFNENDAISTRKAPY  166



>gb|AHF58596.1| delta 1-pyrroline-5-carboxylate synthetase 2 [Chrysanthemum lavandulifolium]
Length=717

 Score =   297 bits (760),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M ++D TR F+KDVKR+V+KVGTAVVTR DGRLALGR+GALCEQIQ LNSQG+EVILV+S
Sbjct  1    MAAIDPTRGFLKDVKRVVIKVGTAVVTRDDGRLALGRLGALCEQIQVLNSQGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVGAGRQRLRYR+L+HSSFADLQKPQ ELDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGAGRQRLRYRKLVHSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFR P+FR QL E V+ LLS KVIP+FNENDA+STRRAPY
Sbjct  121  LLVTDNDFRSPEFRKQLTETVDSLLSYKVIPVFNENDAVSTRRAPY  166



>gb|AHJ08569.1| P5CS1 [Helianthus tuberosus]
Length=717

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M ++D TR F+KDVKRIV+KVGTAVVTR DGRLALGR+GALCEQIQ LN+QG+EVILV+S
Sbjct  1    MAAIDPTRGFLKDVKRIVIKVGTAVVTREDGRLALGRLGALCEQIQTLNTQGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVGAGRQRLRYR+L+HSSFADLQKPQ ELDGKACAAVGQNGLMALYD+LFS LDVTSAQ
Sbjct  61   GAVGAGRQRLRYRKLVHSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSPLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFR P+FR QL E V+ LLS KVIP+FNENDA+STRRAPY
Sbjct  121  LLVTDNDFRSPEFRKQLTETVDSLLSFKVIPVFNENDAVSTRRAPY  166



>ref|XP_006486420.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Citrus 
sinensis]
Length=717

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            ++DS+RAFVKDVKRIVVKVGTAVVTRSDGRLALGR+GALCEQI+ELNSQGYEVILV+SGA
Sbjct  4    TMDSSRAFVKDVKRIVVKVGTAVVTRSDGRLALGRLGALCEQIKELNSQGYEVILVSSGA  63

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYRRLI+SSFADLQKPQ ELDGKACAAVGQN +MALYD+LFS+LD+TSAQLL
Sbjct  64   VGLGRQRLRYRRLINSSFADLQKPQIELDGKACAAVGQNSIMALYDTLFSELDLTSAQLL  123

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTDNDFRD +FRSQL+E V  LLSL+VIP+FNENDA+STR+APY
Sbjct  124  VTDNDFRDKEFRSQLSETVKSLLSLRVIPVFNENDAVSTRKAPY  167



>gb|KJB74060.1| hypothetical protein B456_011G269700 [Gossypium raimondii]
Length=677

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +2

Query  263  DSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVG  442
            DS+RAFVKDVKRIV+KVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYE+ILV+SGAVG
Sbjct  4    DSSRAFVKDVKRIVIKVGTAVVTRNDGRLALGRLGALCEQIKELNSQGYEIILVSSGAVG  63

Query  443  AGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVT  622
             GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFS+LD++SAQLLVT
Sbjct  64   LGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSELDISSAQLLVT  123

Query  623  DNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            D+DFRD DFR QLNE V  LLSLKVIPIFNENDA+STR+APY
Sbjct  124  DSDFRDRDFRKQLNETVKSLLSLKVIPIFNENDAVSTRKAPY  165



>ref|XP_006435608.1| hypothetical protein CICLE_v10030839mg [Citrus clementina]
 gb|ESR48848.1| hypothetical protein CICLE_v10030839mg [Citrus clementina]
Length=713

 Score =   293 bits (749),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +DS+RAFVKDVKRIVVKVGTAVVTRSDGRLALGR+GALCEQI+ELNSQGYEVILV+SGAV
Sbjct  1    MDSSRAFVKDVKRIVVKVGTAVVTRSDGRLALGRLGALCEQIKELNSQGYEVILVSSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRLI+SSFADLQKPQ ELDGKACAAVGQN +MALYD+LFS+LD+TSAQLLV
Sbjct  61   GLGRQRLRYRRLINSSFADLQKPQIELDGKACAAVGQNSIMALYDTLFSELDLTSAQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDFRD +FRSQL+E V  LLSL+VIP+FNENDA+STR+APY
Sbjct  121  TDNDFRDKEFRSQLSETVKSLLSLRVIPVFNENDAVSTRKAPY  163



>gb|KHG12117.1| Delta-1-pyrroline-5-carboxylate synthase [Gossypium arboreum]
Length=678

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +2

Query  263  DSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVG  442
            DS+RAFVKDVKRIV+KVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYE+ILV+SGAVG
Sbjct  4    DSSRAFVKDVKRIVIKVGTAVVTRNDGRLALGRLGALCEQIKELNSQGYEIILVSSGAVG  63

Query  443  AGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVT  622
             GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFS+LD++SAQLLVT
Sbjct  64   LGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSELDISSAQLLVT  123

Query  623  DNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            D+DFRD DFR QLNE V  LLSLKVIPIFNENDA+STR+APY
Sbjct  124  DSDFRDRDFRKQLNETVKSLLSLKVIPIFNENDAVSTRKAPY  165



>gb|KDO69189.1| hypothetical protein CISIN_1g005131mg [Citrus sinensis]
Length=713

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +DS+RAFVKDVKRIVVKVGTAVVTRSDGRLALGR+GALCEQI+ELNSQGYEVILV+SGAV
Sbjct  1    MDSSRAFVKDVKRIVVKVGTAVVTRSDGRLALGRLGALCEQIKELNSQGYEVILVSSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRLI+SSFADLQKPQ ELDGKACAAVGQN +MALYD+LFS+LD+TSAQLLV
Sbjct  61   GLGRQRLRYRRLINSSFADLQKPQIELDGKACAAVGQNSIMALYDTLFSELDLTSAQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDFRD +FRSQL+E V  LLSL+VIP+FNENDA+STR+APY
Sbjct  121  TDNDFRDKEFRSQLSETVKSLLSLRVIPVFNENDAVSTRKAPY  163



>gb|KJB74059.1| hypothetical protein B456_011G269700 [Gossypium raimondii]
Length=716

 Score =   292 bits (747),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +2

Query  263  DSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVG  442
            DS+RAFVKDVKRIV+KVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYE+ILV+SGAVG
Sbjct  4    DSSRAFVKDVKRIVIKVGTAVVTRNDGRLALGRLGALCEQIKELNSQGYEIILVSSGAVG  63

Query  443  AGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVT  622
             GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFS+LD++SAQLLVT
Sbjct  64   LGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSELDISSAQLLVT  123

Query  623  DNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            D+DFRD DFR QLNE V  LLSLKVIPIFNENDA+STR+APY
Sbjct  124  DSDFRDRDFRKQLNETVKSLLSLKVIPIFNENDAVSTRKAPY  165



>gb|ACI62865.1| delta 1-pyrroline-5-carboxylate synthetase [Gossypium arboreum]
Length=716

 Score =   292 bits (747),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +2

Query  263  DSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVG  442
            DS+RAFVKDVKRIV+KVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYE+ILV+SGAVG
Sbjct  4    DSSRAFVKDVKRIVIKVGTAVVTRNDGRLALGRLGALCEQIKELNSQGYEIILVSSGAVG  63

Query  443  AGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVT  622
             GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFS+LD++SAQLLVT
Sbjct  64   LGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSELDISSAQLLVT  123

Query  623  DNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            D+DFRD DFR QLNE V  LLSLKVIPIFNENDA+STR+APY
Sbjct  124  DSDFRDRDFRKQLNETVKSLLSLKVIPIFNENDAVSTRKAPY  165



>ref|XP_007009200.1| Pyrroline-5-carboxylate synthetase isoform 2 [Theobroma cacao]
 gb|EOY18010.1| Pyrroline-5-carboxylate synthetase isoform 2 [Theobroma cacao]
Length=561

 Score =   288 bits (736),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +R FVKDVKR+V+KVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYEVILV+S
Sbjct  1    MGDMDPSRGFVKDVKRLVIKVGTAVVTRTDGRLALGRLGALCEQIKELNSQGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFS+LDV+SAQ
Sbjct  61   GAVGLGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSELDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL+E V  LLSL+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDGDFRKQLSETVKSLLSLRVIPIFNENDAVSTRKAPY  166



>gb|EYU35248.1| hypothetical protein MIMGU_mgv1a002086mg [Erythranthe guttata]
Length=717

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTR F++DVKR+++KVGTAVV+R DGRLALGR+GALCEQI ELN  GYEV+LVTS
Sbjct  1    MEAEDSTREFMRDVKRVIIKVGTAVVSRDDGRLALGRLGALCEQIHELNDMGYEVVLVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ+ELDGKACAAVGQNGLMALYD+LFSQLD TSAQ
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQQELDGKACAAVGQNGLMALYDTLFSQLDTTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV+DNDFRDP FR QLNE V  LLSLKV+PIFNENDA+STR+APY
Sbjct  121  LLVSDNDFRDPAFRKQLNENVESLLSLKVVPIFNENDAVSTRKAPY  166



>gb|ABZ79407.2| pyrroline-5-carboxylate synthetase [Gossypium arboreum]
Length=801

 Score =   291 bits (745),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +2

Query  263  DSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVG  442
            DS+RAFVKDVKRIV+KVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYE+ILV+SGAVG
Sbjct  89   DSSRAFVKDVKRIVIKVGTAVVTRNDGRLALGRLGALCEQIKELNSQGYEIILVSSGAVG  148

Query  443  AGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVT  622
             GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFS+LD++SAQLLVT
Sbjct  149  LGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSELDISSAQLLVT  208

Query  623  DNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            D+DFRD DFR QLNE V  LLSLKVIPIFNENDA+STR+APY
Sbjct  209  DSDFRDRDFRKQLNETVKSLLSLKVIPIFNENDAVSTRKAPY  250


 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  254  DSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSG  433
            ++++S R F+++VKR+ VKVGTAVVTR+DGRLA+GR+GALCEQ++ELNSQGYE++LVTSG
Sbjct  9    NAMESERTFMRNVKRVFVKVGTAVVTRADGRLAVGRLGALCEQLKELNSQGYEIVLVTSG  68

Query  434  AVGAGRQRLRYRRLIHSSFAD  496
            AVG GRQRLRYRRL++S   D
Sbjct  69   AVGLGRQRLRYRRLVNSMAED  89



>gb|ABG74923.1| pyrroline-5-carboxylate synthetase [Aegiceras corniculatum]
Length=717

 Score =   289 bits (740),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD VDSTRAFVK VK IVVKVGTAVVTRSDGRLALGR+GALCEQI+EL + G+EVILV S
Sbjct  1    MDRVDSTRAFVKGVKLIVVKVGTAVVTRSDGRLALGRLGALCEQIKELITLGHEVILVAS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAV  GRQRLRYRRLI+SSFADLQKPQ ELDGKACAAVGQNGLMALYD+LFSQLDVTS+Q
Sbjct  61   GAVSVGRQRLRYRRLINSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDP+FR QL+  V  LLSLKVIPIFNENDA+STRRAPY
Sbjct  121  LLVTDNDFRDPEFRKQLSGTVKTLLSLKVIPIFNENDAVSTRRAPY  166



>ref|XP_011624153.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Amborella 
trichopoda]
Length=716

 Score =   289 bits (740),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            S D +RAF+KDVKR+++KVGTAVVTRSDGRLALGR+GALCEQ++ELNSQG EVILVTSGA
Sbjct  2    SKDPSRAFLKDVKRVIIKVGTAVVTRSDGRLALGRVGALCEQVKELNSQGLEVILVTSGA  61

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQNGLMALYD LFSQLDVTS+QLL
Sbjct  62   VGVGRQRLRYRRLVNSSFADLQKPQLELDGKACAAVGQNGLMALYDVLFSQLDVTSSQLL  121

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTDNDF+D DFR QL E VN LL+L+V+P+FNENDA+STRRAPY
Sbjct  122  VTDNDFKDSDFRMQLTETVNSLLNLRVVPVFNENDAVSTRRAPY  165



>gb|AGE00987.1| delta-1-pyrroline-5-carboxylate synthetase [Morus alba]
Length=497

 Score =   283 bits (725),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF+KDVKR+++KVGTAVVTR+DGRLALGR+GALCEQI+ELNS GYEVILVTS
Sbjct  1    MSDMDRSRAFLKDVKRLIIKVGTAVVTRNDGRLALGRLGALCEQIKELNSLGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ E+DGKACAAVGQN LMALYD+LF QLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVEIDGKACAAVGQNSLMALYDTLFIQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD +FR QL+E V  LLSLKV+PI NENDA+STR+APY
Sbjct  121  LLVTDNDFRDKEFRKQLSETVTSLLSLKVVPILNENDAVSTRKAPY  166



>ref|XP_010658318.1| PREDICTED: pyrroline-5-carboxylate synthetase isoform X1 [Vitis 
vinifera]
 emb|CBI31612.3| unnamed protein product [Vitis vinifera]
Length=719

 Score =   289 bits (740),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD++D TRAFVKDVKR+V+K GTAVVTRSDGRLALGR+GALCEQI+ELNSQGY+VI+VTS
Sbjct  3    MDAMDPTRAFVKDVKRLVIKFGTAVVTRSDGRLALGRLGALCEQIKELNSQGYQVIVVTS  62

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDVTSAQ
Sbjct  63   GAVGLGRQRLRYRSLLNSSFADLQKPQAELDGKACAAVGQNNLMALYDTLFSQLDVTSAQ  122

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD  FR+QL + V+ LL+L+VIPIFNENDA+STR+APY
Sbjct  123  LLVTDNDFRDEAFRNQLTQTVDSLLALRVIPIFNENDAVSTRKAPY  168



>ref|XP_007009202.1| Pyrroline-5-carboxylate synthetase isoform 4 [Theobroma cacao]
 gb|EOY18012.1| Pyrroline-5-carboxylate synthetase isoform 4 [Theobroma cacao]
Length=671

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +R FVKDVKR+V+KVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYEVILV+S
Sbjct  1    MGDMDPSRGFVKDVKRLVIKVGTAVVTRTDGRLALGRLGALCEQIKELNSQGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFS+LDV+SAQ
Sbjct  61   GAVGLGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSELDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL+E V  LLSL+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDGDFRKQLSETVKSLLSLRVIPIFNENDAVSTRKAPY  166



>ref|XP_008441400.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Cucumis 
melo]
Length=717

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS+D +RAF++DVKR+V+KVGTAVVTRSDGRLALGR+GALCEQI+ELNSQ YEVILV+S
Sbjct  1    MDSMDRSRAFLRDVKRLVIKVGTAVVTRSDGRLALGRLGALCEQIKELNSQEYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ +LDGKACAAVGQN LMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGIGRQRLRYRKLVNSSFADLQKPQVDLDGKACAAVGQNSLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL++ V  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRRQLSDTVKSLLALKVIPIFNENDAVSTRKAPY  166



>gb|KCW65598.1| hypothetical protein EUGRSUZ_G02990 [Eucalyptus grandis]
Length=460

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            S+DSTRAF+ DVKR+V+KVGTAVVTRSDGRLALGR+GALCEQI+ELN QG+EVILVTSGA
Sbjct  19   SMDSTRAFIGDVKRLVIKVGTAVVTRSDGRLALGRLGALCEQIKELNLQGFEVILVTSGA  78

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTSAQLL
Sbjct  79   VGLGRQRLRYRKLVNSSFADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSAQLL  138

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTD+DF+  +FR QL+E V  LLSL V+PIFNENDA+STR+APY
Sbjct  139  VTDHDFKSIEFRKQLSETVQSLLSLTVVPIFNENDAVSTRKAPY  182



>gb|ADK37758.1| delta 1-pyrroline-5-carboxylate synthetase [Jatropha curcas]
 gb|ADK47028.1| delta 1-pyrroline-5-carboxylate synthetase [Jatropha curcas]
Length=715

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +2

Query  254  DSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSG  433
            D VD +RAFVKDVKRIV+KVGTAVVTRSDGRLALGR+GALCEQI+ELN+QGY++I+V+SG
Sbjct  3    DGVDRSRAFVKDVKRIVMKVGTAVVTRSDGRLALGRLGALCEQIKELNTQGYDIIVVSSG  62

Query  434  AVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQL  613
            AVG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDVTSAQL
Sbjct  63   AVGIGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSQLDVTSAQL  122

Query  614  LVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LVTD+DFRD DFR QLN+ V  L++L+V+PIFNENDA+STR+APY
Sbjct  123  LVTDSDFRDKDFRKQLNDTVESLINLRVVPIFNENDAVSTRKAPY  167



>ref|XP_009351358.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Pyrus 
x bretschneideri]
Length=717

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ VD +RAFVKDVKR+V+KVGTAVVTR+DGR+ALGR+GALCEQ++ELNSQGYE+ILV+S
Sbjct  1    MEEVDRSRAFVKDVKRLVIKVGTAVVTRNDGRIALGRLGALCEQLKELNSQGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDV+SAQ
Sbjct  61   GAVGLGRQRLRYRKLVNSSFADLQKPQVELDGKACAAVGQNCLMALYDTLFSQLDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL+E +  LLSLKVIPIFNENDA+STRRAPY
Sbjct  121  LLVTDSDFRDRDFRKQLSETMKSLLSLKVIPIFNENDAVSTRRAPY  166



>ref|XP_008233492.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Prunus mume]
Length=717

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD VD +RAF+KDVKRIV+KVGTAVVTR+DGR+ALGR+GALCEQ++ELNSQGYEVILV+S
Sbjct  1    MDEVDRSRAFLKDVKRIVLKVGTAVVTRNDGRIALGRLGALCEQLKELNSQGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDV+SAQ
Sbjct  61   GAVGLGRQRLRYRKLVNSSFADLQKPQVELDGKACAAVGQNCLMALYDTLFSQLDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL++ V  LLSLKVIPIFNENDA+STRRAPY
Sbjct  121  LLVTDSDFRDRDFRKQLSDTVKSLLSLKVIPIFNENDAVSTRRAPY  166



>ref|XP_007009203.1| Pyrroline-5-carboxylate synthetase isoform 5 [Theobroma cacao]
 gb|EOY18013.1| Pyrroline-5-carboxylate synthetase isoform 5 [Theobroma cacao]
Length=687

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +R FVKDVKR+V+KVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYEVILV+S
Sbjct  1    MGDMDPSRGFVKDVKRLVIKVGTAVVTRTDGRLALGRLGALCEQIKELNSQGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFS+LDV+SAQ
Sbjct  61   GAVGLGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSELDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL+E V  LLSL+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDGDFRKQLSETVKSLLSLRVIPIFNENDAVSTRKAPY  166



>ref|XP_012088529.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Jatropha 
curcas]
 gb|KDP44879.1| hypothetical protein JCGZ_01379 [Jatropha curcas]
Length=731

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +2

Query  254  DSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSG  433
            D VD +RAFVKDVKRIV+KVGTAVVTRSDGRLALGR+GALCEQI+ELN+QGY++I+V+SG
Sbjct  3    DGVDRSRAFVKDVKRIVMKVGTAVVTRSDGRLALGRLGALCEQIKELNTQGYDIIVVSSG  62

Query  434  AVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQL  613
            AVG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDVTSAQL
Sbjct  63   AVGIGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSQLDVTSAQL  122

Query  614  LVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LVTD+DFRD DFR QLN+ V  L++L+V+PIFNENDA+STR+APY
Sbjct  123  LVTDSDFRDKDFRKQLNDTVESLINLRVVPIFNENDAVSTRKAPY  167



>ref|XP_007009199.1| Pyrroline-5-carboxylate synthetase isoform 1 [Theobroma cacao]
 gb|EOY18009.1| Pyrroline-5-carboxylate synthetase isoform 1 [Theobroma cacao]
Length=717

 Score =   288 bits (736),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +R FVKDVKR+V+KVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYEVILV+S
Sbjct  1    MGDMDPSRGFVKDVKRLVIKVGTAVVTRTDGRLALGRLGALCEQIKELNSQGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFS+LDV+SAQ
Sbjct  61   GAVGLGRQRLRYRRLVNSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSELDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL+E V  LLSL+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDGDFRKQLSETVKSLLSLRVIPIFNENDAVSTRKAPY  166



>ref|XP_009343959.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Pyrus 
x bretschneideri]
 gb|AHJ60269.1| delta-1-pyrroline-5-carboxylate synthase 1 [Pyrus betulifolia]
 gb|AHJ60271.1| delta-1-pyrroline-5-carboxylate synthase 1 [Pyrus betulifolia]
Length=717

 Score =   286 bits (733),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ VDS+R F+KDVKR+V+KVGTAVVTR+DGR+ALGR+GALCEQ++ELNSQGYE+ILV+S
Sbjct  1    MEEVDSSRGFLKDVKRLVLKVGTAVVTRNDGRIALGRLGALCEQLKELNSQGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDV+SAQ
Sbjct  61   GAVGLGRQRLRYRKLVNSSFADLQKPQVELDGKACAAVGQNCLMALYDTLFSQLDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL E +  LLSLKV+PIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDRDFRKQLGETMKSLLSLKVVPIFNENDAVSTRKAPY  166



>ref|XP_004138450.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Cucumis 
sativus]
 gb|KGN45747.1| hypothetical protein Csa_6G008780 [Cucumis sativus]
Length=717

 Score =   286 bits (733),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS+D +R F++DVKR+V+KVGTAVVTRSDGRLALGR+GALCEQI+ELNSQ YEVILV+S
Sbjct  1    MDSMDRSRTFLRDVKRLVIKVGTAVVTRSDGRLALGRLGALCEQIKELNSQEYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ +LDGKACAAVGQN LMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGIGRQRLRYRKLVNSSFADLQKPQVDLDGKACAAVGQNSLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL++ V  LL+LKV+PIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRRQLSDTVKSLLTLKVVPIFNENDAVSTRKAPY  166



>ref|XP_008372068.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Malus 
domestica]
Length=717

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ VD +RAF+KDVKR+V+KVGTAVVTR+DGR+ALGR+GALCEQ++ELNSQGYE+ILV+S
Sbjct  1    MEEVDHSRAFLKDVKRLVIKVGTAVVTRNDGRIALGRLGALCEQLKELNSQGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDV+SAQ
Sbjct  61   GAVGLGRQRLRYRKLVNSSFADLQKPQVELDGKACAAVGQNCLMALYDTLFSQLDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL E +  LLSLKVIPIFNENDA+STRRAPY
Sbjct  121  LLVTDSDFRDRDFRRQLGETMKSLLSLKVIPIFNENDAVSTRRAPY  166



>gb|AGW51410.1| pyrroline-5-carboxylate synthetase [Salicornia bigelovii]
Length=716

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D++R FVKDVKR++VKVGTAVVTRSDGR+ALGR+GALCEQ++ELN+ GYEVILVTSGAV
Sbjct  1    MDASRVFVKDVKRVIVKVGTAVVTRSDGRMALGRLGALCEQLKELNNDGYEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
             AGRQRLR+RRL++SSFADLQKPQ ELDGKACAAVGQNGLMALYD+LF QLD+TSAQLLV
Sbjct  61   SAGRQRLRFRRLVNSSFADLQKPQVELDGKACAAVGQNGLMALYDALFGQLDLTSAQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDFRDP+FRSQL E V++LL LKV+P+ NENDA+STR+APY
Sbjct  121  TDNDFRDPNFRSQLTETVDRLLDLKVVPVLNENDAVSTRKAPY  163



>gb|AFV15798.1| gamma-glutamyl phosphate reductase [Carica papaya]
Length=717

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD +D +RAFVKDVKR+V+KVGTAVVTR+DGRLALGR+G LCEQI+ELNSQGYEVILV+S
Sbjct  1    MDGLDRSRAFVKDVKRLVIKVGTAVVTRNDGRLALGRLGGLCEQIKELNSQGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ +LDGKACA VGQN LMALYD++FSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLVNSSFADLQKPQIDLDGKACAGVGQNCLMALYDTMFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL+E V  LL+L+VIPIFNENDA+STRRAPY
Sbjct  121  LLVTDSDFRDKDFRKQLDETVGSLLALRVIPIFNENDAVSTRRAPY  166



>ref|XP_007220615.1| hypothetical protein PRUPE_ppa002098mg [Prunus persica]
 gb|EMJ21814.1| hypothetical protein PRUPE_ppa002098mg [Prunus persica]
Length=717

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD VD +RAF+KDVKRIV+KVGTAVVTR+DGR+ALGR+GALCEQ++ELNS GYEVILV+S
Sbjct  1    MDEVDRSRAFLKDVKRIVLKVGTAVVTRNDGRIALGRLGALCEQLKELNSLGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDV+SAQ
Sbjct  61   GAVGLGRQRLRYRKLVNSSFADLQKPQVELDGKACAAVGQNCLMALYDTLFSQLDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL++ V  LLSLKVIPIFNENDA+STRRAPY
Sbjct  121  LLVTDSDFRDRDFRKQLSDTVKSLLSLKVIPIFNENDAVSTRRAPY  166



>gb|AGC51785.1| delta1-pyrroline-5-carboxylate synthase [Manihot esculenta]
Length=739

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            VD +R F KDVKR+V+KVGTAVVTRSDGRLALG++GALCEQI+ELNS+GYEVILV+SGAV
Sbjct  5    VDRSRPFFKDVKRLVIKVGTAVVTRSDGRLALGKLGALCEQIKELNSEGYEVILVSSGAV  64

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYR+L++SSFADLQKPQ E+DGKACAAVGQN LMALYD+LFSQLDVTSAQLLV
Sbjct  65   GIGRQRLRYRKLVNSSFADLQKPQNEIDGKACAAVGQNSLMALYDTLFSQLDVTSAQLLV  124

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDFRD +FR QLN+ V  LL+L+VIPIFNENDA+STRRAPY
Sbjct  125  TDNDFRDKEFRKQLNDTVKSLLALRVIPIFNENDAVSTRRAPY  167



>gb|KCW65597.1| hypothetical protein EUGRSUZ_G02990 [Eucalyptus grandis]
Length=572

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            S+DSTRAF+ DVKR+V+KVGTAVVTRSDGRLALGR+GALCEQI+ELN QG+EVILVTSGA
Sbjct  19   SMDSTRAFIGDVKRLVIKVGTAVVTRSDGRLALGRLGALCEQIKELNLQGFEVILVTSGA  78

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTSAQLL
Sbjct  79   VGLGRQRLRYRKLVNSSFADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSAQLL  138

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTD+DF+  +FR QL+E V  LLSL V+PIFNENDA+STR+APY
Sbjct  139  VTDHDFKSIEFRKQLSETVQSLLSLTVVPIFNENDAVSTRKAPY  182



>ref|XP_004307578.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Fragaria 
vesca subsp. vesca]
Length=717

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  VDS+R F++DVKRIV+KVGTAVVTR DGR+ALGR+GALCEQ++ELN+QGYEVILV+S
Sbjct  1    MGDVDSSRGFLRDVKRIVLKVGTAVVTRKDGRIALGRLGALCEQLKELNTQGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDV+SAQ
Sbjct  61   GAVGLGRQRLKYRKLINSSFADLQKPQVELDGKACAAVGQNCLMALYDTLFSQLDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL++ V  LLSLKVIPIFNENDA+STRRAPY
Sbjct  121  LLVTDSDFRDRDFRKQLSDTVKSLLSLKVIPIFNENDAVSTRRAPY  166



>ref|NP_001268134.1| pyrroline-5-carboxylate synthetase [Vitis vinifera]
 emb|CAB40834.1| pyrroline-5-carboxylate synthetase [Vitis vinifera]
Length=762

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD++D TRAFVKDVKR+V+K GTAVVTRSDGRLALGR+GALCEQI+ELNSQGY+VI+VTS
Sbjct  3    MDAMDPTRAFVKDVKRLVIKFGTAVVTRSDGRLALGRLGALCEQIKELNSQGYQVIVVTS  62

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDVTSAQ
Sbjct  63   GAVGLGRQRLRYRSLLNSSFADLQKPQAELDGKACAAVGQNNLMALYDTLFSQLDVTSAQ  122

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD  FR+QL + V+ LL+L+VIPIFNENDA  TR+APY
Sbjct  123  LLVTDNDFRDEAFRNQLTQTVDSLLALRVIPIFNENDAEVTRKAPY  168



>gb|KCW65596.1| hypothetical protein EUGRSUZ_G02990 [Eucalyptus grandis]
Length=610

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            S+DSTRAF+ DVKR+V+KVGTAVVTRSDGRLALGR+GALCEQI+ELN QG+EVILVTSGA
Sbjct  19   SMDSTRAFIGDVKRLVIKVGTAVVTRSDGRLALGRLGALCEQIKELNLQGFEVILVTSGA  78

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTSAQLL
Sbjct  79   VGLGRQRLRYRKLVNSSFADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSAQLL  138

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTD+DF+  +FR QL+E V  LLSL V+PIFNENDA+STR+APY
Sbjct  139  VTDHDFKSIEFRKQLSETVQSLLSLTVVPIFNENDAVSTRKAPY  182



>ref|XP_010691515.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=716

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D++R FVKDVKR++VKVGTAVVTRSDGR+ALGR+G+LCEQ++ELN  GYEVILVTSGAV
Sbjct  1    MDTSRVFVKDVKRVIVKVGTAVVTRSDGRMALGRLGSLCEQLKELNLDGYEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
             AGRQRLR+R+L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLD+TSAQLLV
Sbjct  61   SAGRQRLRFRKLVNSSFADLQKPQAELDGKACAAVGQNSLMALYDTLFSQLDLTSAQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDFRDP+FRSQ+ E VNQLL  KV+P+ NENDA+STRRAPY
Sbjct  121  TDNDFRDPNFRSQITETVNQLLDSKVVPVLNENDAVSTRRAPY  163



>gb|ACF19677.1| pyrroline-5-carboxylate synthetase [Euonymus japonicus]
Length=714

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +RAFVK+VKRI++KVGTAVVTRSDGRLALGR+G+LCEQ++ELNSQGYEVI+VTSGAV
Sbjct  1    MDPSRAFVKNVKRIIIKVGTAVVTRSDGRLALGRLGSLCEQVKELNSQGYEVIVVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRLI+SS ADLQKPQ +LDGKACAAVGQN LMALYD+LFSQLD+TSAQLLV
Sbjct  61   GLGRQRLRYRRLINSSLADLQKPQVDLDGKACAAVGQNSLMALYDTLFSQLDITSAQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DFRD DFR QL+E V  LLSLKVIPI NENDAISTR+APY
Sbjct  121  TDSDFRDKDFRKQLDETVISLLSLKVIPILNENDAISTRKAPY  163



>ref|NP_001238153.1| delta-pyrroline-5-carboxylate synthetase [Glycine max]
 gb|AAR86688.1| delta-pyrroline-5-carboxylate synthetase [Glycine max]
Length=715

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D  R F+KDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELNS GYE+ILV+S
Sbjct  1    MENTDPCRHFLKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNSLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVELDGKACAAVGQNSLMALYDVLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E +  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRMQLSETMKSLLALKVIPIFNENDAVSTRKAPY  166



>emb|CAX46385.1| hypothetical protein [Glycine max]
Length=715

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D  R F+KDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELNS GYE+ILV+S
Sbjct  1    MENTDPCRHFLKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNSLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVELDGKACAAVGQNSLMALYDVLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E +  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRMQLSETMKSLLALKVIPIFNENDAVSTRKAPY  166



>ref|XP_004503180.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Cicer 
arietinum]
Length=715

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D +R FVKDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+EL++ GYE+ILV+S
Sbjct  1    MENADPSRDFVKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELSTLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LIHSSFADLQKPQ ELDGKACAAVGQ+ LMA YD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLIHSSFADLQKPQVELDGKACAAVGQSSLMATYDDLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E V  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRKQLSETVKSLLALKVIPIFNENDAVSTRKAPY  166



>ref|XP_007163470.1| hypothetical protein PHAVU_001G236900g [Phaseolus vulgaris]
 gb|ESW35464.1| hypothetical protein PHAVU_001G236900g [Phaseolus vulgaris]
Length=715

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D  R F+KDVKRIV+KVGTAVVTR DGR+A+G++GALCEQI+ELNS GYE+ILV+S
Sbjct  1    MENADPNRHFLKDVKRIVIKVGTAVVTRQDGRVAVGKLGALCEQIKELNSLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVELDGKACAAVGQSSLMALYDALFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E V  LL LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRKQLSETVKSLLGLKVIPIFNENDAVSTRKAPY  166



>gb|KHN07602.1| Delta-1-pyrroline-5-carboxylate synthase [Glycine soja]
Length=718

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D  R F+KDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELNS GYE+ILV+S
Sbjct  1    MENTDPCRHFLKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNSLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVELDGKACAAVGQNSLMALYDVLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E +  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRMQLSETMKSLLALKVIPIFNENDAVSTRKAPY  166



>gb|AEV46825.1| delta-1-pyrroline-5-carboxylate synthetase [Boehmeria nivea]
Length=717

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D +RAFVKDVKR++VKVGTAVVTR+DGRLALGR+GALCEQI+ELNSQGYEVILVTS
Sbjct  1    MSDTDRSRAFVKDVKRLIVKVGTAVVTRADGRLALGRLGALCEQIKELNSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQ+PQ ++DGKACAAVGQN LMALYD+LF QL+VTSAQ
Sbjct  61   GAVGLGRQRLRYRKLVNSSFADLQEPQVDIDGKACAAVGQNSLMALYDTLFIQLNVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QLN+ V  L++LKVIPI NENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRKQLNDTVQSLVALKVIPILNENDAVSTRKAPY  166



>ref|XP_010108393.1| Delta-1-pyrroline-5-carboxylate synthase [Morus notabilis]
 gb|EXC19384.1| Delta-1-pyrroline-5-carboxylate synthase [Morus notabilis]
Length=738

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF+KDVKR+++KVGTAVVTR+DGRLALGR+GALCEQI+ELNS GYEVILVTS
Sbjct  1    MSDMDRSRAFLKDVKRLIIKVGTAVVTRNDGRLALGRLGALCEQIKELNSLGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ E+DGKACAAVGQN LMALYD+LF QLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVEIDGKACAAVGQNSLMALYDTLFIQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD +FR QL+E V  LLSLKV+PI NENDA+STR+APY
Sbjct  121  LLVTDNDFRDKEFRKQLSETVTSLLSLKVVPILNENDAVSTRKAPY  166



>gb|ABY89287.1| pyrroline-5-carboxylate synthetase [Phaseolus vulgaris]
Length=715

 Score =   282 bits (721),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D  R F+KDVKRIV+KVGTAVVTR DGR+A+G++GALCEQI+ELNS GYE+ILV+S
Sbjct  1    MENTDPCRHFLKDVKRIVIKVGTAVVTRQDGRVAVGKLGALCEQIKELNSLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVELDGKACAAVGQSSLMALYDALFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E V  LL LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRKQLSETVKSLLGLKVIPIFNENDAVSTRKAPY  166



>gb|AEO51062.1| pyrroline-5-carboxylate synthetase [Malus hupehensis]
Length=717

 Score =   281 bits (719),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ VD +RAF+KDVKR+V+KVGTAVV R+DG++ALG++GALCEQ++ELNSQGYE+ILV+S
Sbjct  1    MEEVDHSRAFLKDVKRLVIKVGTAVVARNDGKIALGKLGALCEQLKELNSQGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLDV+SAQ
Sbjct  61   GAVGLGRQRLKYRKLVNSSFADLQKPQVELDGKACAAVGQNCLMALYDTLFSQLDVSSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL+E +  LLSLKVIPIFNENDA+STRRAPY
Sbjct  121  LLVTDSDFRDRDFRRQLSETMKSLLSLKVIPIFNENDAVSTRRAPY  166



>ref|XP_011076783.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Sesamum 
indicum]
Length=717

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++VDSTR FV+DVKR+V+KVGTAVVTR+DGRLALGR+G+LCEQI ELN QGYEVILVTS
Sbjct  1    MEAVDSTRVFVRDVKRVVIKVGTAVVTRADGRLALGRLGSLCEQIHELNVQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQNGLMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGVGRQRLRYRRLLNSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRDPDFR QLNE V  LLSLKV+PIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDPDFRRQLNETVKSLLSLKVVPIFNENDAVSTRKAPY  166



>emb|CBH32076.1| hypothetical protein [Glycine max]
Length=715

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D  R F++DVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELNS GYE+ILV+S
Sbjct  1    MENTDPCRHFLEDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNSLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVELDGKACAAVGQNSLMALYDVLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E +  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRMQLSETMKSLLALKVIPIFNENDAVSTRKAPY  166



>ref|XP_002524230.1| delta 1-pyrroline-5-carboxylate synthetase, putative [Ricinus 
communis]
 gb|EEF38154.1| delta 1-pyrroline-5-carboxylate synthetase, putative [Ricinus 
communis]
Length=732

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +RAFVKDVKR+V+KVGTAVVTR DGRLALGR+GA CEQ++ELNSQGYEVI+V+SGAV
Sbjct  5    MDRSRAFVKDVKRLVIKVGTAVVTRGDGRLALGRLGAFCEQVKELNSQGYEVIVVSSGAV  64

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYR+L++SSFADLQKPQ E+DGKA AAVGQ+ LMALYD++FSQLDVTSAQLLV
Sbjct  65   GLGRQRLRYRKLVNSSFADLQKPQVEIDGKASAAVGQSSLMALYDTMFSQLDVTSAQLLV  124

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDFRD DFR QLNE V  LLSL+VIPIFNENDA+STR+APY
Sbjct  125  TDNDFRDKDFRKQLNETVESLLSLRVIPIFNENDAVSTRKAPY  167



>ref|XP_003519362.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Glycine 
max]
Length=713

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +2

Query  263  DSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVG  442
            D +R+F+KDVKR+++KVGTAVVTR +GRLA+GR+GALCEQI++LNS GY++ILV+SGAVG
Sbjct  3    DPSRSFMKDVKRVIIKVGTAVVTREEGRLAVGRLGALCEQIKQLNSLGYDIILVSSGAVG  62

Query  443  AGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVT  622
             GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD+LF+QLDVTSAQLLVT
Sbjct  63   IGRQRLRYRKLINSSFADLQKPQHELDGKACAAVGQNSLMALYDTLFTQLDVTSAQLLVT  122

Query  623  DNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            DNDFRD DFR QL E V  LLSLKVIP+FNENDA+STR+APY
Sbjct  123  DNDFRDKDFRKQLTETVKSLLSLKVIPVFNENDAVSTRKAPY  164



>gb|AFW04294.1| delta-pyrroline-5-carboxylate synthetase [Lespedeza potaninii]
Length=715

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D  R F+KDVKRI++KVGTAVVTR DGRLA+G++GA+CEQI+EL+S GYE+ILV+S
Sbjct  1    MENADPYRHFIKDVKRIIIKVGTAVVTRRDGRLAVGKLGAVCEQIKELSSLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLD+TSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVELDGKACAAVGQNSLMALYDTLFSQLDMTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL E +  LLSLKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRKQLTETMKSLLSLKVIPIFNENDAVSTRKAPY  166



>emb|CDP06570.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TR FVK VKR+V KVGTAVVTR DGRLA+GR+GA+ EQ++ELNSQGYE+ILVTSGAV
Sbjct  1    MDPTRKFVKHVKRVVFKVGTAVVTRDDGRLAVGRVGAIFEQLEELNSQGYEIILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            GAGRQRL+YRRL++SSFADLQKPQ E+DGKACAAVGQNGLMALYD+LFSQLDVTS+QLLV
Sbjct  61   GAGRQRLKYRRLVNSSFADLQKPQVEIDGKACAAVGQNGLMALYDNLFSQLDVTSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDF+ PDFR QL+E V+ LLSL+ IPIFNENDAISTRRAPY
Sbjct  121  TDNDFKSPDFRMQLSETVDTLLSLRSIPIFNENDAISTRRAPY  163



>gb|KCW65595.1| hypothetical protein EUGRSUZ_G02990 [Eucalyptus grandis]
Length=711

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            S+DSTRAF+ DVKR+V+KVGTAVVTRSDGRLALGR+GALCEQI+ELN QG+EVILVTSGA
Sbjct  19   SMDSTRAFIGDVKRLVIKVGTAVVTRSDGRLALGRLGALCEQIKELNLQGFEVILVTSGA  78

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTSAQLL
Sbjct  79   VGLGRQRLRYRKLVNSSFADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSAQLL  138

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTD+DF+  +FR QL+E V  LLSL V+PIFNENDA+STR+APY
Sbjct  139  VTDHDFKSIEFRKQLSETVQSLLSLTVVPIFNENDAVSTRKAPY  182



>ref|XP_009412561.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412562.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=712

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TR F+K VKR+V+KVGTAVVTR++GRLALGR+GALCEQI+ELNS G+EVI+VTSGAV
Sbjct  1    MDPTRDFIKGVKRLVIKVGTAVVTRTEGRLALGRLGALCEQIKELNSSGFEVIMVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYR+L++SSFADLQKPQ ELDGKACA+VGQ+GLMALYD+LFSQLDVTS+QLLV
Sbjct  61   GVGRQRLRYRKLVNSSFADLQKPQVELDGKACASVGQSGLMALYDTLFSQLDVTSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DF+DPDFR QL++ VN LL+L+VIP+FNENDAISTR+APY
Sbjct  121  TDSDFKDPDFRMQLSQTVNTLLALRVIPVFNENDAISTRKAPY  163



>gb|AAS89034.1| delta-1-pyrroline-5-carboxylate synthetase [Oryza sativa Japonica 
Group]
Length=716

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M SVD +R+FV+DVKR+++KVGTAVV+R DGRLALGR+GALCEQ++ELNS GYEVILVTS
Sbjct  1    MASVDPSRSFVRDVKRVIIKVGTAVVSRQDGRLALGRVGALCEQVKELNSLGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFNQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF +P FR QL E V  LL LKVIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENPKFREQLTETVESLLDLKVIPIFNENDAISTRKAPY  166



>ref|NP_001055723.1| Os05g0455500 [Oryza sativa Japonica Group]
 sp|O04226.2|P5CS_ORYSJ RecName: Full=Delta-1-pyrroline-5-carboxylate synthase; Short=P5CS; 
Includes: RecName: Full=Glutamate 5-kinase; Short=GK; 
AltName: Full=Gamma-glutamyl kinase; Includes: RecName: Full=Gamma-glutamyl 
phosphate reductase; Short=GPR; AltName: Full=Glutamate-5-semialdehyde 
dehydrogenase; AltName: Full=Glutamyl-gamma-semialdehyde 
dehydrogenase [Oryza sativa Japonica 
Group]
 gb|AAU90213.1| putative delta 1-pyrroline-5-carboxylate synthetase [Oryza sativa 
Japonica Group]
 dbj|BAF17637.1| Os05g0455500 [Oryza sativa Japonica Group]
 dbj|BAG95649.1| unnamed protein product [Oryza sativa Japonica Group]
Length=716

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M SVD +R+FV+DVKR+++KVGTAVV+R DGRLALGR+GALCEQ++ELNS GYEVILVTS
Sbjct  1    MASVDPSRSFVRDVKRVIIKVGTAVVSRQDGRLALGRVGALCEQVKELNSLGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFNQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF +P FR QL E V  LL LKVIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENPKFREQLTETVESLLDLKVIPIFNENDAISTRKAPY  166



>dbj|BAA19916.1| deltal-pyrroline-5-carboxylate synthetase [Oryza sativa (japonica 
cultivar-group)]
Length=716

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M SVD +R+FV+DVKR+++KVGTAVV+R DGRLALGR+GALCEQ++ELNS GYEVILVTS
Sbjct  1    MASVDPSRSFVRDVKRVIIKVGTAVVSRQDGRLALGRVGALCEQVKELNSLGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFNQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF +P FR QL E V  LL LKVIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENPKFREQLTETVESLLDLKVIPIFNENDAISTRKAPY  166



>ref|XP_010067456.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X1 
[Eucalyptus grandis]
Length=732

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            S+DSTRAF+ DVKR+V+KVGTAVVTRSDGRLALGR+GALCEQI+ELN QG+EVILVTSGA
Sbjct  19   SMDSTRAFIGDVKRLVIKVGTAVVTRSDGRLALGRLGALCEQIKELNLQGFEVILVTSGA  78

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTSAQLL
Sbjct  79   VGLGRQRLRYRKLVNSSFADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSAQLL  138

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTD+DF+  +FR QL+E V  LLSL V+PIFNENDA+STR+APY
Sbjct  139  VTDHDFKSIEFRKQLSETVQSLLSLTVVPIFNENDAVSTRKAPY  182



>emb|CAX46386.1| hypothetical protein [Glycine max]
Length=715

 Score =   279 bits (714),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D  R  +KDVKRI++KVGTAVVTR DGRLA+G +GALCEQI+ELNS GYE+ILV+S
Sbjct  1    MENTDPCRHLLKDVKRIIIKVGTAVVTRQDGRLAVGELGALCEQIKELNSLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPQVELDGKACAAVGQNSLMALYDVLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E +  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRMQLSETMKSLLALKVIPIFNENDAVSTRKAPY  166



>gb|AEN04066.1| delta-1-pyrroline-5-carboxylate synthetase [Cucurbita maxima 
x Cucurbita moschata]
Length=717

 Score =   279 bits (714),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS+D +R F+++VKR+VVKVGTAVVTRSDGRLALGR+GALCEQI+ELNSQ +EVILV+S
Sbjct  1    MDSMDRSRTFLRNVKRLVVKVGTAVVTRSDGRLALGRLGALCEQIKELNSQEFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ +LDGKACAAVGQN LMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGIGRQRLRYRQLVNSSFADLQKPQVDLDGKACAAVGQNSLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            L VTDNDFRD  FRSQL++ V  LLSL VIPIFNENDA+STR+APY
Sbjct  121  LPVTDNDFRDKGFRSQLSDTVKSLLSLTVIPIFNENDAVSTRKAPY  166



>ref|XP_007141843.1| hypothetical protein PHAVU_008G230300g [Phaseolus vulgaris]
 gb|ABY61079.1| pyrroline-5-carboxylate synthetase [Phaseolus vulgaris]
 gb|ESW13837.1| hypothetical protein PHAVU_008G230300g [Phaseolus vulgaris]
Length=716

 Score =   278 bits (712),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            +VD +R+F+KDVKR+++KVGTAVVTR +GRLA+GR+GALCEQI++LNS  Y++ILV+SGA
Sbjct  4    AVDPSRSFMKDVKRVIIKVGTAVVTREEGRLAVGRLGALCEQIKQLNSLEYDIILVSSGA  63

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLR+R+LIHSSFADLQKPQ ELDGKACAAVGQN LMALYD+LF+QLDVTSAQLL
Sbjct  64   VGIGRQRLRFRKLIHSSFADLQKPQLELDGKACAAVGQNSLMALYDTLFTQLDVTSAQLL  123

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTDNDFRD DFR QL E V  LL+LKVIP+FNENDA+STR+APY
Sbjct  124  VTDNDFRDKDFRKQLTETVESLLALKVIPVFNENDAVSTRKAPY  167



>gb|ABX54880.2| delta-pyrroline-5-carboxylate synthetase [Eucalyptus camaldulensis]
Length=713

 Score =   278 bits (712),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +DSTRAF+ DVKR+V+KVGTAVVTRSDGRLALGR+GALCEQI+ELN QG+EVILVTSGAV
Sbjct  1    MDSTRAFIGDVKRLVIKVGTAVVTRSDGRLALGRLGALCEQIKELNLQGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTSAQLLV
Sbjct  61   GLGRQRLRYRKLVNSSFADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSAQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DF+  +FR QL+E V  LLSL V+PIFNENDA+STR+APY
Sbjct  121  TDHDFKSIEFRKQLSETVQSLLSLTVVPIFNENDAVSTRKAPY  163



>ref|XP_009419714.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Musa 
acuminata subsp. malaccensis]
Length=711

 Score =   278 bits (712),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +R+F+KDVKRI++KVGTAVVTR+DGRLALGR+GALCEQ++ELN  G+EVILVTSGAV
Sbjct  1    MDPSRSFIKDVKRIIIKVGTAVVTRADGRLALGRLGALCEQVKELNYSGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLR+R+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD+LFSQLDVTS+QLLV
Sbjct  61   GVGRQRLRFRKLVNSSFADLQKPQVELDGKACAAVGQSGLMALYDALFSQLDVTSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DF+DP+FR QL + V  LL+LKVIP+FNENDA+STRRAPY
Sbjct  121  TDSDFKDPNFRMQLCQTVKSLLALKVIPVFNENDAVSTRRAPY  163



>gb|AET97457.1| delta1-pyrroline-5-carboxylate synthetase [Musa acuminata AAA 
Group]
Length=712

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +R+F+KDVKRI++KVGTAVVTR+DGRLALGR+GALCEQ++ELN  G+EVILVTSGAV
Sbjct  1    MDPSRSFIKDVKRIIIKVGTAVVTRADGRLALGRLGALCEQVKELNYSGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLR+R+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD+LFSQLDVTS+QLLV
Sbjct  61   GVGRQRLRFRKLVNSSFADLQKPQVELDGKACAAVGQSGLMALYDALFSQLDVTSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DF+DP+FR QL + V  LL+LKVIP+FNENDA+STRRAPY
Sbjct  121  TDSDFKDPNFRMQLCQTVKSLLALKVIPVFNENDAVSTRRAPY  163



>gb|AGW30209.1| P5CS [Nitraria tangutorum]
Length=714

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +RA +KDVKR+V+KVGTAVVTR DGRLALGR+GA+CEQI+ELN+QGYE+ILV+SGAV
Sbjct  1    MDPSRASLKDVKRLVIKVGTAVVTRGDGRLALGRLGAVCEQIKELNTQGYEIILVSSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRL+YRRL++SSFADLQ+PQ ELDGKACAAVGQN LMALYD+LFS+LDVTSAQLLV
Sbjct  61   GLGRQRLKYRRLVNSSFADLQRPQYELDGKACAAVGQNSLMALYDTLFSELDVTSAQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DFRD DFR QLNE  N LL+L+VIP FNENDAIS+R+APY
Sbjct  121  TDHDFRDKDFRKQLNETENSLLNLRVIPTFNENDAISSRKAPY  163



>ref|XP_003544177.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Glycine 
max]
Length=713

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +2

Query  263  DSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVG  442
            D +R+F+KDVKR+V+KVGTAVVTR +GRLA+GR+GALCEQI++LNS GY++ILV+SGAVG
Sbjct  3    DRSRSFMKDVKRVVIKVGTAVVTREEGRLAVGRLGALCEQIKQLNSLGYDIILVSSGAVG  62

Query  443  AGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVT  622
             GRQRLRYR+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD LF+QLDVTSAQLLVT
Sbjct  63   IGRQRLRYRKLINSSFADLQKPQLELDGKACAAVGQNSLMALYDILFTQLDVTSAQLLVT  122

Query  623  DNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            DNDFRD DFR QL E V  LLSLKVIP+FNENDA+STR+APY
Sbjct  123  DNDFRDEDFRKQLTETVKSLLSLKVIPVFNENDAVSTRKAPY  164



>ref|XP_011077626.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Sesamum 
indicum]
Length=715

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TR FVK+VKR+V KVGTAVVTRSDGRLA+GR+GA+ EQ++ LNSQGYE+ILVTSGAV
Sbjct  1    MDPTRVFVKNVKRVVFKVGTAVVTRSDGRLAVGRVGAIFEQLEALNSQGYEIILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            GAGRQRL+YR+L++SSFADLQKPQ E+DGKACAAVGQNGLMALYDSLFSQLD+TS+QLLV
Sbjct  61   GAGRQRLKYRKLLNSSFADLQKPQVEIDGKACAAVGQNGLMALYDSLFSQLDITSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDF+  DFR+QL++ VN LL+L+ IPIFNENDAISTRRAPY
Sbjct  121  TDNDFKSTDFRTQLSQTVNSLLALRSIPIFNENDAISTRRAPY  163



>ref|XP_008369947.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Malus domestica]
Length=727

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +2

Query  242  RSTMDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVIL  421
            + TMDSVD TRAFVK+VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++NSQGYEVIL
Sbjct  9    KQTMDSVDPTRAFVKNVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINSQGYEVIL  68

Query  422  VTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVT  601
            VTSGAVG GRQRLR+RRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVT
Sbjct  69   VTSGAVGLGRQRLRFRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVT  128

Query  602  SAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            S+QLLVTD+ FRD  FR QL+E V  LL L+V+PIFNENDA+STR+APY
Sbjct  129  SSQLLVTDSVFRDEAFRKQLSETVKSLLKLRVVPIFNENDAVSTRKAPY  177



>ref|XP_008369946.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Malus domestica]
Length=731

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +2

Query  242  RSTMDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVIL  421
            + TMDSVD TRAFVK+VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++NSQGYEVIL
Sbjct  9    KQTMDSVDPTRAFVKNVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINSQGYEVIL  68

Query  422  VTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVT  601
            VTSGAVG GRQRLR+RRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVT
Sbjct  69   VTSGAVGLGRQRLRFRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVT  128

Query  602  SAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            S+QLLVTD+ FRD  FR QL+E V  LL L+V+PIFNENDA+STR+APY
Sbjct  129  SSQLLVTDSVFRDEAFRKQLSETVKSLLKLRVVPIFNENDAVSTRKAPY  177



>ref|XP_009345430.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Pyrus 
x bretschneideri]
Length=727

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +2

Query  242  RSTMDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVIL  421
            + TMDSVD TRAFVK+VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++NSQGYEVIL
Sbjct  9    KQTMDSVDPTRAFVKNVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINSQGYEVIL  68

Query  422  VTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVT  601
            VTSGAVG GRQRLR+RRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVT
Sbjct  69   VTSGAVGLGRQRLRFRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVT  128

Query  602  SAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            S+QLLVTD+ FRD  FR QL+E V  LL L+V+PIFNENDA+STR+APY
Sbjct  129  SSQLLVTDSVFRDEAFRKQLSETVTSLLKLRVVPIFNENDAVSTRKAPY  177



>gb|AES71013.2| delta-1-pyrroline-5-carboxylate synthetase [Medicago truncatula]
Length=715

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D  R FVKDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELN  GYEVILV+S
Sbjct  1    MANADPCRDFVKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNILGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI SSFADLQKPQ ELDGKACAAVGQ+ LMA YD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLIQSSFADLQKPQVELDGKACAAVGQSSLMATYDDLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR+QL+E V  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDQDFRNQLSETVKSLLALKVIPIFNENDAVSTRKAPY  166



>gb|AHJ60270.1| delta-1-pyrroline-5-carboxylate synthase 2 [Pyrus betulifolia]
 gb|AHJ60272.1| delta-1-pyrroline-5-carboxylate synthase 2 [Pyrus betulifolia]
Length=735

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +2

Query  242  RSTMDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVIL  421
            + TMDSVD TRAFVK+VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++NSQGYEVIL
Sbjct  9    KQTMDSVDPTRAFVKNVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINSQGYEVIL  68

Query  422  VTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVT  601
            VTSGAVG GRQRLR+RRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVT
Sbjct  69   VTSGAVGLGRQRLRFRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVT  128

Query  602  SAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            S+QLLVTD+ FRD  FR QL+E V  LL L+V+PIFNENDA+STR+APY
Sbjct  129  SSQLLVTDSVFRDEAFRKQLSETVTSLLKLRVVPIFNENDAVSTRKAPY  177



>emb|CAC82184.1| pyrroline-5-carboxylate synthetase 1 [Medicago truncatula]
Length=715

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D  R FVKDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELN  GYEVILV+S
Sbjct  1    MANADPCRDFVKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNILGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI SSFADLQKPQ ELDGKACAAVGQ+ LMA YD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLIQSSFADLQKPQVELDGKACAAVGQSSLMATYDDLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR+QL+E V  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDQDFRNQLSETVKSLLALKVIPIFNENDAVSTRKAPY  166



>gb|ACZ67848.1| pyrroline-5-carboxylate synthetase [Medicago falcata]
Length=715

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D  R FVKDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELN  GYEVILV+S
Sbjct  1    MANADPCRDFVKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNILGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI SSFADLQKPQ ELDGKACAAVGQ+ LMA YD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLIQSSFADLQKPQVELDGKACAAVGQSSLMATYDDLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E V  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDQDFRKQLSETVKSLLALKVIPIFNENDAVSTRKAPY  166



>sp|P32296.1|P5CS_VIGAC RecName: Full=Delta-1-pyrroline-5-carboxylate synthase; Short=P5CS; 
Includes: RecName: Full=Glutamate 5-kinase; Short=GK; 
AltName: Full=Gamma-glutamyl kinase; Includes: RecName: Full=Gamma-glutamyl 
phosphate reductase; Short=GPR; AltName: Full=Glutamate-5-semialdehyde 
dehydrogenase; AltName: Full=Glutamyl-gamma-semialdehyde 
dehydrogenase [Vigna aconitifolia]
Length=671

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            +VD +R F+KDVKR+++KVGTAVVTR +GRLA+GR+GALCEQI++LNS GY++ILV+SG 
Sbjct  4    AVDPSRGFMKDVKRVIIKVGTAVVTREEGRLAVGRLGALCEQIKQLNSLGYDIILVSSGP  63

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLR+R+LI+SSFADLQKPQ ELDGKACAAVGQN LMALYD+LF+QLDVTSAQLL
Sbjct  64   VGIGRQRLRFRKLINSSFADLQKPQLELDGKACAAVGQNSLMALYDTLFTQLDVTSAQLL  123

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTDNDFRD DFR QL E V  LL+LKVIP+FNENDA+STR+APY
Sbjct  124  VTDNDFRDKDFRKQLTETVKSLLALKVIPVFNENDAVSTRKAPY  167



>ref|XP_008387828.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Malus 
domestica]
Length=716

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDSVD TRAF+K+VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++NSQGYEVILVTS
Sbjct  1    MDSVDPTRAFIKNVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ FRD  FR QL+E V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSVFRDEAFRKQLSETVKSLLKLRVIPIFNENDAVSTRKAPY  166



>ref|XP_011036063.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Populus 
euphratica]
Length=719

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+  D +R F KDVKR+++KVGTAVVTR+DGRLALGR+GALCEQI++LNS GYEVI+VTS
Sbjct  1    MNGTDLSRGFFKDVKRLIIKVGTAVVTRTDGRLALGRLGALCEQIKDLNSLGYEVIVVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YRRLI+SSFADLQKPQ + DGKACAAVGQN LMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLKYRRLINSSFADLQKPQVDFDGKACAAVGQNNLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD  FR QL+E V  LL+L+VIPIFNENDA+STRRAPY
Sbjct  121  LLVTDSDFRDKGFRKQLDETVKSLLALRVIPIFNENDAVSTRRAPY  166



>gb|ABY76166.1| pyrroline-5-carboxylate synthetase [Medicago sativa subsp. x 
varia]
Length=715

 Score =   276 bits (707),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D  R FVKDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELN  GYEVILV+S
Sbjct  1    MANADPCRDFVKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNILGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI SSFADLQKPQ ELDGKACAAVGQ+ LMA YD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLIQSSFADLQKPQVELDGKACAAVGQSSLMATYDDLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E V  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDQDFRKQLSETVRSLLALKVIPIFNENDAVSTRKAPY  166



>ref|XP_009358778.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Pyrus x bretschneideri]
Length=717

 Score =   276 bits (707),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDSVD TRAF+K+VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++NSQGYEVILVTS
Sbjct  1    MDSVDPTRAFIKNVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ FRD  FR QL+E V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSVFRDEAFRKQLSETVKSLLKLRVIPIFNENDAVSTRKAPY  166



>ref|XP_009358777.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Pyrus x bretschneideri]
Length=721

 Score =   276 bits (707),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDSVD TRAF+K+VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++NSQGYEVILVTS
Sbjct  1    MDSVDPTRAFIKNVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ FRD  FR QL+E V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSVFRDEAFRKQLSETVKSLLKLRVIPIFNENDAVSTRKAPY  166



>gb|AEO27874.1| pyrroline-5-carboxylate synthetase [Cucumis melo]
Length=717

 Score =   276 bits (706),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MD +D +RAF++DVKR+V+KV TAVVTRSDGRLALGR+GALCEQI+ELNSQ YEVILV+S
Sbjct  1    MDPMDRSRAFLRDVKRLVIKVRTAVVTRSDGRLALGRLGALCEQIKELNSQEYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ +LDGKACAAVGQN LMALYD+L SQL+VTSAQ
Sbjct  61   GAVGIGRQRLRYRKLVNSSFADLQKPQVDLDGKACAAVGQNSLMALYDTLLSQLEVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL++ V  LL+LKVIPIFN NDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRRQLSDTVKSLLALKVIPIFNANDAVSTRKAPY  166



>ref|XP_002315202.1| VuP5CS family protein [Populus trichocarpa]
 gb|EEF01373.1| VuP5CS family protein [Populus trichocarpa]
Length=719

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+  D +R F KDVKR+++KVGTAVVTR+DGRLALGR+GALCEQI++LNS GYEVI+VTS
Sbjct  1    MNGTDPSRGFFKDVKRLIIKVGTAVVTRTDGRLALGRLGALCEQIKDLNSLGYEVIVVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YRRL++SSFADLQKPQ + DGKACAAVGQN LMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLKYRRLVNSSFADLQKPQVDFDGKACAAVGQNNLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD  FR QL++ V  LL+L+VIPIFNENDA+STRRAPY
Sbjct  121  LLVTDSDFRDKGFRKQLDQTVKSLLALRVIPIFNENDAVSTRRAPY  166



>ref|XP_007026913.1| Pyrroline-5-carboxylate synthetase isoform 3 [Theobroma cacao]
 ref|XP_007026914.1| Pyrroline-5-carboxylate synthetase isoform 3 [Theobroma cacao]
 ref|XP_007026915.1| Pyrroline-5-carboxylate synthetase isoform 3 [Theobroma cacao]
 ref|XP_007026916.1| Pyrroline-5-carboxylate synthetase isoform 3 [Theobroma cacao]
 gb|EOY07415.1| Pyrroline-5-carboxylate synthetase isoform 3 [Theobroma cacao]
 gb|EOY07416.1| Pyrroline-5-carboxylate synthetase isoform 3 [Theobroma cacao]
 gb|EOY07417.1| Pyrroline-5-carboxylate synthetase isoform 3 [Theobroma cacao]
 gb|EOY07418.1| Pyrroline-5-carboxylate synthetase isoform 3 [Theobroma cacao]
Length=525

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS+D +RAFV +VKR++VKVGTAVVTR+DGRLALGR+GALCEQ++ELNSQGYE++LVTS
Sbjct  1    MDSMDPSRAFVTNVKRLIVKVGTAVVTRADGRLALGRLGALCEQLKELNSQGYEIVLVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SS ADLQ  Q ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRKLVNSSLADLQNLQFELDGKACAAVGQSSLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
             LVTD+DFR   FR QL+E V  LL+LKVIPIFNENDA+STRRAPY
Sbjct  121  HLVTDSDFRSVSFRKQLSETVQSLLALKVIPIFNENDAVSTRRAPY  166



>gb|EMS59537.1| Delta-1-pyrroline-5-carboxylate synthase [Triticum urartu]
Length=549

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D  R+F+KDVKRI++KVGTAV+TR+DGRLALGR+GALCEQ+++LN+QGYEVI+VTS
Sbjct  1    MAGADPNRSFMKDVKRIIIKVGTAVITRNDGRLALGRIGALCEQVKDLNAQGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF + +FR +L E V  LL L+VIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFDNSNFRERLRETVESLLELRVIPIFNENDAISTRKAPY  166



>emb|CBH32077.1| hypothetical protein [Glycine max]
Length=715

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ D  R F+KDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELNS GYE+ILV+S
Sbjct  1    MENTDPCRHFLKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNSLGYEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI+SSFADLQKP  ELDGKACAAVGQN L ALYD LFSQ DVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLINSSFADLQKPHVELDGKACAAVGQNSLTALYDVLFSQPDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E +  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDKDFRMQLSETMKSLLALKVIPIFNENDAVSTRKAPY  166



>emb|CAA67069.1| delta-1-pyrroline-5-carboxylate synthase [Medicago sativa]
Length=752

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D  R FVKDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELN  GYEVILV+S
Sbjct  1    MANADPCREFVKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNILGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI SSFADLQKPQ ELDGKACAAVGQ+ LMA YD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLIQSSFADLQKPQVELDGKACAAVGQSSLMATYDILFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR QL+E V  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDQDFRKQLSETVRSLLALKVIPIFNENDAVSTRKAPY  166



>ref|XP_004961886.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Setaria 
italica]
Length=716

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D  R+F+KDVKR+++KVGTAVVTR DGRLALGR+GALCEQ++ELN+ GYEVI+VTS
Sbjct  1    MATADRNRSFMKDVKRVIIKVGTAVVTRHDGRLALGRLGALCEQVKELNTLGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLKYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDF +P+FR +L E V  LL LKV+P+FNENDAISTR+APY
Sbjct  121  LLVTDNDFENPNFRERLRETVESLLDLKVVPVFNENDAISTRKAPY  166



>ref|XP_006654501.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Oryza 
brachyantha]
Length=716

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M SVD +R+FVKDVKR+++KVGTAVV+R DGRLALGR+G+LCEQ++ELN+ GYEVILVTS
Sbjct  1    MASVDQSRSFVKDVKRVIIKVGTAVVSRQDGRLALGRVGSLCEQVKELNTLGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFNQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF +  FR QL E V  LL LKVIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENSKFREQLTETVESLLDLKVIPIFNENDAISTRKAPY  166



>gb|AGW20994.1| delta 1-pyrroline-5-carboxylate synthetase 2 [Saccharum hybrid 
cultivar]
Length=716

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D TRAF+KDVKR+++KVGTAVVTR DGRLALGR+GALCEQ++ELN+ GYEVI+VTS
Sbjct  1    MATADRTRAFMKDVKRVIIKVGTAVVTRHDGRLALGRLGALCEQVKELNALGYEVIIVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG G+QRL+YR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGKQRLKYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF +P+FR +L E V  LL LKV+PIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENPNFRERLRETVESLLDLKVVPIFNENDAISTRKAPY  166



>ref|XP_003600762.1| Delta-pyrroline-5-carboxylate synthetase [Medicago truncatula]
Length=783

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D  R FVKDVKRI++KVGTAVVTR DGRLA+G++GALCEQI+ELN  GYEVILV+S
Sbjct  1    MANADPCRDFVKDVKRIIIKVGTAVVTRQDGRLAVGKLGALCEQIKELNILGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+LI SSFADLQKPQ ELDGKACAAVGQ+ LMA YD LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLRYRKLIQSSFADLQKPQVELDGKACAAVGQSSLMATYDDLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDFRD DFR+QL+E V  LL+LKVIPIFNENDA+STR+APY
Sbjct  121  LLVTDNDFRDQDFRNQLSETVKSLLALKVIPIFNENDAVSTRKAPY  166



>gb|EMT16872.1| Delta-1-pyrroline-5-carboxylate synthetase [Aegilops tauschii]
Length=730

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            +++ DSTR FV+DVKRIVVKVGTAVVT  +GRLA+GR+GALCEQ++ELN QGYEVILVTS
Sbjct  15   LENSDSTRGFVRDVKRIVVKVGTAVVTGQNGRLAMGRLGALCEQVKELNFQGYEVILVTS  74

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+LI+SSFADLQ PQ +LDGKACAAVGQ+GLMA+YD+LFSQLDVTS+Q
Sbjct  75   GAVGVGRQRLKYRKLINSSFADLQNPQLDLDGKACAAVGQSGLMAIYDTLFSQLDVTSSQ  134

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD DFRDP F  QL E V  LL LKVIP+FNENDAISTRRAPY
Sbjct  135  LLVTDRDFRDPSFGHQLRETVVSLLDLKVIPVFNENDAISTRRAPY  180



>emb|CDM85013.1| unnamed protein product [Triticum aestivum]
Length=730

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            +++ DSTR FV+DVKRIVVKVGTAVVT  +GRLA+GR+GALCEQ++ELN QGYEVILVTS
Sbjct  15   LENSDSTRGFVRDVKRIVVKVGTAVVTGQNGRLAMGRLGALCEQVKELNFQGYEVILVTS  74

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+LI+SSFADLQ PQ +LDGKACAAVGQ+GLMA+YD+LFSQLDVTS+Q
Sbjct  75   GAVGVGRQRLKYRKLINSSFADLQNPQLDLDGKACAAVGQSGLMAIYDTLFSQLDVTSSQ  134

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD DFRDP F  QL E V  LL LKVIP+FNENDAISTRRAPY
Sbjct  135  LLVTDRDFRDPSFGHQLRETVVSLLDLKVIPVFNENDAISTRRAPY  180



>gb|AGQ04179.1| putative delta-1-pyrroline-5-carboxylate 1 [Lolium perenne]
Length=716

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTR FV+DVKRIV+KVGTAVVT  +GRLA+GR+GALCEQ++ELN QGYEVILVTS
Sbjct  1    MENSDSTRCFVRDVKRIVIKVGTAVVTGQNGRLAMGRLGALCEQVKELNFQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+LI+SSFADLQ PQ +LDGKACAAVGQ+GLMA+YD+LFSQLDVTS+Q
Sbjct  61   GAVGVGRQRLKYRKLINSSFADLQNPQLDLDGKACAAVGQSGLMAIYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD DFRDP F  QL E V  LL LKVIP+FNENDAISTR+APY
Sbjct  121  LLVTDRDFRDPSFGHQLRETVVSLLDLKVIPVFNENDAISTRKAPY  166



>gb|ABV03819.1| delta-1-pyrroline-5-carboxylate synthetase [Saccharum arundinaceum]
Length=715

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D TR F+KDVKR+++KVGTAVVTR DGRLALGR+GALCEQ++ELN+ GYEVI+VTS
Sbjct  1    MATADRTRTFMKDVKRVIIKVGTAVVTRHDGRLALGRLGALCEQVKELNALGYEVIIVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG G+QRL+YR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGKQRLKYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF +P+FR +L E V  LL LKV+PIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENPNFRERLRETVESLLDLKVVPIFNENDAISTRKAPY  166



>gb|AIA10349.1| delta-1-pyrroline-5-carboxylate synthetase [Saccharum hybrid 
cultivar GT21]
Length=716

 Score =   274 bits (700),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M +VD TRAF+KDVKR+++KVGTAVVTR DGRLALGR+GALCEQ++ELN+ GY VI+VTS
Sbjct  1    MATVDRTRAFMKDVKRVIIKVGTAVVTRHDGRLALGRLGALCEQVKELNALGYGVIIVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG G+QRL+YR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD+LF+QLDV+S Q
Sbjct  61   GAVGVGKQRLKYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDTLFTQLDVSSFQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF +P+FR +L E V  LL LKV+PIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENPNFRERLRETVESLLDLKVVPIFNENDAISTRKAPY  166



>ref|XP_003568327.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Brachypodium 
distachyon]
Length=730

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M S D  RAF+KDVKRI++KVGTAV+TR+DGRLALGR+GALCEQ+++LNSQGYEVI+VTS
Sbjct  1    MASADPNRAFMKDVKRIIIKVGTAVITRNDGRLALGRIGALCEQVKDLNSQGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQNELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF + +FR +L E V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFDNSNFRERLCETVESLLELRVIPIFNENDAVSTRKAPY  166



>gb|ACU65227.1| delta-1-pyrroline-5-carboxylate synthetase 2 [Sorghum bicolor]
Length=715

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D TR+F++DVKR+++KVGTAVVTR DGRLALGR+GALCEQ++ELN+ GYEVI+VTS
Sbjct  1    MATADRTRSFMRDVKRVIIKVGTAVVTRHDGRLALGRLGALCEQVKELNALGYEVIIVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG G+QRL+YR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGKQRLKYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF +P+FR +L E V  LL LKV+PIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENPNFRERLRETVESLLDLKVVPIFNENDAISTRKAPY  166



>ref|XP_004970573.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Setaria 
italica]
Length=727

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTRAFVKDVKRI++KVGTAVVT  +GRLA+GR+G+LCEQ+++LN QGYEVILVTS
Sbjct  12   METADSTRAFVKDVKRIIIKVGTAVVTGQNGRLAMGRLGSLCEQVKQLNFQGYEVILVTS  71

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+LIHSSFADLQ PQ + DGKACAAVGQ+GLMA+YD++FSQLDVTS+Q
Sbjct  72   GAVGVGRQRLQYRKLIHSSFADLQNPQMDFDGKACAAVGQSGLMAIYDTMFSQLDVTSSQ  131

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD DF+DP F  QL E V  LL LKVIP+FNENDAISTRR PY
Sbjct  132  LLVTDRDFKDPSFGDQLRETVFALLDLKVIPLFNENDAISTRRQPY  177



>gb|EYU26613.1| hypothetical protein MIMGU_mgv1a002088mg [Erythranthe guttata]
Length=716

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TR FVK++KR+V KVGTAVVTR+DGRLA+GR+GA+ EQ++ELNSQGYE+ILVTSGAV
Sbjct  1    MDPTRDFVKNIKRVVFKVGTAVVTRNDGRLAIGRVGAIFEQLEELNSQGYEIILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            GAG QRL+YRRL++SSFADLQKPQ E+DGKACAAVGQNGLMA+YDSLF+QL++TS+QLLV
Sbjct  61   GAGCQRLKYRRLLNSSFADLQKPQVEIDGKACAAVGQNGLMAVYDSLFNQLNITSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDF++P+FR+QL+  VN LL+L+ IPIFNENDAISTR+APY
Sbjct  121  TDNDFKNPEFRTQLSRTVNSLLALRSIPIFNENDAISTRKAPY  163



>ref|XP_008240359.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Prunus mume]
Length=718

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDSVD TRAFV  VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++N+QGYEVILVTS
Sbjct  1    MDSVDPTRAFVNRVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINAQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ FRD  FR QL+E V  LL L+V+PIFNENDA+STR+APY
Sbjct  121  LLVTDSVFRDEAFRKQLSETVKSLLKLRVVPIFNENDAVSTRKAPY  166



>ref|XP_008240350.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Prunus mume]
Length=722

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDSVD TRAFV  VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++N+QGYEVILVTS
Sbjct  1    MDSVDPTRAFVNRVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINAQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ FRD  FR QL+E V  LL L+V+PIFNENDA+STR+APY
Sbjct  121  LLVTDSVFRDEAFRKQLSETVKSLLKLRVVPIFNENDAVSTRKAPY  166



>ref|XP_007208056.1| hypothetical protein PRUPE_ppa002087mg [Prunus persica]
 gb|EMJ09255.1| hypothetical protein PRUPE_ppa002087mg [Prunus persica]
Length=718

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDSVD TRAFV  VKRIVVKVGTAVVTR DGRLALGR+GALCEQ++++N+QGYEVILVTS
Sbjct  1    MDSVDPTRAFVNRVKRIVVKVGTAVVTRGDGRLALGRLGALCEQLKDINAQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ FRD  FR QL+E V  LL L+V+PIFNENDA+STR+APY
Sbjct  121  LLVTDSVFRDEAFRKQLSETVKSLLKLRVVPIFNENDAVSTRKAPY  166



>gb|ABS32296.2| delta-1-pyrroline-5-carboxylate synthetase [Saccharum officinarum]
Length=716

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M +VD TR F+KDVKR+++KVGTAVVT  DGRLALGR+GALCEQ++ELN+ GYEVI+VTS
Sbjct  1    MATVDRTRTFMKDVKRVIIKVGTAVVTTHDGRLALGRLGALCEQVKELNALGYEVIIVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG G+QRL+YR+L+ SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGKQRLKYRKLVDSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF +P+FR +L E V  LL LKV+PIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENPNFRERLRETVESLLDLKVVPIFNENDAISTRKAPY  166



>gb|AHM25913.1| delta 1-pyrroline-5-carboxylate synthase [Calotropis procera]
Length=717

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = +2

Query  251  MDS-VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVT  427
            MDS VD +RAFVKDVKR+VVKVGTAVVTR+DGRLALGR+GALCEQI ELNSQGYEVILVT
Sbjct  1    MDSNVDPSRAFVKDVKRVVVKVGTAVVTRADGRLALGRLGALCEQIHELNSQGYEVILVT  60

Query  428  SGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSA  607
            SGAVG GRQRL+YRRL++SSFADLQKPQ ELDGKACAAVGQNGLMALYD LFSQLDVTSA
Sbjct  61   SGAVGVGRQRLKYRRLVNSSFADLQKPQLELDGKACAAVGQNGLMALYDLLFSQLDVTSA  120

Query  608  QLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            QLLVTDNDFRDPDFR QLNE VN LL LKV+PIFNENDAISTRRAPY
Sbjct  121  QLLVTDNDFRDPDFRRQLNETVNSLLDLKVVPIFNENDAISTRRAPY  167



>gb|AGS78290.1| pyrroline-5-carboxylate synthetase [Lolium perenne]
Length=716

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D  R+F+KDVKRI++KVGTAV+TR+DGRLALGR+G+LCEQ+++LN+QGYEVI+VTS
Sbjct  1    MAPADPNRSFIKDVKRIIIKVGTAVITRNDGRLALGRIGSLCEQVKDLNAQGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQNELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF + +FR +L E V  LL L+VIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENSNFRERLRETVESLLELRVIPIFNENDAISTRKAPY  166



>gb|AGQ04180.1| putative delta-1-pyrroline-5-carboxylate 2 [Lolium perenne]
Length=716

 Score =   271 bits (694),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D  R+F+KDVKRI++KVGTAV+TR+DGRLALGR+G+LCEQ+++LN+QGYEVI+VTS
Sbjct  1    MAPADPNRSFIKDVKRIIIKVGTAVITRNDGRLALGRIGSLCEQVKDLNAQGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQNELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF + +FR +L E V  LL L+VIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFENSNFRERLRETVESLLELRVIPIFNENDAISTRKAPY  166



>gb|AIZ77473.1| delta1-pyrroline-5-carboxylate synthetase [Triticum aestivum]
Length=716

 Score =   271 bits (693),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D  R+F+KDVKRI++KVGTAV+TR+DGRLALGR+GALCEQ+++LN+QGYEVI+VTS
Sbjct  1    MAGADLNRSFIKDVKRIIIKVGTAVITRNDGRLALGRIGALCEQVKDLNAQGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF + +FR +L E V  LL L+VIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFDNSNFRERLRETVESLLELRVIPIFNENDAISTRKAPY  166



>gb|AAX35536.1| delta 1-pyrroline-5-carboxylate synthetase [Triticum aestivum]
Length=716

 Score =   271 bits (693),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D  R+F+KDVKRI++KVGTAV+TR+DGRLALGR+GALCEQ+++LN+QGYEVI+VTS
Sbjct  1    MAGADPNRSFMKDVKRIIIKVGTAVITRNDGRLALGRIGALCEQVKDLNAQGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF + +FR +L E V  LL L+VIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFDNSNFRERLRETVESLLELRVIPIFNENDAISTRKAPY  166



>ref|XP_007026911.1| Pyrroline-5-carboxylate synthetase isoform 1 [Theobroma cacao]
 gb|EOY07413.1| Pyrroline-5-carboxylate synthetase isoform 1 [Theobroma cacao]
Length=719

 Score =   271 bits (692),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS+D +RAFV +VKR++VKVGTAVVTR+DGRLALGR+GALCEQ++ELNSQGYE++LVTS
Sbjct  1    MDSMDPSRAFVTNVKRLIVKVGTAVVTRADGRLALGRLGALCEQLKELNSQGYEIVLVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SS ADLQ  Q ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRKLVNSSLADLQNLQFELDGKACAAVGQSSLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
             LVTD+DFR   FR QL+E V  LL+LKVIPIFNENDA+STRRAPY
Sbjct  121  HLVTDSDFRSVSFRKQLSETVQSLLALKVIPIFNENDAVSTRRAPY  166



>gb|EMT28782.1| Delta-1-pyrroline-5-carboxylate synthetase [Aegilops tauschii]
Length=716

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D  R+F+KDVKRI++KVGTAV+TR+DGRLALGR+GALCEQ+++LN+QGYEVI+VTS
Sbjct  1    MAGADLNRSFMKDVKRIIIKVGTAVITRNDGRLALGRIGALCEQVKDLNAQGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF + +FR +L E V  LL L+VIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFDNSNFRERLRETVESLLELRVIPIFNENDAISTRKAPY  166



>gb|ADU02859.1| delta(1)-pyrroline-5-carboxylate synthetase [Puccinellia chinampoensis]
Length=716

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D  R F+KDVKRI++KVGTAV+TR DGRLALGR+GALCEQ+++LN+QGYEVI+VTS
Sbjct  1    MATADPNRNFIKDVKRIIIKVGTAVITRDDGRLALGRIGALCEQVKDLNAQGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQIELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF + +FR +L E V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFENSNFRERLRETVESLLDLRVIPIFNENDAVSTRKAPY  166



>ref|NP_001291233.1| delta-1-pyrroline-5-carboxylate synthase-like [Populus euphratica]
 gb|ABP63534.1| pyrroline-5-carboxylate synthetase [Populus euphratica]
Length=715

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF  DVKR+++KVGTAVVTR+DGRLALGR+GALCEQI++L+S GYEVI+VTS
Sbjct  1    MSDLDRSRAFFNDVKRLIIKVGTAVVTRADGRLALGRLGALCEQIKDLSSLGYEVIVVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YRR ++SSF+DLQKPQ +LDGKACAAVGQN LMALYD+LFSQLDVTSAQ
Sbjct  61   GAVGLGRQRLKYRRFVNSSFSDLQKPQVDLDGKACAAVGQNSLMALYDTLFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD DF++ DFR QL+E V  LL+L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDRDFKNKDFRKQLDETVQSLLALRVIPIFNENDAVSTRKAPY  166



>ref|XP_006379609.1| hypothetical protein POPTR_0008s06060g [Populus trichocarpa]
 gb|ERP57406.1| hypothetical protein POPTR_0008s06060g [Populus trichocarpa]
Length=691

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF  DVKR+++KVGTAVVTR+DGRLALGR+GALCEQI++L+S GYEVI+VTS
Sbjct  1    MSDLDRSRAFFNDVKRLIIKVGTAVVTRADGRLALGRLGALCEQIKDLSSLGYEVIVVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YRR ++SSF+DLQKPQ +LDGKACAAVGQN LMALYD++FSQLDVTSAQ
Sbjct  61   GAVGLGRQRLKYRRFVNSSFSDLQKPQVDLDGKACAAVGQNSLMALYDTMFSQLDVTSAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD DF++ DFR QL+E V  LL+L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDRDFKNKDFRKQLDETVQSLLALRVIPIFNENDAVSTRKAPY  166



>ref|XP_004137758.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Cucumis sativus]
Length=717

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS+D TR F++ VKR+VVKVGTAVVTR DGRLALGR+GALCEQ++ELNS+GYEVILVTS
Sbjct  1    MDSIDPTRIFIRKVKRLVVKVGTAVVTRGDGRLALGRLGALCEQLKELNSRGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRRLANSSFADLQNPQGDFDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ F D  FR QL+E VN LL L+VIPIFNENDA+STR+ PY
Sbjct  121  LLVTDSVFSDTGFRQQLSETVNALLDLRVIPIFNENDAVSTRKTPY  166



>gb|AGW20993.1| delta 1-pyrroline-5-carboxylate synthetase 1 [Saccharum hybrid 
cultivar]
Length=729

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +2

Query  248  TMDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVT  427
            TM++ DS RAFVKDVKRI++KVGTAVVT  +GRLA+ R+G+LCEQ+++LN QGYEVILVT
Sbjct  13   TMENADSARAFVKDVKRIIIKVGTAVVTGQNGRLAMDRLGSLCEQVKQLNFQGYEVILVT  72

Query  428  SGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSA  607
            SGAVG GRQRL+YR+LIHSSFADLQ PQ   DGKACAAVGQ+GLMA+YD+LFSQLDVTS+
Sbjct  73   SGAVGVGRQRLQYRKLIHSSFADLQNPQMNFDGKACAAVGQSGLMAIYDTLFSQLDVTSS  132

Query  608  QLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            QLLVTD DF+DP F  QL E V  LL+LKVIP+FNENDAISTRR PY
Sbjct  133  QLLVTDRDFKDPSFGDQLRETVFPLLNLKVIPLFNENDAISTRRQPY  179



>ref|XP_004305183.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011466523.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Fragaria 
vesca subsp. vesca]
Length=717

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+++D TRAFVK+VKR++VKVGTAVVTR DGRLALGR+GALCEQ++++NSQGYEVILVTS
Sbjct  1    MEAIDPTRAFVKNVKRVIVKVGTAVVTRGDGRLALGRLGALCEQLKDINSQGYEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYRRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++F+QLDVTS+Q
Sbjct  61   GAVGLGRQRLRYRRLANSSFADLQNPQNDFDGKACAAVGQSSLMALYDAMFAQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ FRD  FR QL++ V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSVFRDEAFRKQLSDTVKSLLRLRVIPIFNENDAVSTRKAPY  166



>gb|AFP89589.1| delta-1-pyrroline-5-carboxylate synthetase [Sophora davidii]
Length=753

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            +VD +RAFV+ VKR++VKVGTAVVTRSDGRLALGR+GALCEQ++ELN+QGYEVILVTSGA
Sbjct  39   NVDPSRAFVRKVKRLIVKVGTAVVTRSDGRLALGRLGALCEQLKELNTQGYEVILVTSGA  98

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG G+QRLRYRRL +SSF+DLQKPQ ELDGKACAAVGQ+ LMALYD++FSQLDVTS+QLL
Sbjct  99   VGLGKQRLRYRRLANSSFSDLQKPQTELDGKACAAVGQSSLMALYDTMFSQLDVTSSQLL  158

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            V D  FRD  FR QL + VN LL L+VIPIFNENDA+STR+APY
Sbjct  159  VNDGFFRDAGFRKQLPDTVNSLLDLRVIPIFNENDAVSTRKAPY  202



>ref|XP_003564608.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Brachypodium 
distachyon]
Length=732

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DSTR FV+DVKRIV+KVGTAVVT  +GRLA+GR+GALCEQ++ELN QGYEVILVTS
Sbjct  17   MENSDSTRCFVRDVKRIVIKVGTAVVTGQNGRLAMGRLGALCEQVKELNFQGYEVILVTS  76

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+LI+SSFADLQ PQ +LDGKACAAVGQ+GLMA+YD+LFSQLDVTS+Q
Sbjct  77   GAVGVGRQRLKYRKLINSSFADLQNPQLDLDGKACAAVGQSGLMAIYDTLFSQLDVTSSQ  136

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD DF DP F  QL E V  LL LKVIP+FNENDAISTR+ PY
Sbjct  137  LLVTDRDFLDPSFGHQLRETVISLLDLKVIPVFNENDAISTRKQPY  182



>ref|XP_003516890.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Glycine max]
Length=755

 Score =   269 bits (687),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            + ++D +R FV  VKRI+VKVGTAVVTRSDGRLALGR+GALCEQ++EL+SQGYEVILVTS
Sbjct  39   LGNIDPSRVFVTKVKRIIVKVGTAVVTRSDGRLALGRIGALCEQLKELSSQGYEVILVTS  98

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L +SSF+DLQKPQ ELDGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  99   GAVGLGRQRLRYRKLANSSFSDLQKPQEELDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  158

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D  FRD  FR QL++ VN LL L+VIPIFNENDA+STR+APY
Sbjct  159  LLVNDGFFRDSGFRKQLSDTVNSLLDLRVIPIFNENDAVSTRKAPY  204



>gb|KHN05644.1| Delta-1-pyrroline-5-carboxylate synthase [Glycine soja]
Length=758

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            + ++D +R FV  VKRI+VKVGTAVVTRSDGRLALGR+GALCEQ++EL+SQGYEVILVTS
Sbjct  39   LGNIDPSRVFVTKVKRIIVKVGTAVVTRSDGRLALGRIGALCEQLKELSSQGYEVILVTS  98

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L +SSF+DLQKPQ ELDGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  99   GAVGLGRQRLRYRKLANSSFSDLQKPQEELDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  158

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D  FRD  FR QL++ VN LL L+VIPIFNENDA+STR+APY
Sbjct  159  LLVNDGFFRDSGFRKQLSDTVNSLLDLRVIPIFNENDAVSTRKAPY  204



>gb|KJB46606.1| hypothetical protein B456_007G377200 [Gossypium raimondii]
Length=716

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D  RAF+ DVKR++VKVGTAVVTR DGRLA+GR+GALCEQ++ELNSQGYEV+LVTSGAV
Sbjct  1    MDPIRAFLIDVKRLIVKVGTAVVTRHDGRLAVGRLGALCEQLKELNSQGYEVVLVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYR+L++SS ADLQ PQ ELDGKACAAVGQN LMALYD+LFSQLDVTS+Q LV
Sbjct  61   GLGRQRLRYRKLVNSSLADLQNPQVELDGKACAAVGQNSLMALYDTLFSQLDVTSSQHLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DFR+  FR QL+E V  LL+LKVIP+FNENDA+STRR PY
Sbjct  121  TDSDFRNDSFREQLSETVKSLLALKVIPVFNENDAVSTRRTPY  163



>dbj|BAD97364.1| delta1-pyrroline-5-carboxylate synthetase [Triticum aestivum]
Length=716

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D  R+ +KDVKRI++KVGTAV+TR+DGRLALGR+GALCEQ+++LN+QGYEVI+VTS
Sbjct  1    MAGADPNRSSMKDVKRIIIKVGTAVITRNDGRLALGRIGALCEQVKDLNAQGYEVIMVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DF + +FR +L E V  LL L+VIPIFNENDAISTR+APY
Sbjct  121  LLVTDSDFDNSNFRERLRETVESLLELRVIPIFNENDAISTRKAPY  166



>gb|KHG23088.1| Delta-1-pyrroline-5-carboxylate synthase [Gossypium arboreum]
Length=709

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D  RAF+ DVKR++VKVGTAVVTR DGRLA+GR+GALCEQ++ELNSQGYEV+LVTSGAV
Sbjct  1    MDPIRAFLIDVKRLIVKVGTAVVTRHDGRLAVGRLGALCEQLKELNSQGYEVVLVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYR+L++SS ADLQ PQ ELDGKACAAVGQN LMALYD+LFSQLDVTS+Q LV
Sbjct  61   GLGRQRLRYRKLVNSSLADLQNPQVELDGKACAAVGQNSLMALYDTLFSQLDVTSSQHLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DFR   FR QL+E V  LL+LKVIP+FNENDA+STRRAPY
Sbjct  121  TDSDFRIDSFREQLSETVKSLLALKVIPVFNENDAVSTRRAPY  163



>ref|NP_001044802.1| Os01g0848200 [Oryza sativa Japonica Group]
 dbj|BAB64280.1| putative delta-1-pyrroline-5-carboxylate synthetase [Oryza sativa 
Japonica Group]
 dbj|BAF06716.1| Os01g0848200 [Oryza sativa Japonica Group]
 dbj|BAG94966.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71802.1| hypothetical protein OsI_04432 [Oryza sativa Indica Group]
 gb|EEE55670.1| hypothetical protein OsJ_04075 [Oryza sativa Japonica Group]
Length=735

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  239  SRSTMDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVI  418
            +++ +++ DSTR FVKDVKRI++KVGTAVVT  +GRLA+GR+GALCEQ+++LN +GYEVI
Sbjct  16   AKADVENTDSTRGFVKDVKRIIIKVGTAVVTGPNGRLAMGRLGALCEQVKQLNFEGYEVI  75

Query  419  LVTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDV  598
            LVTSGAVG GRQRL+YR+L++SSFADLQ PQ ++DGKACAAVGQ+ LMA+YD+LFSQLDV
Sbjct  76   LVTSGAVGVGRQRLKYRKLVNSSFADLQNPQMDMDGKACAAVGQSVLMAIYDTLFSQLDV  135

Query  599  TSAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TS+QLLVTD DF DP F +QL E VN LL LKVIP+FNENDAISTRR PY
Sbjct  136  TSSQLLVTDRDFMDPSFGNQLRETVNSLLDLKVIPVFNENDAISTRRQPY  185



>gb|ABM30223.1| delta-1-pyrroline-5-carboxylate synthetase [Saccharum officinarum]
Length=716

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M +VD TR F+KDVKR+++KVGTAVVT  DGRLALGR+GALCEQ++ELN+  YEVI+VTS
Sbjct  1    MATVDRTRTFMKDVKRVIIKVGTAVVTTHDGRLALGRLGALCEQVKELNALRYEVIIVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG G+QRL+YR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD L +QLDV+S+Q
Sbjct  61   GAVGVGKQRLKYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLXTQLDVSSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDF +P+FR +L E V  LL LKV+PIFNENDAISTR+APY
Sbjct  121  LLVTDNDFENPNFRERLRETVESLLDLKVVPIFNENDAISTRKAPY  166



>ref|XP_006645010.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Oryza 
brachyantha]
Length=734

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            +++ DSTR FVKDVKRI++KVGTAVVT  +GRLA+GR+G+LCEQ+++LN +GYEVILVTS
Sbjct  19   VENTDSTRGFVKDVKRIIIKVGTAVVTGPNGRLAMGRLGSLCEQVKQLNFEGYEVILVTS  78

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+LI+SSFADLQ PQ ++DGKACAAVGQ+GLMA+YD+LFSQLDVTS+Q
Sbjct  79   GAVGVGRQRLKYRKLINSSFADLQNPQTDMDGKACAAVGQSGLMAIYDTLFSQLDVTSSQ  138

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD DF DP F +QL E V+ LL LKVIP+FNENDAISTRR PY
Sbjct  139  LLVTDRDFLDPSFGNQLRETVDSLLDLKVIPVFNENDAISTRRQPY  184



>gb|KJB76799.1| hypothetical protein B456_012G107700 [Gossypium raimondii]
Length=712

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +R FV +VKR++VKVGTAVVTR+DGRLA+GR+GALCEQ++ELNSQGYE++LVTSGAV
Sbjct  1    MDPSRCFVTNVKRLIVKVGTAVVTRADGRLAVGRLGALCEQLKELNSQGYEIVLVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYR+L++SS ADLQ PQ ELDGKACAAVGQ+ LMALYD+LFSQLDV+S+Q LV
Sbjct  61   GLGRQRLRYRKLVNSSLADLQNPQYELDGKACAAVGQSSLMALYDTLFSQLDVSSSQHLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD DFR+  FR QL+E V  LL+LKVIPIFNENDA+STRRAPY
Sbjct  121  TDTDFRNGSFRKQLSETVKSLLALKVIPIFNENDAVSTRRAPY  163



>ref|XP_003520914.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Glycine max]
Length=756

 Score =   267 bits (683),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            ++D +R FV  VKRI+VKVGTAVVTRSDGRLALGR+GALCEQ++EL+SQGYEVILVTSGA
Sbjct  42   NIDPSRVFVTKVKRIIVKVGTAVVTRSDGRLALGRIGALCEQLKELSSQGYEVILVTSGA  101

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYR+L +SSF+DLQKPQ ELDGKACAAVGQ+ LMALYD++FSQLDVTS+QLL
Sbjct  102  VGLGRQRLRYRKLANSSFSDLQKPQGELDGKACAAVGQSSLMALYDTMFSQLDVTSSQLL  161

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            V D  FRD  FR QL++ VN LL L+VIPIFNENDA+STR+APY
Sbjct  162  VNDGFFRDSGFRKQLSDTVNSLLDLRVIPIFNENDAVSTRKAPY  205



>ref|XP_010691523.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=713

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D++R FVKDVKR++VKVGTAVVTRSDGR+ALGR+G+LCEQ++ELN  GYEVILVTSGAV
Sbjct  1    MDTSRVFVKDVKRVIVKVGTAVVTRSDGRMALGRLGSLCEQLKELNLDGYEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
             AGRQRLR+R+L++SSFADLQKPQ ELDGKACAAVGQN LMALYD+LFSQLD+TSAQLLV
Sbjct  61   SAGRQRLRFRKLVNSSFADLQKPQAELDGKACAAVGQNSLMALYDTLFSQLDLTSAQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAIST  733
            TDNDFRDP+FRSQ+ E VNQLL  KV+P+ NENDA  T
Sbjct  121  TDNDFRDPNFRSQITETVNQLLDSKVVPVLNENDAGCT  158



>dbj|BAI22477.1| delta 1-pyrroline-5-carboxylate synthase [Vigna unguiculata]
Length=751

 Score =   266 bits (681),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            ++D +RAFV  VKR++VKVGTAVVTRSDGRLALGR+GALCEQ++EL+SQG+EVILVTSGA
Sbjct  37   NIDPSRAFVSKVKRLIVKVGTAVVTRSDGRLALGRIGALCEQLKELSSQGFEVILVTSGA  96

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYR+L +SSF+DLQKPQ ELDGKACAAVGQ+ LMALYD++FSQLDVTS+QLL
Sbjct  97   VGLGRQRLRYRKLANSSFSDLQKPQGELDGKACAAVGQSSLMALYDTMFSQLDVTSSQLL  156

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            V D  FRD  FR QL++ VN LL L+VIPIFNENDA+STR+APY
Sbjct  157  VNDGFFRDAGFRKQLSDTVNALLDLRVIPIFNENDAVSTRKAPY  200



>dbj|BAB33037.1| VuP5CS [Vigna unguiculata]
Length=751

 Score =   266 bits (681),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            ++D +RAFV  VKR++VKVGTAVVTRSDGRLALGR+GALCEQ++EL+SQG+EVILVTSGA
Sbjct  37   NIDPSRAFVSKVKRLIVKVGTAVVTRSDGRLALGRIGALCEQLKELSSQGFEVILVTSGA  96

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYR+L +SSF+DLQKPQ ELDGKACAAVGQ+ LMALYD++FSQLDVTS+QLL
Sbjct  97   VGLGRQRLRYRKLANSSFSDLQKPQGELDGKACAAVGQSSLMALYDTMFSQLDVTSSQLL  156

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            V D  FRD  FR QL++ VN LL L+VIPIFNENDA+STR+APY
Sbjct  157  VNDGFFRDAGFRKQLSDTVNALLDLRVIPIFNENDAVSTRKAPY  200



>ref|XP_010105422.1| Delta-1-pyrroline-5-carboxylate synthase [Morus notabilis]
 gb|EXC04697.1| Delta-1-pyrroline-5-carboxylate synthase [Morus notabilis]
Length=206

 Score =   251 bits (640),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +RAFV DVKR+++KVGTAVVTR+DGRLALGR+GALCEQI++LNS GYEVILVTSGA+
Sbjct  1    MDPSRAFVDDVKRLIIKVGTAVVTRNDGRLALGRLGALCEQIKDLNSLGYEVILVTSGAI  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRL YR+LI+SS  DLQKPQ E+DGK+CA VGQN +MALYD+LF QLD+TSAQLLV
Sbjct  61   GLGRQRLSYRKLINSSLDDLQKPQAEIDGKSCAVVGQN-IMALYDTLFIQLDMTSAQLLV  119

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRA  742
            T+NDF D DFR QL E VN LLSLKV+PI NENDA S R+A
Sbjct  120  TNNDFSDKDFRRQLKETVNSLLSLKVVPILNENDAFSIRKA  160



>gb|AFW81700.1| delta-pyrroline-5-carboxylate synthetase [Zea mays]
Length=679

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSD-GRLALGRMGALCEQIQELNSQGYEVILVT  427
            M + D TR F+KDVKR+++KVGTAVVTR D GRLA+GR+G LCEQ++ELN  GYEVILVT
Sbjct  1    MATADRTRTFMKDVKRVIIKVGTAVVTRGDDGRLAVGRLGCLCEQVKELNVLGYEVILVT  60

Query  428  SGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSA  607
            SGAVG G+QRL+YR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+
Sbjct  61   SGAVGVGKQRLKYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSS  120

Query  608  QLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            QLLVTD+DF +P+FR +L E V  LL LKV+PIFNENDAISTR+APY
Sbjct  121  QLLVTDSDFENPNFRERLCETVESLLDLKVVPIFNENDAISTRKAPY  167



>ref|XP_009133385.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase A-like isoform 
X2 [Brassica rapa]
Length=622

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+  D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILVTS
Sbjct  1    MEETDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR++I+SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQMINSSFADLQKPQSELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QL+E V  +L L VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLSETVKSMLDLSVIPIFNENDAISTRRAPY  166



>gb|ERN08053.1| hypothetical protein AMTR_s00012p00263260 [Amborella trichopoda]
Length=698

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +2

Query  311  VGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVGAGRQRLRYRRLIHSSF  490
            VGTAVVTRSDGRLALGR+GALCEQ++ELNSQG EVILVTSGAVG GRQRLRYRRL++SSF
Sbjct  2    VGTAVVTRSDGRLALGRVGALCEQVKELNSQGLEVILVTSGAVGVGRQRLRYRRLVNSSF  61

Query  491  ADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVTDNDFRDPDFRSQLNEA  670
            ADLQKPQ ELDGKACAAVGQNGLMALYD LFSQLDVTS+QLLVTDNDF+D DFR QL E 
Sbjct  62   ADLQKPQLELDGKACAAVGQNGLMALYDVLFSQLDVTSSQLLVTDNDFKDSDFRMQLTET  121

Query  671  VNQLLSLKVIPIFNENDAISTRRAPY  748
            VN LL+L+V+P+FNENDA+STRRAPY
Sbjct  122  VNSLLNLRVVPVFNENDAVSTRRAPY  147



>ref|XP_008656219.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Zea mays]
 ref|XP_008656220.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Zea mays]
 ref|XP_008656221.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Zea mays]
 gb|ACR33941.1| unknown [Zea mays]
 gb|AFW81698.1| p5cs isoform 1 [Zea mays]
 gb|AFW81699.1| p5cs isoform 2 [Zea mays]
Length=717

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSD-GRLALGRMGALCEQIQELNSQGYEVILVT  427
            M + D TR F+KDVKR+++KVGTAVVTR D GRLA+GR+G LCEQ++ELN  GYEVILVT
Sbjct  1    MATADRTRTFMKDVKRVIIKVGTAVVTRGDDGRLAVGRLGCLCEQVKELNVLGYEVILVT  60

Query  428  SGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSA  607
            SGAVG G+QRL+YR+L++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LF+QLDV+S+
Sbjct  61   SGAVGVGKQRLKYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFTQLDVSSS  120

Query  608  QLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            QLLVTD+DF +P+FR +L E V  LL LKV+PIFNENDAISTR+APY
Sbjct  121  QLLVTDSDFENPNFRERLCETVESLLDLKVVPIFNENDAISTRKAPY  167



>ref|XP_006411215.1| hypothetical protein EUTSA_v10016322mg [Eutrema salsugineum]
 gb|ESQ52668.1| hypothetical protein EUTSA_v10016322mg [Eutrema salsugineum]
Length=708

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQSELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>gb|KJB76800.1| hypothetical protein B456_012G107700 [Gossypium raimondii]
Length=722

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            +++S R F+++VKR+ VKVGTAVVTR+DGRLA+GR+GALCEQ++ELNSQGYE++LVTSGA
Sbjct  10   AMESERTFMRNVKRVFVKVGTAVVTRADGRLAVGRLGALCEQLKELNSQGYEIVLVTSGA  69

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRLRYR+L++SS ADLQ PQ ELDGKACAAVGQ+ LMALYD+LFSQLDV+S+Q L
Sbjct  70   VGLGRQRLRYRKLVNSSLADLQNPQYELDGKACAAVGQSSLMALYDTLFSQLDVSSSQHL  129

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTD DFR+  FR QL+E V  LL+LKVIPIFNENDA+STRRAPY
Sbjct  130  VTDTDFRNGSFRKQLSETVKSLLALKVIPIFNENDAVSTRRAPY  173



>ref|XP_010654240.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Vitis vinifera]
 emb|CBI30493.3| unnamed protein product [Vitis vinifera]
Length=714

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +DS+R FVKDVKR++VKVGTAVVTR+DGRLA+GR+GALCEQ++ELNSQGYEVILV SGAV
Sbjct  1    MDSSREFVKDVKRVIVKVGTAVVTRADGRLAVGRVGALCEQLKELNSQGYEVILVASGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G G QRLRYRRL++SS  DLQKPQ ELD KACAAVGQ+ LMALYD+LFSQLDVT++QLLV
Sbjct  61   GVGIQRLRYRRLVNSSLDDLQKPQIELDSKACAAVGQSSLMALYDTLFSQLDVTASQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAP  745
            T++DFR+PDFR QL+E V  LL L+VIPIFNENDAISTR  P
Sbjct  121  TNSDFRNPDFRMQLSETVGSLLDLRVIPIFNENDAISTRDHP  162



>ref|XP_006411212.1| hypothetical protein EUTSA_v10016322mg [Eutrema salsugineum]
 ref|XP_006411213.1| hypothetical protein EUTSA_v10016322mg [Eutrema salsugineum]
 ref|XP_006411214.1| hypothetical protein EUTSA_v10016322mg [Eutrema salsugineum]
 dbj|BAJ34419.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52665.1| hypothetical protein EUTSA_v10016322mg [Eutrema salsugineum]
 gb|ESQ52666.1| hypothetical protein EUTSA_v10016322mg [Eutrema salsugineum]
 gb|ESQ52667.1| hypothetical protein EUTSA_v10016322mg [Eutrema salsugineum]
Length=716

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQSELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>ref|XP_006293364.1| hypothetical protein CARUB_v10022685mg, partial [Capsella rubella]
 gb|EOA26262.1| hypothetical protein CARUB_v10022685mg, partial [Capsella rubella]
Length=771

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 149/179 (83%), Gaps = 5/179 (3%)
 Frame = +2

Query  227  FCLC-----SRSTMDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQE  391
            FC+C       + M+ +D +RAF +DVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ E
Sbjct  42   FCVCVVLVGETTAMEELDRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAE  101

Query  392  LNSQGYEVILVTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALY  571
            LNS G+EVILV+SGAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y
Sbjct  102  LNSDGFEVILVSSGAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYY  161

Query  572  DSLFSQLDVTSAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +++F QLDVT+AQLLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  162  ETMFDQLDVTAAQLLVNDSSFRDKEFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  220



>gb|EEE63954.1| hypothetical protein OsJ_18779 [Oryza sativa Japonica Group]
Length=745

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 151/195 (77%), Gaps = 29/195 (15%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVK-----------------------------VGTAVVTRSDG  343
            M SVD +R+FV+DVKR+++K                             VGTAVV+R DG
Sbjct  1    MASVDPSRSFVRDVKRVIIKIIRSGALLGLFCGLLDVTAYVEVANLSTLVGTAVVSRQDG  60

Query  344  RLALGRMGALCEQIQELNSQGYEVILVTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELD  523
            RLALGR+GALCEQ++ELNS GYEVILVTSGAVG GRQRLRYR+L++SSFADLQKPQ ELD
Sbjct  61   RLALGRVGALCEQVKELNSLGYEVILVTSGAVGVGRQRLRYRKLVNSSFADLQKPQMELD  120

Query  524  GKACAAVGQNGLMALYDSLFSQLDVTSAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIP  703
            GKACAAVGQ+GLMALYD LF+QLDV+S+QLLVTD+DF +P FR QL E V  LL LKVIP
Sbjct  121  GKACAAVGQSGLMALYDMLFNQLDVSSSQLLVTDSDFENPKFREQLTETVESLLDLKVIP  180

Query  704  IFNENDAISTRRAPY  748
            IFNENDAISTR+APY
Sbjct  181  IFNENDAISTRKAPY  195



>gb|EEC79334.1| hypothetical protein OsI_20190 [Oryza sativa Indica Group]
Length=745

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 151/195 (77%), Gaps = 29/195 (15%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVK-----------------------------VGTAVVTRSDG  343
            M SVD +R+FV+DVKR+++K                             VGTAVV+R DG
Sbjct  1    MASVDPSRSFVRDVKRVIIKIIRSGALLGLFCGLLDVTAYVEVANLSTLVGTAVVSRQDG  60

Query  344  RLALGRMGALCEQIQELNSQGYEVILVTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELD  523
            RLALGR+GALCEQ++ELNS GYEVILVTSGAVG GRQRLRYR+L++SSFADLQKPQ ELD
Sbjct  61   RLALGRVGALCEQVKELNSLGYEVILVTSGAVGVGRQRLRYRKLVNSSFADLQKPQMELD  120

Query  524  GKACAAVGQNGLMALYDSLFSQLDVTSAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIP  703
            GKACAAVGQ+GLMALYD LF+QLDV+S+QLLVTD+DF +P FR QL E V  LL LKVIP
Sbjct  121  GKACAAVGQSGLMALYDMLFNQLDVSSSQLLVTDSDFENPKFREQLTETVESLLDLKVIP  180

Query  704  IFNENDAISTRRAPY  748
            IFNENDAISTR+APY
Sbjct  181  IFNENDAISTRKAPY  195



>gb|ABR18097.1| unknown [Picea sitchensis]
Length=749

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +RAFVK+ KR+++KVGTAVVTR++G LALGR+G+LCEQ++EL S G EVILVTSGAV
Sbjct  1    MDPSRAFVKNAKRVIIKVGTAVVTRANGGLALGRLGSLCEQVKELMSFGLEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRY+RLI+SSF DLQKPQ ELDGK CAAVGQ+GLMALYDSLFSQLDV S+QLLV
Sbjct  61   GIGRQRLRYQRLINSSFVDLQKPQVELDGKPCAAVGQSGLMALYDSLFSQLDVASSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDN+F+DP+FR QLN+ V  LL L+V+PIFNENDA+STR+APY
Sbjct  121  TDNEFKDPEFRRQLNDTVTSLLELRVVPIFNENDAVSTRKAPY  163



>emb|CDY20482.1| BnaC04g05620D [Brassica napus]
Length=717

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQHELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKEFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>gb|AIF76244.1| delta1-pyrroline-5-carboxylate synthetase 1 [Brassica napus]
Length=717

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQHELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKEFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>gb|AAK01360.1|AF314811_1 delta 1-pyrroline-5-carboxylate synthetase A [Brassica napus]
Length=717

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQHELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKEFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>gb|AIF76241.1| delta1-pyrroline-5-carboxylate synthetase 1 [Brassica napus]
 emb|CDX74830.1| BnaA05g05760D [Brassica napus]
Length=717

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQHELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKEFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>ref|XP_009143283.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase A isoform 
X1 [Brassica rapa]
Length=717

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQHELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKEFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>ref|NP_181510.1| delta1-pyrroline-5-carboxylate synthase 1 [Arabidopsis thaliana]
 ref|NP_001189714.1| delta1-pyrroline-5-carboxylate synthase 1 [Arabidopsis thaliana]
 sp|P54887.1|P5CS1_ARATH RecName: Full=Delta-1-pyrroline-5-carboxylate synthase A; Short=P5CS 
A; Includes: RecName: Full=Glutamate 5-kinase; Short=GK; 
AltName: Full=Gamma-glutamyl kinase; Includes: RecName: 
Full=Gamma-glutamyl phosphate reductase; Short=GPR; AltName: 
Full=Glutamate-5-semialdehyde dehydrogenase; AltName: Full=Glutamyl-gamma-semialdehyde 
dehydrogenase [Arabidopsis thaliana]
 gb|AAL11626.1|AF424633_1 At2g39800/T5I7.10 [Arabidopsis thaliana]
 emb|CAA60740.1| pyrroline-5-carboxylate synthetase [Arabidopsis thaliana]
 emb|CAA60446.1| pyrroline-5-carboxylate synthetase A [Arabidopsis thaliana]
 emb|CAA61593.1| pyrroline-5-carboxylate synthase [Arabidopsis thaliana]
 gb|AAB87129.1| delta-1-pyrroline 5-carboxylase synthetase (P5C1) [Arabidopsis 
thaliana]
 gb|AAM47354.1| At2g39800/T5I7.10 [Arabidopsis thaliana]
 gb|AAN12972.1| delta-1-pyrroline 5-carboxylase synthetase (P5C1) [Arabidopsis 
thaliana]
 gb|AEC09729.1| delta1-pyrroline-5-carboxylate synthase 1 [Arabidopsis thaliana]
 gb|AEC09730.1| delta1-pyrroline-5-carboxylate synthase 1 [Arabidopsis thaliana]
Length=717

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF +DVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>ref|XP_002881679.1| delta1-pyrroline-5-carboxylate synthase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH57938.1| delta1-pyrroline-5-carboxylate synthase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=717

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF +DVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>emb|CDY65768.1| BnaC04g55570D [Brassica napus]
Length=726

 Score =   263 bits (672),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D +RAF K+VKRIVVKVGTAVVT  DGRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MAETDRSRAFTKNVKRIVVKVGTAVVTGKDGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+ LMA Y+S+F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQNELDGKACAAVGQSSLMAYYESMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD DFRD DFR QL+E V  ++ ++VIP+FNENDAISTR+APY
Sbjct  121  MLVTDKDFRDKDFRKQLSETVKAMMKMRVIPVFNENDAISTRKAPY  166



>ref|NP_001189715.1| delta1-pyrroline-5-carboxylate synthase 1 [Arabidopsis thaliana]
 gb|AEC09731.1| delta1-pyrroline-5-carboxylate synthase 1 [Arabidopsis thaliana]
Length=714

 Score =   263 bits (672),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF +DVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>gb|KJB16950.1| hypothetical protein B456_002G256200 [Gossypium raimondii]
Length=716

 Score =   263 bits (671),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +RAFV +VKR++VKVGTAVVTR DGRLA+GR+GALCEQ++ELNSQGYE++LVTSGAV
Sbjct  1    MDPSRAFVTNVKRLIVKVGTAVVTRGDGRLAVGRLGALCEQLKELNSQGYEIVLVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G G QRLRYR+L++SS A+LQ  Q ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q LV
Sbjct  61   GIGLQRLRYRKLVNSSLAELQNAQFELDGKACAAVGQSSLMALYDTLFSQLDVTSSQYLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD +FRD  FR QL+E V  LLSLKVIPIFNENDA+STRRAPY
Sbjct  121  TDTEFRDTSFRKQLSETVKSLLSLKVIPIFNENDAVSTRRAPY  163



>gb|KFK36869.1| hypothetical protein AALP_AA4G182500 [Arabis alpina]
Length=717

 Score =   263 bits (671),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF +DVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>gb|AIF76246.1| delta1-pyrroline-5-carboxylate synthetase 1 [Brassica napus]
Length=715

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+  D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILVTS
Sbjct  1    MEETDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR++I+SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQMINSSFADLQKPQSELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QL+E V  +L L VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLSETVKSMLDLSVIPIFNENDAISTRRAPY  166



>gb|KJB16951.1| hypothetical protein B456_002G256200 [Gossypium raimondii]
Length=725

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +RAFV +VKR++VKVGTAVVTR DGRLA+GR+GALCEQ++ELNSQGYE++LVTSGAV
Sbjct  1    MDPSRAFVTNVKRLIVKVGTAVVTRGDGRLAVGRLGALCEQLKELNSQGYEIVLVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G G QRLRYR+L++SS A+LQ  Q ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q LV
Sbjct  61   GIGLQRLRYRKLVNSSLAELQNAQFELDGKACAAVGQSSLMALYDTLFSQLDVTSSQYLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD +FRD  FR QL+E V  LLSLKVIPIFNENDA+STRRAPY
Sbjct  121  TDTEFRDTSFRKQLSETVKSLLSLKVIPIFNENDAVSTRRAPY  163



>emb|CDY61781.1| BnaC03g72600D [Brassica napus]
Length=715

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+  D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILVTS
Sbjct  1    MEETDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR++I+SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQMINSSFADLQKPQSELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QL+E V  +L L VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLSETVKSMLDLSVIPIFNENDAISTRRAPY  166



>ref|XP_002441204.1| hypothetical protein SORBIDRAFT_09g022310 [Sorghum bicolor]
 gb|EES19634.1| hypothetical protein SORBIDRAFT_09g022310 [Sorghum bicolor]
Length=354

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M + D TR F+KDVKR+++K+GTAVVTR DGRLALGR+GALCEQ+ ELN+ GYEVI+VTS
Sbjct  1    MATADPTRTFMKDVKRVIIKLGTAVVTRHDGRLALGRLGALCEQVMELNALGYEVIIVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GA+G G+QRL+ R+L++SSFADLQ PQ ELDGKACAAVGQ+GLMALYD LF+QLDV+++Q
Sbjct  61   GAIGVGKQRLKKRKLVNSSFADLQLPQMELDGKACAAVGQSGLMALYDMLFTQLDVSASQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVT +DF +P+FR +L   V  LL LKV+PIFN+NDAISTR+A Y
Sbjct  121  LLVTHSDFENPNFRERLRGTVESLLDLKVVPIFNDNDAISTRKALY  166



>emb|CDY07635.1| BnaA03g18760D [Brassica napus]
Length=715

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+  D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILVTS
Sbjct  1    MEETDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR++I+SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQMINSSFADLQKPQSELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QL+E V  +L L VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLSETVKSMLDLSVIPIFNENDAISTRRAPY  166



>ref|XP_009133384.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase A-like isoform 
X1 [Brassica rapa]
Length=715

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+  D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILVTS
Sbjct  1    MEETDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR++I+SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQMINSSFADLQKPQSELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QL+E V  +L L VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLSETVKSMLDLSVIPIFNENDAISTRRAPY  166



>gb|KJB46607.1| hypothetical protein B456_007G377200 [Gossypium raimondii]
Length=740

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 152/186 (82%), Gaps = 7/186 (4%)
 Frame = +2

Query  191  ESPHFTSRRLVGFCLCSRSTMDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGA  370
             SP F S R         S MD+     A +K+VKR+VVKVGTAVVTR DGRLA+GR+GA
Sbjct  9    HSPIFHSVRNQAL-----SPMDT--DPAACIKNVKRLVVKVGTAVVTRHDGRLAVGRLGA  61

Query  371  LCEQIQELNSQGYEVILVTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQ  550
            LCEQ++ELNSQGYEV+LVTSGAVG GRQRLRYR+L++SS ADLQ PQ ELDGKACAAVGQ
Sbjct  62   LCEQLKELNSQGYEVVLVTSGAVGLGRQRLRYRKLVNSSLADLQNPQVELDGKACAAVGQ  121

Query  551  NGLMALYDSLFSQLDVTSAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAIS  730
            N LMALYD+LFSQLDVTS+Q LVTD+DFR+  FR QL+E V  LL+LKVIP+FNENDA+S
Sbjct  122  NSLMALYDTLFSQLDVTSSQHLVTDSDFRNDSFREQLSETVKSLLALKVIPVFNENDAVS  181

Query  731  TRRAPY  748
            TRR PY
Sbjct  182  TRRTPY  187



>ref|XP_004506632.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Cicer arietinum]
Length=755

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = +2

Query  233  LCSRSTMDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYE  412
            L     + ++D +R FV  VKR++VKVGTAVVTRSDGRLALGR+GALCEQ++ELN QGYE
Sbjct  33   LAETEDLSNMDPSRVFVNKVKRLIVKVGTAVVTRSDGRLALGRLGALCEQLKELNVQGYE  92

Query  413  VILVTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQL  592
            VILVTSGAVG GRQRLRYRRL +SSF+DLQKPQ +LDGKACAAVGQ+ LMALYD++FSQL
Sbjct  93   VILVTSGAVGLGRQRLRYRRLANSSFSDLQKPQGDLDGKACAAVGQSSLMALYDTMFSQL  152

Query  593  DVTSAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            DVTS+QLLV D  F+D  FR QL++ V+ LL L+VIPIFNENDA+STR+APY
Sbjct  153  DVTSSQLLVNDGFFKDAGFRKQLSDTVSSLLELRVIPIFNENDAVSTRKAPY  204



>ref|NP_001118846.1| delta 1-pyrroline-5-carboxylate synthase 2 [Arabidopsis thaliana]
 gb|AEE79409.1| delta 1-pyrroline-5-carboxylate synthase 2 [Arabidopsis thaliana]
Length=622

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MTEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTRRAPY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPY  166



>ref|XP_009139148.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase B-like [Brassica 
rapa]
 ref|XP_009139149.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase B-like [Brassica 
rapa]
Length=719

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D +RAF K+VKRIVVKVGTAVVT  DGRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MAETDRSRAFTKNVKRIVVKVGTAVVTGKDGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQNELDGKACAAVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD DFRD DFR QL+E V  ++ ++VIP+FNENDAISTR+APY
Sbjct  121  MLVTDKDFRDKDFRKQLSETVKAMMKMRVIPVFNENDAISTRKAPY  166



>emb|CDX76082.1| BnaA04g03460D [Brassica napus]
Length=716

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M   D +RAF K+VKRIVVKVGTAVVT  DGRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MAETDRSRAFTKNVKRIVVKVGTAVVTGKDGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACAAVGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQNELDGKACAAVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD DFRD DFR QL+E V  ++ ++VIP+FNENDAISTR+APY
Sbjct  121  MLVTDKDFRDKDFRKQLSETVKAMMKMRVIPVFNENDAISTRKAPY  166



>gb|AAL87255.1| putative delta-1-pyrroline 5-carboxylase synthetase P5C1 [Arabidopsis 
thaliana]
Length=717

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +R F +DVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRTFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>ref|NP_001147111.1| LOC100280719 [Zea mays]
 gb|ACG25484.1| delta 1-pyrroline-5-carboxylate synthetase [Zea mays]
Length=731

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  254  DSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSG  433
            ++ D  RAFVKDVKRI++KVGTAVVT  +GRLA+GR+G+LCEQ+++LN QGYEVILVTSG
Sbjct  17   ETADPARAFVKDVKRIIIKVGTAVVTGMNGRLAMGRLGSLCEQVKQLNFQGYEVILVTSG  76

Query  434  AVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQL  613
            AVG GRQRL+YR+LIHSSFADLQ PQ   DGKACAAVGQ+ LMA+YD+LFSQLDVTS+QL
Sbjct  77   AVGVGRQRLQYRKLIHSSFADLQNPQMNFDGKACAAVGQSVLMAIYDTLFSQLDVTSSQL  136

Query  614  LVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LVTD DF+DP F  QL E V  LL LKV+P+FNENDAISTRR PY
Sbjct  137  LVTDRDFKDPSFGDQLRETVFSLLDLKVVPLFNENDAISTRRQPY  181



>ref|XP_010534556.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase A-like [Tarenaya 
hassleriana]
Length=726

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAFV DVKRI+VKVGTAVVT   GRLALGR+GALCE++ ELN+ GYEVILV+S
Sbjct  1    MEEMDRSRAFVNDVKRIIVKVGTAVVTGKGGRLALGRLGALCEELAELNADGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQVELDGKACAGVGQSSLMAYYETMFEQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ FRD +FR QLNE V  LL LKVIP+FNENDA+STRRAPY
Sbjct  121  LLVTDSSFRDKEFRKQLNETVKSLLRLKVIPVFNENDALSTRRAPY  166



>gb|AAV67896.1| delta-1-pyrroline 5-carboxylase synthetase [Chorispora bungeana]
Length=726

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFGKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKEFRQQLNETVKPMLDLRVIPIFNENDAISTRRAPY  166



>ref|XP_008654886.1| PREDICTED: LOC100280719 isoform X1 [Zea mays]
 gb|AFW84589.1| delta 1-pyrroline-5-carboxylate synthetase isoform 1 [Zea mays]
 gb|AFW84590.1| delta 1-pyrroline-5-carboxylate synthetase isoform 2 [Zea mays]
Length=731

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  254  DSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSG  433
            ++ D  RAFVKDVKRI++KVGTAVVT  +GRLA+GR+G+LCEQ+++LN QGYEVILVTSG
Sbjct  17   ETADPARAFVKDVKRIIIKVGTAVVTGMNGRLAMGRLGSLCEQVKQLNFQGYEVILVTSG  76

Query  434  AVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQL  613
            AVG GRQRL+YR+LIHSSFADLQ PQ   DGKACAAVGQ+ LMA+YD+LFSQLDVTS+QL
Sbjct  77   AVGVGRQRLQYRKLIHSSFADLQNPQMNFDGKACAAVGQSVLMAIYDTLFSQLDVTSSQL  136

Query  614  LVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LVTD DF+DP F  QL E V  LL LKV+P+FNENDAISTRR PY
Sbjct  137  LVTDRDFKDPSFGDQLRETVFSLLDLKVVPLFNENDAISTRRQPY  181



>gb|KEH29008.1| delta-1-pyrroline-5-carboxylate synthetase [Medicago truncatula]
Length=697

 Score =   260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            + ++D +RAFV  VKR++VKVGTAVVTRSDGRLALGR+GALCEQ+++LN QGYEVILVTS
Sbjct  41   LSNMDPSRAFVNKVKRLIVKVGTAVVTRSDGRLALGRLGALCEQLKDLNLQGYEVILVTS  100

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L +SSF+DLQKPQ +LDGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  101  GAVGLGRQRLRYRKLANSSFSDLQKPQGDLDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  160

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D  FRD  FR QL++ +  LL  KVIPIFNENDA+STR+APY
Sbjct  161  LLVNDGFFRDSGFRKQLSDTITSLLESKVIPIFNENDAVSTRKAPY  206



>ref|XP_011651883.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Cucumis sativus]
 gb|KGN58838.1| hypothetical protein Csa_3G733920 [Cucumis sativus]
Length=714

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +R F K+ +RIVVKVGTAVVTR DGRLALGR+GALCEQ++ELNS+GYEVILVTSGAV
Sbjct  1    MDPSRVFTKNARRIVVKVGTAVVTRGDGRLALGRLGALCEQLKELNSRGYEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL +SSFADLQ PQ + DGKACAAVGQ+ LMALYD++FSQLDVTS+QLLV
Sbjct  61   GLGRQRLRYRRLANSSFADLQNPQGDFDGKACAAVGQSSLMALYDTMFSQLDVTSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+ F D  FR QL+E VN LL L+VIPIFNENDA+STR+ PY
Sbjct  121  TDSVFSDTGFRQQLSETVNALLDLRVIPIFNENDAVSTRKTPY  163



>gb|AIF76243.1| delta1-pyrroline-5-carboxylate synthetase 1 [Brassica napus]
Length=715

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+  D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILVTS
Sbjct  1    MEETDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVTS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR++I+SSFADL+KPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQMINSSFADLRKPQSELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QL+E V  +L L VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLSETVKSMLDLSVIPIFNENDAISTRRAPY  166



>ref|XP_006403440.1| hypothetical protein EUTSA_v10010150mg [Eutrema salsugineum]
 gb|ESQ44893.1| hypothetical protein EUTSA_v10010150mg [Eutrema salsugineum]
Length=578

 Score =   257 bits (657),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MAEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQ+PQ ELDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQRPQTELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTR+APY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVRAMLKMRVIPVFNENDAISTRKAPY  166



>ref|XP_010067457.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X2 
[Eucalyptus grandis]
Length=724

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 8/164 (5%)
 Frame = +2

Query  257  SVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGA  436
            S+DSTRAF+ DVKR+V+KVGTAVVTRSDGRLALGR+GALCEQI+ELN QG+EVILVTSGA
Sbjct  19   SMDSTRAFIGDVKRLVIKVGTAVVTRSDGRLALGRLGALCEQIKELNLQGFEVILVTSGA  78

Query  437  VGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLL  616
            VG GRQRL        SFADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTSAQLL
Sbjct  79   VGLGRQRL--------SFADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSAQLL  130

Query  617  VTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            VTD+DF+  +FR QL+E V  LLSL V+PIFNENDA+STR+APY
Sbjct  131  VTDHDFKSIEFRKQLSETVQSLLSLTVVPIFNENDAVSTRKAPY  174



>ref|XP_010508967.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase A-like [Camelina 
sativa]
Length=717

 Score =   260 bits (665),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF +DVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LM+ Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMSYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKEFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>ref|XP_010517343.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase A [Camelina 
sativa]
Length=717

 Score =   260 bits (665),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF +DVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LM+ Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMSYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKEFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>ref|XP_010505668.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase A-like isoform 
X1 [Camelina sativa]
Length=717

 Score =   260 bits (664),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF +DVKRIVVKVGTAVVT   GRLALGR+GALCEQ+ ELNS G+EVILV+S
Sbjct  1    MEELDRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LM+ Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMSYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD +FR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKEFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>ref|XP_010931202.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X10 [Elaeis guineensis]
Length=581

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDVKR+++KVGTAVVTR+DGRLALGR+GALCEQ++ELNS+G+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVKRVIIKVGTAVVTRTDGRLALGRLGALCEQVKELNSRGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAA GQ+GLMALYD+LFSQLDV S+QLLV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAAGQSGLMALYDALFSQLDVASSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD++F+ PDFR QL + VN L++L+VIP+FNENDAISTR+APY
Sbjct  121  TDSEFKHPDFRMQLIQTVNSLIALRVIPVFNENDAISTRKAPY  163



>ref|XP_006290649.1| hypothetical protein CARUB_v10016741mg [Capsella rubella]
 gb|EOA23547.1| hypothetical protein CARUB_v10016741mg [Capsella rubella]
Length=726

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MTEIDPSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTRRAPY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPY  166



>ref|NP_191120.2| delta 1-pyrroline-5-carboxylate synthase 2 [Arabidopsis thaliana]
 sp|P54888.1|P5CS2_ARATH RecName: Full=Delta-1-pyrroline-5-carboxylate synthase B; Short=P5CS 
B; Includes: RecName: Full=Glutamate 5-kinase; Short=GK; 
AltName: Full=Gamma-glutamyl kinase; Includes: RecName: 
Full=Gamma-glutamyl phosphate reductase; Short=GPR; AltName: 
Full=Glutamate-5-semialdehyde dehydrogenase; AltName: Full=Glutamyl-gamma-semialdehyde 
dehydrogenase [Arabidopsis thaliana]
 emb|CAA60447.1| pyrroline-5-carboxylate synthetase B [Arabidopsis thaliana]
 emb|CAA70527.1| pyrroline-5-carboxlyate synthetase [Arabidopsis thaliana]
 gb|AAM10314.1| AT3g55610/F1I16_20 [Arabidopsis thaliana]
 gb|AEE79408.1| delta 1-pyrroline-5-carboxylate synthase 2 [Arabidopsis thaliana]
Length=726

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MTEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTRRAPY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPY  166



>emb|CAB81586.1| delta-1-pyrroline-5-carboxylate synthetase [Arabidopsis thaliana]
Length=726

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MTEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTRRAPY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPY  166



>gb|KEH29007.1| delta-1-pyrroline-5-carboxylate synthetase [Medicago truncatula]
Length=737

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            + ++D +RAFV  VKR++VKVGTAVVTRSDGRLALGR+GALCEQ+++LN QGYEVILVTS
Sbjct  41   LSNMDPSRAFVNKVKRLIVKVGTAVVTRSDGRLALGRLGALCEQLKDLNLQGYEVILVTS  100

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L +SSF+DLQKPQ +LDGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  101  GAVGLGRQRLRYRKLANSSFSDLQKPQGDLDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  160

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D  FRD  FR QL++ +  LL  KVIPIFNENDA+STR+APY
Sbjct  161  LLVNDGFFRDSGFRKQLSDTITSLLESKVIPIFNENDAVSTRKAPY  206



>gb|AET35478.1| delta-1-pyrroline-5-carboxylate synthetase 3 [Medicago truncatula]
 gb|KEH29009.1| delta-1-pyrroline-5-carboxylate synthetase [Medicago truncatula]
Length=756

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            + ++D +RAFV  VKR++VKVGTAVVTRSDGRLALGR+GALCEQ+++LN QGYEVILVTS
Sbjct  41   LSNMDPSRAFVNKVKRLIVKVGTAVVTRSDGRLALGRLGALCEQLKDLNLQGYEVILVTS  100

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L +SSF+DLQKPQ +LDGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  101  GAVGLGRQRLRYRKLANSSFSDLQKPQGDLDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  160

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D  FRD  FR QL++ +  LL  KVIPIFNENDA+STR+APY
Sbjct  161  LLVNDGFFRDSGFRKQLSDTITSLLESKVIPIFNENDAVSTRKAPY  206



>gb|KEH29006.1| delta-1-pyrroline-5-carboxylate synthetase [Medicago truncatula]
Length=760

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            + ++D +RAFV  VKR++VKVGTAVVTRSDGRLALGR+GALCEQ+++LN QGYEVILVTS
Sbjct  41   LSNMDPSRAFVNKVKRLIVKVGTAVVTRSDGRLALGRLGALCEQLKDLNLQGYEVILVTS  100

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L +SSF+DLQKPQ +LDGKACAAVGQ+ LMALYD++FSQLDVTS+Q
Sbjct  101  GAVGLGRQRLRYRKLANSSFSDLQKPQGDLDGKACAAVGQSSLMALYDTMFSQLDVTSSQ  160

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D  FRD  FR QL++ +  LL  KVIPIFNENDA+STR+APY
Sbjct  161  LLVNDGFFRDSGFRKQLSDTITSLLESKVIPIFNENDAVSTRKAPY  206



>ref|XP_002878042.1| delta 1-pyrroline-5-carboxylate synthase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54301.1| delta 1-pyrroline-5-carboxylate synthase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=726

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MTEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTRRAPY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPY  166



>gb|ACU65226.1| delta 1-pyrroline-5-carboxylate synthetase 1 [Sorghum bicolor]
Length=729

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M++ DS RAFVKDVKRI++KVGTAVVT  +GRLA+G +G+LCEQ+++LN QGYEVILVTS
Sbjct  14   MENADSARAFVKDVKRIIIKVGTAVVTGQNGRLAMGGLGSLCEQVKQLNFQGYEVILVTS  73

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRL+YR+LIHSSFADLQ PQ   DGKACAAVGQ+GLMA+ D+LFSQLDVTS+Q
Sbjct  74   GAVGVGRQRLQYRKLIHSSFADLQNPQMNFDGKACAAVGQSGLMAICDTLFSQLDVTSSQ  133

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRR  739
            LLVTD DFRDP F  QL E V  LL+LKVIP+FNENDAISTRR
Sbjct  134  LLVTDRDFRDPSFGDQLRETVFALLNLKVIPLFNENDAISTRR  176



>gb|AET35479.1| delta-1-pyrroline-5-carboxylate synthetase 3 variant a [Medicago 
truncatula]
 gb|KEH29005.1| delta-1-pyrroline-5-carboxylate synthetase [Medicago truncatula]
Length=713

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFV  V R++VKVGTAVVTRSDGRLALGR+GALCEQ+++LN QGYEVILVTSGAV
Sbjct  1    MDPTRAFVTSVNRVIVKVGTAVVTRSDGRLALGRLGALCEQLKDLNLQGYEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYR+L +SSF+DLQKPQ +LDGKACAAVGQ+ LMALYD++FSQLDVTS+QLLV
Sbjct  61   GLGRQRLRYRKLANSSFSDLQKPQGDLDGKACAAVGQSSLMALYDTMFSQLDVTSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
             D  FRD  FR QL++ +  LL  KVIPIFNENDA+STR+APY
Sbjct  121  NDGFFRDSGFRKQLSDTITSLLESKVIPIFNENDAVSTRKAPY  163



>gb|AAK01361.1|AF314812_1 delta 1-pyrroline-5-carboxylate synthetase B [Brassica napus]
 emb|CDY40241.1| BnaA09g35230D [Brassica napus]
Length=727

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  254  DSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSG  433
            D +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+SG
Sbjct  3    DEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSSG  62

Query  434  AVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQL  613
            AVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F Q+DVT AQ+
Sbjct  63   AVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQMDVTVAQM  122

Query  614  LVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTR+APY
Sbjct  123  LVTDSSFRDKDFRKQLSETVKAMLKMRVIPVFNENDAISTRKAPY  167



>ref|XP_009116262.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase B [Brassica 
rapa]
Length=727

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  254  DSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSG  433
            D +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+SG
Sbjct  3    DEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSSG  62

Query  434  AVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQL  613
            AVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F Q+DVT AQ+
Sbjct  63   AVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQMDVTVAQM  122

Query  614  LVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTR+APY
Sbjct  123  LVTDSSFRDKDFRKQLSETVKAMLKMRVIPVFNENDAISTRKAPY  167



>ref|XP_010554640.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase A [Tarenaya 
hassleriana]
Length=717

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D TRAFV DVKRIVVKVGTAVVT   GRLALGR+GALCE++  LN+ GYEVILV+S
Sbjct  1    MAHMDRTRAFVDDVKRIVVKVGTAVVTGKGGRLALGRLGALCEELAGLNADGYEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA ++++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQEELDGKACAGVGQSSLMAYFETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+ FRD +FR QLNE V  +  LKVIPIFNENDAISTRRAPY
Sbjct  121  LLVTDSSFRDKEFRKQLNETVQSMFRLKVIPIFNENDAISTRRAPY  166



>ref|XP_008785507.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X2 
[Phoenix dactylifera]
Length=703

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDV+RI++KVGTAVVTR+DGRLALGR+GALCEQ++EL SQG+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVRRIIIKVGTAVVTRTDGRLALGRLGALCEQVKELISQGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAA GQ+GLMALYD LFSQLDVTS++LLV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAAGQSGLMALYDCLFSQLDVTSSELLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DF++PDFR QL++ VN LL L+VIPIFNENDAISTR+APY
Sbjct  121  TDSDFKNPDFRMQLSQTVNSLLDLRVIPIFNENDAISTRKAPY  163



>gb|KDO48131.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis]
Length=643

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS DS+RAFVKDVKR+VVKVGTAVVTRSDGRLALGR+GAL EQ++ELNSQG+E+ILV+S
Sbjct  1    MDSTDSSRAFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SS ADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL + V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPY  166



>ref|XP_008785506.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X1 
[Phoenix dactylifera]
Length=713

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDV+RI++KVGTAVVTR+DGRLALGR+GALCEQ++EL SQG+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVRRIIIKVGTAVVTRTDGRLALGRLGALCEQVKELISQGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAA GQ+GLMALYD LFSQLDVTS++LLV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAAGQSGLMALYDCLFSQLDVTSSELLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DF++PDFR QL++ VN LL L+VIPIFNENDAISTR+APY
Sbjct  121  TDSDFKNPDFRMQLSQTVNSLLDLRVIPIFNENDAISTRKAPY  163



>ref|XP_006429189.1| hypothetical protein CICLE_v10011176mg [Citrus clementina]
 gb|ESR42429.1| hypothetical protein CICLE_v10011176mg [Citrus clementina]
Length=643

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS DS+RAFVKDVKR+VVKVGTAVVTRSDGRLALGR+GAL EQ++ELNSQG+E+ILV+S
Sbjct  1    MDSTDSSRAFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SS ADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL + V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPY  166



>ref|XP_010931197.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X7 [Elaeis guineensis]
Length=650

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDVKR+++KVGTAVVTR+DGRLALGR+GALCEQ++ELNS+G+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVKRVIIKVGTAVVTRTDGRLALGRLGALCEQVKELNSRGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAA GQ+GLMALYD+LFSQLDV S+QLLV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAAGQSGLMALYDALFSQLDVASSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD++F+ PDFR QL + VN L++L+VIP+FNENDAISTR+APY
Sbjct  121  TDSEFKHPDFRMQLIQTVNSLIALRVIPVFNENDAISTRKAPY  163



>ref|XP_010931199.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X8 [Elaeis guineensis]
Length=645

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDVKR+++KVGTAVVTR+DGRLALGR+GALCEQ++ELNS+G+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVKRVIIKVGTAVVTRTDGRLALGRLGALCEQVKELNSRGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAA GQ+GLMALYD+LFSQLDV S+QLLV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAAGQSGLMALYDALFSQLDVASSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD++F+ PDFR QL + VN L++L+VIP+FNENDAISTR+APY
Sbjct  121  TDSEFKHPDFRMQLIQTVNSLIALRVIPVFNENDAISTRKAPY  163



>emb|CDY41203.1| BnaC08g26550D [Brassica napus]
Length=727

 Score =   258 bits (658),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  254  DSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSG  433
            + +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+SG
Sbjct  3    EEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSSG  62

Query  434  AVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQL  613
            AVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F Q+DVT AQ+
Sbjct  63   AVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQMDVTVAQM  122

Query  614  LVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTR+APY
Sbjct  123  LVTDSSFRDKDFRKQLSETVKAMLKMRVIPVFNENDAISTRKAPY  167



>ref|XP_010931195.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X5 [Elaeis guineensis]
 ref|XP_010931196.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X6 [Elaeis guineensis]
Length=666

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDVKR+++KVGTAVVTR+DGRLALGR+GALCEQ++ELNS+G+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVKRVIIKVGTAVVTRTDGRLALGRLGALCEQVKELNSRGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAA GQ+GLMALYD+LFSQLDV S+QLLV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAAGQSGLMALYDALFSQLDVASSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD++F+ PDFR QL + VN L++L+VIP+FNENDAISTR+APY
Sbjct  121  TDSEFKHPDFRMQLIQTVNSLIALRVIPVFNENDAISTRKAPY  163



>ref|XP_010931193.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X4 [Elaeis guineensis]
 ref|XP_010931194.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X4 [Elaeis guineensis]
Length=676

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDVKR+++KVGTAVVTR+DGRLALGR+GALCEQ++ELNS+G+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVKRVIIKVGTAVVTRTDGRLALGRLGALCEQVKELNSRGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAA GQ+GLMALYD+LFSQLDV S+QLLV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAAGQSGLMALYDALFSQLDVASSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD++F+ PDFR QL + VN L++L+VIP+FNENDAISTR+APY
Sbjct  121  TDSEFKHPDFRMQLIQTVNSLIALRVIPVFNENDAISTRKAPY  163



>gb|KFK35118.1| hypothetical protein AALP_AA5G238400 [Arabis alpina]
Length=726

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF KDV+RIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MEEIDRSRAFSKDVRRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQIELDGKACAGVGQSSLMAYYEAMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD++F+D DFR QL+E V  +L ++VIPIFNENDAISTR+APY
Sbjct  121  MLVTDSNFKDKDFRKQLSETVKAMLKMRVIPIFNENDAISTRKAPY  166



>ref|XP_007140469.1| hypothetical protein PHAVU_008G115100g [Phaseolus vulgaris]
 gb|ESW12463.1| hypothetical protein PHAVU_008G115100g [Phaseolus vulgaris]
Length=720

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVK VKR++VKVGTAVVTRSDGRLALGR+GALCEQ++ELN + YEVILVTSGAV
Sbjct  1    MDPTRAFVKSVKRVIVKVGTAVVTRSDGRLALGRLGALCEQLKELNDKDYEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSF+DLQ PQ +LDGKACAAVGQ+ LMALYD +FSQLDVTS+QLLV
Sbjct  61   GLGRQRLRYRRLVNSSFSDLQNPQGDLDGKACAAVGQSSLMALYDIMFSQLDVTSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
             D  FRD  FR QL++ V+ LL L++IPIFNENDA+STR+A Y
Sbjct  121  NDGFFRDTAFRKQLSDTVSALLDLRIIPIFNENDAVSTRKASY  163



>ref|XP_010931192.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X3 [Elaeis guineensis]
Length=696

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDVKR+++KVGTAVVTR+DGRLALGR+GALCEQ++ELNS+G+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVKRVIIKVGTAVVTRTDGRLALGRLGALCEQVKELNSRGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAA GQ+GLMALYD+LFSQLDV S+QLLV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAAGQSGLMALYDALFSQLDVASSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD++F+ PDFR QL + VN L++L+VIP+FNENDAISTR+APY
Sbjct  121  TDSEFKHPDFRMQLIQTVNSLIALRVIPVFNENDAISTRKAPY  163



>ref|XP_006403442.1| hypothetical protein EUTSA_v10010150mg [Eutrema salsugineum]
 gb|ESQ44895.1| hypothetical protein EUTSA_v10010150mg [Eutrema salsugineum]
Length=733

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +RAF KDVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MAEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQ+PQ ELDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQRPQTELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +L ++VIP+FNENDAISTR+APY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVRAMLKMRVIPVFNENDAISTRKAPY  166



>dbj|BAA06864.1| delta1-pyrroline-5-carboxylate synthetase [Arabidopsis thaliana]
Length=717

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M+ +D +RAF +DVKRIVVKVGTAVVT   GRLALGR+GAL EQ+ ELNS G++VILV+S
Sbjct  1    MEELDRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALFEQLAELNSDGFKVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ ELDGKACA VGQ+ LMA Y+++F QLDVT+AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLV D+ FRD DFR QLNE V  +L L+VIPIFNENDAISTRRAPY
Sbjct  121  LLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPY  166



>ref|XP_001756289.1| predicted protein [Physcomitrella patens]
 gb|EDQ78685.1| predicted protein [Physcomitrella patens]
Length=748

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 146/166 (88%), Gaps = 3/166 (2%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D +R F++D KR+V+K+GTAVVTR DGRLALGR+GA+CEQ++EL + G EVI VTSGAV
Sbjct  1    MDRSRIFIRDAKRVVIKIGTAVVTRHDGRLALGRLGAICEQVKELITDGIEVIFVTSGAV  60

Query  440  GAGRQRLRYRRLIHSS---FADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            G GRQ+LR++R+++S    F DLQKPQ ELDGK CAAVGQ+GLMALYDSLFSQLDV S+Q
Sbjct  61   GVGRQKLRHQRMMNSRRVIFVDLQKPQVELDGKPCAAVGQSGLMALYDSLFSQLDVASSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTDNDF+DP+FR QL+E VN LL+L+V+PIFNENDAISTR++PY
Sbjct  121  LLVTDNDFKDPEFRQQLSETVNSLLALRVVPIFNENDAISTRKSPY  166



>ref|XP_010931190.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010931191.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Elaeis guineensis]
Length=712

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDVKR+++KVGTAVVTR+DGRLALGR+GALCEQ++ELNS+G+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVKRVIIKVGTAVVTRTDGRLALGRLGALCEQVKELNSRGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAA GQ+GLMALYD+LFSQLDV S+QLLV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAAGQSGLMALYDALFSQLDVASSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD++F+ PDFR QL + VN L++L+VIP+FNENDAISTR+APY
Sbjct  121  TDSEFKHPDFRMQLIQTVNSLIALRVIPVFNENDAISTRKAPY  163



>ref|XP_006429184.1| hypothetical protein CICLE_v10011176mg [Citrus clementina]
 ref|XP_006429185.1| hypothetical protein CICLE_v10011176mg [Citrus clementina]
 ref|XP_006493585.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Citrus sinensis]
 ref|XP_006493586.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X3 [Citrus sinensis]
 ref|XP_006493587.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X4 [Citrus sinensis]
 gb|ESR42424.1| hypothetical protein CICLE_v10011176mg [Citrus clementina]
 gb|ESR42425.1| hypothetical protein CICLE_v10011176mg [Citrus clementina]
Length=715

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS DS+RAFVKDVKR+VVKVGTAVVTRSDGRLALGR+GAL EQ++ELNSQG+E+ILV+S
Sbjct  1    MDSTDSSRAFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SS ADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL + V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPY  166



>gb|KDO48127.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis]
 gb|KDO48128.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis]
 gb|KDO48129.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis]
 gb|KDO48130.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis]
Length=715

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS DS+RAFVKDVKR+VVKVGTAVVTRSDGRLALGR+GAL EQ++ELNSQG+E+ILV+S
Sbjct  1    MDSTDSSRAFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SS ADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL + V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPY  166



>gb|KDO48126.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis]
Length=716

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS DS+RAFVKDVKR+VVKVGTAVVTRSDGRLALGR+GAL EQ++ELNSQG+E+ILV+S
Sbjct  1    MDSTDSSRAFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SS ADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL + V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPY  166



>ref|XP_006429187.1| hypothetical protein CICLE_v10011176mg [Citrus clementina]
 gb|ESR42427.1| hypothetical protein CICLE_v10011176mg [Citrus clementina]
Length=718

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS DS+RAFVKDVKR+VVKVGTAVVTRSDGRLALGR+GAL EQ++ELNSQG+E+ILV+S
Sbjct  1    MDSTDSSRAFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SS ADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL + V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPY  166



>gb|KDO48125.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis]
Length=738

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            MDS DS+RAFVKDVKR+VVKVGTAVVTRSDGRLALGR+GAL EQ++ELNSQG+E+ILV+S
Sbjct  1    MDSTDSSRAFVKDVKRLVVKVGTAVVTRSDGRLALGRLGALLEQLKELNSQGFEIILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SS ADLQKPQ ELDGKACAAVGQ+ LMALYD+LFSQLDVTS+Q
Sbjct  61   GAVGVGRQRLRYRKLVNSSLADLQKPQNELDGKACAAVGQSSLMALYDTLFSQLDVTSSQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            LLVTD+DFRD DFR QL + V  LL L+VIPIFNENDA+STR+APY
Sbjct  121  LLVTDSDFRDEDFRKQLYDTVQSLLDLRVIPIFNENDAVSTRKAPY  166



>ref|XP_010088578.1| Delta-1-pyrroline-5-carboxylate synthase [Morus notabilis]
 gb|EXB36719.1| Delta-1-pyrroline-5-carboxylate synthase [Morus notabilis]
Length=710

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 3/168 (2%)
 Frame = +2

Query  251  MDS--VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILV  424
            MDS  +D TRAFVK VKR+VVKVGTAVVTRSDGRLALGR+GALCEQ++ELNSQGYEVILV
Sbjct  1    MDSTTMDPTRAFVKSVKRLVVKVGTAVVTRSDGRLALGRLGALCEQLKELNSQGYEVILV  60

Query  425  TSGAVGAGRQRLRYRRLIHSSFADLQKPQREL-DGKACAAVGQNGLMALYDSLFSQLDVT  601
            +SGAVG GRQRLRYRRL ++SFADLQ  Q    DGKACA+VGQ  LMALYD++FSQLDVT
Sbjct  61   SSGAVGLGRQRLRYRRLANASFADLQYIQDNFEDGKACASVGQGSLMALYDTMFSQLDVT  120

Query  602  SAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAP  745
            S+QLLVTD  F D  FR QL++ VN LLSL+VIPIFNENDA+STRR P
Sbjct  121  SSQLLVTDGVFMDQAFRRQLSDTVNSLLSLRVIPIFNENDAVSTRREP  168



>sp|O65361.1|P5CS_MESCR RecName: Full=Delta-1-pyrroline-5-carboxylate synthase; Short=P5CS; 
Includes: RecName: Full=Glutamate 5-kinase; Short=GK; 
AltName: Full=Gamma-glutamyl kinase; Includes: RecName: Full=Gamma-glutamyl 
phosphate reductase; Short=GPR; AltName: Full=Glutamate-5-semialdehyde 
dehydrogenase; AltName: Full=Glutamyl-gamma-semialdehyde 
dehydrogenase [Mesembryanthemum crystallinum]
 gb|AAC18862.1| pyrroline-5-carboxylate synthetase [Mesembryanthemum crystallinum]
Length=719

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D+TRAFVKDVKR+VVKVGTAVVTRSDGRLALGR+G+LCEQ++ELNS GYEVILVTSGAV
Sbjct  1    MDATRAFVKDVKRVVVKVGTAVVTRSDGRLALGRLGSLCEQLKELNSDGYEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
             AGRQRLR+R+L++SSFADLQKPQ ELDGKACAAVGQNGLMALYD+LFSQLD+T+AQLLV
Sbjct  61   SAGRQRLRFRKLVNSSFADLQKPQVELDGKACAAVGQNGLMALYDTLFSQLDLTAAQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TDNDFRDP FR+QL E V QLL LKV+P+ NENDA+STR+APY
Sbjct  121  TDNDFRDPSFRTQLTETVYQLLDLKVVPVLNENDAVSTRKAPY  163



>ref|XP_008777668.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X1 [Phoenix dactylifera]
Length=712

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFVKDVKR+++KVGTAVVTR++GRLALGR+GALCEQ++ELNSQG+EVILVTSGAV
Sbjct  1    MDPTRAFVKDVKRVIIKVGTAVVTRTEGRLALGRLGALCEQVKELNSQGFEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYRRL++SSFADLQKPQ ELDGKACAAVGQ+GLMALYD LFS LDV S+Q LV
Sbjct  61   GVGRQRLRYRRLLNSSFADLQKPQLELDGKACAAVGQSGLMALYDCLFSLLDVPSSQFLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            TD+DF+ PDFR QL + VN LL+L+VIP+FNENDAIS+R+APY
Sbjct  121  TDSDFKHPDFRMQLIQTVNSLLALRVIPVFNENDAISSRKAPY  163



>ref|XP_010427346.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase B-like [Camelina 
sativa]
Length=726

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +R F +DVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MTEIDPSRVFARDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ +LDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQMDLDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +  ++VIP+FNENDAISTRRAPY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVKAMFRMRVIPVFNENDAISTRRAPY  166



>ref|XP_010504420.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase B [Camelina 
sativa]
Length=726

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +R F +DVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MTEIDPSRVFARDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ +LDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQMDLDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +  ++VIP+FNENDAISTRRAPY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVKAMFRMRVIPVFNENDAISTRRAPY  166



>gb|AAW82442.1| pyrroline-5-carboxylate synthetase, partial [Solanum lycopersicum]
Length=131

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +2

Query  314  GTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVGAGRQRLRYRRLIHSSFA  493
            GTAVV R+DGRLALGR+GALCEQ+QELNSQGYEVILVTSGAVG GRQ+LRYR+L++SSF 
Sbjct  1    GTAVVARADGRLALGRLGALCEQLQELNSQGYEVILVTSGAVGVGRQQLRYRKLLNSSFL  60

Query  494  DLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVTDNDFRDPDFRSQLNEAV  673
            DLQKPQ ELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ LVTDNDFRDPDFR QLN+ V
Sbjct  61   DLQKPQTELDGKACAAVGQNGLMALYDSLFSQLDVTSAQPLVTDNDFRDPDFRRQLNDTV  120

Query  674  NQLLSLKVIPI  706
            N LLSLKVIPI
Sbjct  121  NSLLSLKVIPI  131



>ref|XP_010516141.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase B-like [Camelina 
sativa]
Length=726

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTS  430
            M  +D +R F +DVKRIVVKVGTAVVT   GRLALGR+GA+CEQ+ ELNS G+EVILV+S
Sbjct  1    MTEIDPSRLFARDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS  60

Query  431  GAVGAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQ  610
            GAVG GRQRLRYR+L++SSFADLQKPQ +LDGKACA VGQ+ LMA Y+++F QLDVT AQ
Sbjct  61   GAVGLGRQRLRYRQLVNSSFADLQKPQMDLDGKACAGVGQSSLMAYYETMFDQLDVTVAQ  120

Query  611  LLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
            +LVTD+ FRD DFR QL+E V  +  ++VIP+FNENDAISTRRAPY
Sbjct  121  MLVTDSSFRDKDFRKQLSETVKAMFRMRVIPVFNENDAISTRRAPY  166



>ref|XP_006573308.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X2 [Glycine max]
Length=714

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  260  VDSTRAFVKDVKRIVVKVGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAV  439
            +D TRAFV  VKR+VVKVGTAVVTRSDGRLALGR+GALCEQ++EL+SQGYEVILVTSGAV
Sbjct  1    MDPTRAFVNSVKRVVVKVGTAVVTRSDGRLALGRIGALCEQLKELSSQGYEVILVTSGAV  60

Query  440  GAGRQRLRYRRLIHSSFADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLV  619
            G GRQRLRYR+L +SSF+DLQKPQ ELDGKACAAVGQ+ LMALYD++FSQLDVTS+QLLV
Sbjct  61   GLGRQRLRYRKLANSSFSDLQKPQEELDGKACAAVGQSSLMALYDTMFSQLDVTSSQLLV  120

Query  620  TDNDFRDPDFRSQLNEAVNQLLSLKVIPIFNENDAISTRRAPY  748
             D  FRD  FR QL++ VN LL L+VIPIFNENDA+STR+APY
Sbjct  121  NDGFFRDSGFRKQLSDTVNSLLDLRVIPIFNENDAVSTRKAPY  163



>gb|AEP83831.1| delta 1-pyrroline-5-carboxylate synthetase, partial [Nicotiana 
benthamiana]
Length=131

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  314  GTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVGAGRQRLRYRRLIHSSFA  493
            GTAVVTR DGRLALGRMG+LCEQI+EL +QG+EVILVTSGAVG GRQRLRYR+LI+SSFA
Sbjct  1    GTAVVTRGDGRLALGRMGSLCEQIRELTTQGFEVILVTSGAVGVGRQRLRYRKLINSSFA  60

Query  494  DLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVTDNDFRDPDFRSQLNEAV  673
            DLQKPQ +L+GKACAAVGQNGLMA YD+LF QLDVTSAQL+VTDNDFRDPDFR QLNE V
Sbjct  61   DLQKPQGDLNGKACAAVGQNGLMAPYDTLFGQLDVTSAQLMVTDNDFRDPDFRRQLNETV  120

Query  674  NQLLSLKVIPI  706
            N LLSLKV+PI
Sbjct  121  NSLLSLKVVPI  131



>gb|AFW78229.1| hypothetical protein ZEAMMB73_284633, partial [Zea mays]
Length=545

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 145/194 (75%), Gaps = 28/194 (14%)
 Frame = +2

Query  251  MDSVDSTRAFVKDVKRIVVK----------------------------VGTAVVTRSDGR  346
            M + D +R F+KDVKR+++K                            VGTAVVTR DGR
Sbjct  1    MATADQSRIFMKDVKRVIIKLGNPIPIYGIERVREKEGIERAERAREKVGTAVVTRHDGR  60

Query  347  LALGRMGALCEQIQELNSQGYEVILVTSGAVGAGRQRLRYRRLIHSSFADLQKPQRELDG  526
            ++ G  G LCEQ++E+N+ GYEVI+V+SGAVG G+QRL YR+L++SSFAD+QKPQ ELDG
Sbjct  61   VSTGNFGVLCEQVKEINALGYEVIIVSSGAVGVGKQRLNYRKLVNSSFADMQKPQTELDG  120

Query  527  KACAAVGQNGLMALYDSLFSQLDVTSAQLLVTDNDFRDPDFRSQLNEAVNQLLSLKVIPI  706
            KACAAVGQ+GLMALYD LF+QLDV+S+QLLVTD+DF +P+FR +L E V  LL LKV+PI
Sbjct  121  KACAAVGQSGLMALYDMLFTQLDVSSSQLLVTDSDFENPNFRERLRETVESLLDLKVVPI  180

Query  707  FNENDAISTRRAPY  748
            FNENDAISTR+APY
Sbjct  181  FNENDAISTRKAPY  194



>ref|XP_006573310.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 
X4 [Glycine max]
Length=698

 Score =   246 bits (629),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +2

Query  311  VGTAVVTRSDGRLALGRMGALCEQIQELNSQGYEVILVTSGAVGAGRQRLRYRRLIHSSF  490
            VGTAVVTRSDGRLALGR+GALCEQ++EL+SQGYEVILVTSGAVG GRQRLRYR+L +SSF
Sbjct  2    VGTAVVTRSDGRLALGRIGALCEQLKELSSQGYEVILVTSGAVGLGRQRLRYRKLANSSF  61

Query  491  ADLQKPQRELDGKACAAVGQNGLMALYDSLFSQLDVTSAQLLVTDNDFRDPDFRSQLNEA  670
            +DLQKPQ ELDGKACAAVGQ+ LMALYD++FSQLDVTS+QLLV D  FRD  FR QL++ 
Sbjct  62   SDLQKPQEELDGKACAAVGQSSLMALYDTMFSQLDVTSSQLLVNDGFFRDSGFRKQLSDT  121

Query  671  VNQLLSLKVIPIFNENDAISTRRAPY  748
            VN LL L+VIPIFNENDA+STR+APY
Sbjct  122  VNSLLDLRVIPIFNENDAVSTRKAPY  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427800438025