BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1871

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_012090968.1|  PREDICTED: protein LURP-one-related 8              208   9e-64   Jatropha curcas
ref|XP_010938083.1|  PREDICTED: protein LURP-one-related 8-like         207   3e-63   Elaeis guineensis
ref|XP_009792809.1|  PREDICTED: protein LURP-one-related 8              205   2e-62   Nicotiana sylvestris
ref|XP_009605860.1|  PREDICTED: protein LURP-one-related 8              202   5e-61   Nicotiana tomentosiformis
ref|XP_008782728.1|  PREDICTED: protein LURP-one-related 8-like         198   8e-60   Phoenix dactylifera
ref|XP_011018917.1|  PREDICTED: protein LURP-one-related 8              197   2e-59   Populus euphratica
ref|XP_006381286.1|  hypothetical protein POPTR_0006s11410g             197   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_010278908.1|  PREDICTED: protein LURP-one-related 8-like         197   3e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010921247.1|  PREDICTED: protein LURP-one-related 8-like i...    196   7e-59   Elaeis guineensis
ref|XP_007207350.1|  hypothetical protein PRUPE_ppa011092mg             195   1e-58   Prunus persica
ref|XP_002519976.1|  GTP binding protein, putative                      194   2e-58   Ricinus communis
ref|XP_008365623.1|  PREDICTED: protein LURP-one-related 8-like         194   4e-58   
ref|XP_002269188.1|  PREDICTED: protein LURP-one-related 8              193   5e-58   Vitis vinifera
ref|XP_009337833.1|  PREDICTED: protein LURP-one-related 8-like         193   8e-58   Pyrus x bretschneideri [bai li]
ref|XP_008793393.1|  PREDICTED: protein LURP-one-related 8-like         192   1e-57   Phoenix dactylifera
ref|XP_011006230.1|  PREDICTED: protein LURP-one-related 8-like         192   1e-57   Populus euphratica
ref|XP_008244281.1|  PREDICTED: protein LURP-one-related 8              192   3e-57   Prunus mume [ume]
ref|XP_008804638.1|  PREDICTED: protein LURP-one-related 8-like         190   6e-57   Phoenix dactylifera
ref|XP_008370309.1|  PREDICTED: protein LURP-one-related 8              190   1e-56   
ref|XP_002323697.2|  hypothetical protein POPTR_0016s14960g             190   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_002266077.1|  PREDICTED: protein LURP-one-related 8              188   4e-56   Vitis vinifera
ref|XP_004302498.1|  PREDICTED: protein LURP-one-related 8              187   8e-56   Fragaria vesca subsp. vesca
ref|XP_009370857.1|  PREDICTED: protein LURP-one-related 8-like         187   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_011084643.1|  PREDICTED: protein LURP-one-related 8              187   2e-55   Sesamum indicum [beniseed]
ref|XP_010113037.1|  Protein LURP-one-related 8                         187   2e-55   Morus notabilis
ref|XP_004137667.1|  PREDICTED: protein LURP-one-related 8              185   4e-55   Cucumis sativus [cucumbers]
ref|XP_006429667.1|  hypothetical protein CICLE_v10012703mg             186   4e-55   Citrus clementina [clementine]
gb|KDO64215.1|  hypothetical protein CISIN_1g027614mg                   185   9e-55   Citrus sinensis [apfelsine]
emb|CDO98625.1|  unnamed protein product                                184   2e-54   Coffea canephora [robusta coffee]
gb|KJB35346.1|  hypothetical protein B456_006G110200                    183   4e-54   Gossypium raimondii
ref|XP_008788144.1|  PREDICTED: protein LURP-one-related 8-like         182   9e-54   Phoenix dactylifera
ref|XP_008442309.1|  PREDICTED: protein LURP-one-related 8              182   1e-53   Cucumis melo [Oriental melon]
ref|XP_010922827.1|  PREDICTED: protein LURP-one-related 8-like         181   2e-53   Elaeis guineensis
gb|KJB06398.1|  hypothetical protein B456_001G120200                    181   2e-53   Gossypium raimondii
ref|XP_009410488.1|  PREDICTED: protein LURP-one-related 8-like         181   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399917.1|  PREDICTED: protein LURP-one-related 8-like         181   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG04426.1|  hypothetical protein F383_30201                         180   5e-53   Gossypium arboreum [tree cotton]
ref|XP_009384338.1|  PREDICTED: protein LURP-one-related 8-like         180   6e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921246.1|  PREDICTED: protein LURP-one-related 8-like i...    180   2e-52   Elaeis guineensis
ref|XP_010931417.1|  PREDICTED: protein LURP-one-related 8-like i...    177   5e-52   Elaeis guineensis
gb|EYU39695.1|  hypothetical protein MIMGU_mgv1a013322mg                177   1e-51   Erythranthe guttata [common monkey flower]
gb|KHG04896.1|  hypothetical protein F383_28888                         177   1e-51   Gossypium arboreum [tree cotton]
ref|XP_007015922.1|  LURP-one-related 8, putative                       175   5e-51   Theobroma cacao [chocolate]
ref|XP_009395223.1|  PREDICTED: protein LURP-one-related 8-like         172   4e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004978499.1|  PREDICTED: protein LURP-one-related 8-like         172   6e-50   
ref|XP_010931418.1|  PREDICTED: protein LURP-one-related 8-like i...    172   7e-50   Elaeis guineensis
ref|XP_009417848.1|  PREDICTED: protein LURP-one-related 8-like i...    169   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406860.1|  PREDICTED: protein LURP-one-related 8-like         166   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391657.1|  PREDICTED: protein LURP-one-related 8-like         166   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004978498.1|  PREDICTED: protein LURP-one-related 8-like         166   2e-47   
ref|XP_009383277.1|  PREDICTED: protein LURP-one-related 8-like         165   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT22804.1|  hypothetical protein F775_12487                         164   9e-47   
ref|XP_009417847.1|  PREDICTED: protein LURP-one-related 8-like i...    164   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS64898.1|  Protein LURP-one-related 8                              166   2e-46   Triticum urartu
ref|XP_010553189.1|  PREDICTED: protein LURP-one-related 8              162   2e-46   Tarenaya hassleriana [spider flower]
emb|CBI31137.3|  unnamed protein product                                161   3e-46   Vitis vinifera
emb|CDM84729.1|  unnamed protein product                                163   3e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004977407.1|  PREDICTED: protein LURP-one-related 8-like         163   6e-46   Setaria italica
gb|EMT17787.1|  hypothetical protein F775_12401                         161   9e-46   
ref|XP_010553182.1|  PREDICTED: protein LURP-one-related 8-like i...    160   1e-45   Tarenaya hassleriana [spider flower]
dbj|BAK04409.1|  predicted protein                                      162   2e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009404681.1|  PREDICTED: protein LURP-one-related 8-like         160   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM84727.1|  unnamed protein product                                160   3e-45   Triticum aestivum [Canadian hard winter wheat]
gb|ERN04305.1|  hypothetical protein AMTR_s00077p00184480               159   7e-45   Amborella trichopoda
gb|KJB21683.1|  hypothetical protein B456_004G008600                    160   8e-45   Gossypium raimondii
emb|CDM84728.1|  unnamed protein product                                159   8e-45   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK07033.1|  predicted protein                                      159   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006842630.2|  PREDICTED: protein LURP-one-related 8              159   1e-44   Amborella trichopoda
ref|XP_010044440.1|  PREDICTED: protein LURP-one-related 8              157   1e-43   Eucalyptus grandis [rose gum]
gb|EAY82072.1|  hypothetical protein OsI_37268                          156   1e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_181398.1|  uncharacterized protein                               155   2e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18377.1|  BnaA04g22100D                                          155   2e-43   Brassica napus [oilseed rape]
emb|CDY62436.1|  BnaC03g72180D                                          154   5e-43   Brassica napus [oilseed rape]
emb|CDX93313.1|  BnaC04g45830D                                          154   6e-43   
ref|XP_009141749.1|  PREDICTED: protein LURP-one-related 8-like         154   7e-43   Brassica rapa
emb|CDX91482.1|  BnaC04g06680D                                          154   7e-43   
ref|XP_009143370.1|  PREDICTED: protein LURP-one-related 8              153   9e-43   Brassica rapa
emb|CDY07715.1|  BnaA03g17960D                                          153   1e-42   Brassica napus [oilseed rape]
ref|XP_006843503.1|  PREDICTED: protein LURP-one-related 8              154   1e-42   Amborella trichopoda
ref|XP_009381350.1|  PREDICTED: protein LURP-one-related 8-like         153   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006398550.1|  hypothetical protein EUTSA_v10014772mg             152   3e-42   Eutrema salsugineum [saltwater cress]
ref|XP_007134598.1|  hypothetical protein PHAVU_010G060200g             152   5e-42   Phaseolus vulgaris [French bean]
ref|XP_006295029.1|  hypothetical protein CARUB_v10024098mg             151   5e-42   Capsella rubella
ref|XP_004977408.1|  PREDICTED: protein LURP-one-related 8-like         151   1e-41   Setaria italica
emb|CDY62435.1|  BnaC03g72170D                                          150   2e-41   Brassica napus [oilseed rape]
ref|XP_002881606.1|  hypothetical protein ARALYDRAFT_482873             150   2e-41   
ref|XP_009133276.1|  PREDICTED: protein LURP-one-related 8-like         150   2e-41   Brassica rapa
ref|NP_001065608.2|  Os11g0120300                                       149   5e-41   
ref|NP_001066017.1|  Os12g0120100                                       149   6e-41   
ref|XP_006411081.1|  hypothetical protein EUTSA_v10017266mg             149   7e-41   Eutrema salsugineum [saltwater cress]
gb|ABA91200.1|  eukaryotic translation initiation factor 2B famil...    149   7e-41   Oryza sativa Japonica Group [Japonica rice]
emb|CDY07714.1|  BnaA03g17970D                                          148   7e-41   Brassica napus [oilseed rape]
ref|XP_010509151.1|  PREDICTED: protein LURP-one-related 8-like         148   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009133277.1|  PREDICTED: protein LURP-one-related 8-like         148   8e-41   Brassica rapa
ref|XP_010517169.1|  PREDICTED: protein LURP-one-related 8-like         148   9e-41   Camelina sativa [gold-of-pleasure]
gb|EAZ17233.1|  hypothetical protein OsJ_32751                          149   9e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970372.1|  PREDICTED: protein LURP-one-related 8-like         148   1e-40   Setaria italica
gb|KFK36769.1|  hypothetical protein AALP_AA4G168000                    148   1e-40   Arabis alpina [alpine rockcress]
ref|XP_010505504.1|  PREDICTED: protein LURP-one-related 8              148   1e-40   Camelina sativa [gold-of-pleasure]
gb|EAY79743.1|  hypothetical protein OsI_34901                          148   2e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_003568228.1|  PREDICTED: protein LURP-one-related 8-like         147   5e-40   Brachypodium distachyon [annual false brome]
emb|CDY60759.1|  BnaA05g34820D                                          144   3e-39   Brassica napus [oilseed rape]
ref|NP_001241138.1|  uncharacterized protein LOC100795046               143   1e-38   Glycine max [soybeans]
ref|NP_001170576.1|  hypothetical protein                               144   1e-38   Zea mays [maize]
ref|XP_004961716.1|  PREDICTED: protein LURP-one-related 8-like         143   2e-38   Setaria italica
ref|NP_001149433.1|  GTP binding protein                                142   5e-38   
ref|XP_003567222.1|  PREDICTED: protein LURP-one-related 8-like         141   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_006663759.1|  PREDICTED: protein LURP-one-related 8-like         140   3e-37   Oryza brachyantha
ref|XP_002442752.1|  hypothetical protein SORBIDRAFT_08g002230          139   7e-37   Sorghum bicolor [broomcorn]
ref|XP_002441779.1|  hypothetical protein SORBIDRAFT_08g002190          139   9e-37   Sorghum bicolor [broomcorn]
ref|XP_010261398.1|  PREDICTED: protein LURP-one-related 8-like         138   2e-36   Nelumbo nucifera [Indian lotus]
ref|NP_001147232.1|  GTP binding protein                                136   3e-36   
ref|XP_003558566.1|  PREDICTED: protein LURP-one-related 8-like         136   6e-36   Brachypodium distachyon [annual false brome]
ref|XP_008676388.1|  PREDICTED: protein LURP-one-related 8-like         136   1e-35   Zea mays [maize]
gb|KDO76359.1|  hypothetical protein CISIN_1g039555mg                   135   1e-35   Citrus sinensis [apfelsine]
ref|XP_006439454.1|  hypothetical protein CICLE_v10024192mg             135   2e-35   Citrus clementina [clementine]
ref|NP_001141080.1|  uncharacterized protein LOC100273162               135   2e-35   Zea mays [maize]
dbj|BAJ98118.1|  predicted protein                                      133   6e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006477514.1|  PREDICTED: protein LURP-one-related 17-like        133   9e-35   Citrus sinensis [apfelsine]
ref|XP_003517483.1|  PREDICTED: protein LURP-one-related 17-like        133   1e-34   Glycine max [soybeans]
ref|XP_002456535.1|  hypothetical protein SORBIDRAFT_03g038010          132   1e-34   Sorghum bicolor [broomcorn]
ref|XP_003538270.1|  PREDICTED: protein LURP-one-related 17-like        133   2e-34   Glycine max [soybeans]
ref|NP_001172625.1|  Os01g0817650                                       132   4e-34   
ref|XP_010676398.1|  PREDICTED: protein LURP-one-related 17-like        131   6e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007158538.1|  hypothetical protein PHAVU_002G160600g             131   8e-34   Phaseolus vulgaris [French bean]
ref|XP_004503664.1|  PREDICTED: protein LURP-one-related 17-like        131   9e-34   
gb|ACU20683.1|  unknown                                                 129   4e-33   Glycine max [soybeans]
ref|XP_002272759.1|  PREDICTED: protein LURP-one-related 17             129   4e-33   Vitis vinifera
ref|XP_003532987.1|  PREDICTED: protein LURP-one-related 17-like        129   4e-33   
gb|KHN24576.1|  Protein LURP-one-related 8                              127   6e-33   Glycine soja [wild soybean]
gb|EEE55581.1|  hypothetical protein OsJ_03872                          130   8e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CDP12084.1|  unnamed protein product                                127   1e-32   Coffea canephora [robusta coffee]
gb|KEH21151.1|  tubby C 2 protein                                       128   1e-32   Medicago truncatula
ref|XP_004962480.1|  PREDICTED: protein LURP-one-related 8-like         127   2e-32   Setaria italica
ref|XP_008679348.1|  PREDICTED: protein LURP-one-related 8-like         126   7e-32   Zea mays [maize]
ref|XP_002441278.1|  hypothetical protein SORBIDRAFT_09g023720          126   8e-32   Sorghum bicolor [broomcorn]
ref|NP_001147495.1|  GTP binding protein                                125   1e-31   Zea mays [maize]
gb|AFK37758.1|  unknown                                                 125   1e-31   Medicago truncatula
ref|NP_001239726.1|  uncharacterized protein LOC100782098               125   1e-31   Glycine max [soybeans]
ref|XP_012086809.1|  PREDICTED: protein LURP-one-related 17             125   1e-31   Jatropha curcas
ref|XP_008656402.1|  PREDICTED: protein LURP-one-related 8-like         125   2e-31   Zea mays [maize]
gb|AFK40792.1|  unknown                                                 125   3e-31   Lotus japonicus
ref|NP_001055161.1|  Os05g0311500                                       124   3e-31   
ref|XP_007040364.1|  UPF0706 protein, putative                          123   6e-31   
ref|XP_007160113.1|  hypothetical protein PHAVU_002G293600g             124   6e-31   Phaseolus vulgaris [French bean]
ref|XP_011074224.1|  PREDICTED: protein LURP-one-related 8              122   1e-30   Sesamum indicum [beniseed]
gb|KJB19104.1|  hypothetical protein B456_003G085200                    122   1e-30   Gossypium raimondii
ref|XP_007209037.1|  hypothetical protein PRUPE_ppa014961mg             122   1e-30   
gb|EAY97485.1|  hypothetical protein OsI_19414                          121   3e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_006654556.1|  PREDICTED: protein LURP-one-related 8-like         122   3e-30   Oryza brachyantha
gb|ABK26200.1|  unknown                                                 121   3e-30   Picea sitchensis
gb|AFK42040.1|  unknown                                                 122   3e-30   Lotus japonicus
ref|XP_004146535.1|  PREDICTED: protein LURP-one-related 17             120   6e-30   Cucumis sativus [cucumbers]
ref|XP_008451999.1|  PREDICTED: protein LURP-one-related 17             119   2e-29   Cucumis melo [Oriental melon]
ref|NP_001055871.1|  Os05g0484800                                       120   2e-29   
ref|XP_008362689.1|  PREDICTED: protein LURP-one-related 17-like        119   4e-29   Malus domestica [apple tree]
ref|XP_002298007.2|  hypothetical protein POPTR_0001s09960g             117   9e-29   
ref|XP_011022756.1|  PREDICTED: protein LURP-one-related 17-like        117   2e-28   Populus euphratica
ref|XP_002509870.1|  conserved hypothetical protein                     117   2e-28   
ref|XP_011026970.1|  PREDICTED: protein LURP-one-related 17-like        117   2e-28   Populus euphratica
ref|XP_009343860.1|  PREDICTED: protein LURP-one-related 17             117   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_002304522.1|  hypothetical protein POPTR_0003s13300g             116   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_002450165.1|  hypothetical protein SORBIDRAFT_05g001390          116   5e-28   Sorghum bicolor [broomcorn]
ref|XP_006646432.1|  PREDICTED: protein LURP-one-related 8-like         111   4e-27   
ref|XP_008657131.1|  PREDICTED: protein LURP-one-related 8-like         113   5e-27   Zea mays [maize]
ref|XP_007215974.1|  hypothetical protein PRUPE_ppa011580mg             112   6e-27   
ref|XP_010112615.1|  Protein LURP-one-related 17                        113   1e-26   
gb|KJB24294.1|  hypothetical protein B456_004G137400                    112   1e-26   Gossypium raimondii
ref|XP_009780097.1|  PREDICTED: protein LURP-one-related 17 isofo...    112   1e-26   Nicotiana sylvestris
ref|XP_002450164.1|  hypothetical protein SORBIDRAFT_05g001380          112   2e-26   Sorghum bicolor [broomcorn]
ref|XP_008228691.1|  PREDICTED: protein LURP-one-related 5-like         111   2e-26   Prunus mume [ume]
ref|XP_004300823.1|  PREDICTED: protein LURP-one-related 17             112   2e-26   Fragaria vesca subsp. vesca
ref|XP_012073172.1|  PREDICTED: protein LURP-one-related 5              111   2e-26   Jatropha curcas
ref|XP_002442750.1|  hypothetical protein SORBIDRAFT_08g002210          112   3e-26   Sorghum bicolor [broomcorn]
ref|XP_002298251.1|  hypothetical protein POPTR_0001s19270g             110   3e-26   Populus trichocarpa [western balsam poplar]
gb|KDP25372.1|  hypothetical protein JCGZ_20528                         110   3e-26   Jatropha curcas
emb|CDO98155.1|  unnamed protein product                                110   5e-26   Coffea canephora [robusta coffee]
gb|EYU40057.1|  hypothetical protein MIMGU_mgv1a020987mg                110   6e-26   Erythranthe guttata [common monkey flower]
ref|XP_002517637.1|  GTP binding protein, putative                      110   6e-26   Ricinus communis
ref|XP_009619478.1|  PREDICTED: protein LURP-one-related 17 isofo...    110   1e-25   Nicotiana tomentosiformis
ref|XP_009780096.1|  PREDICTED: protein LURP-one-related 17 isofo...    109   1e-25   Nicotiana sylvestris
ref|XP_006385313.1|  hypothetical protein POPTR_0003s02700g             108   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006465324.1|  PREDICTED: protein LURP-one-related 12-like        108   2e-25   Citrus sinensis [apfelsine]
ref|XP_002266582.1|  PREDICTED: protein LURP-one-related 12             108   2e-25   Vitis vinifera
emb|CAN65825.1|  hypothetical protein VITISV_034997                     108   3e-25   Vitis vinifera
ref|XP_011012351.1|  PREDICTED: protein LURP-one-related 5-like         107   4e-25   Populus euphratica
gb|KJB39665.1|  hypothetical protein B456_007G024700                    107   5e-25   Gossypium raimondii
ref|XP_010063468.1|  PREDICTED: protein LURP-one-related 5              107   5e-25   Eucalyptus grandis [rose gum]
ref|XP_011081412.1|  PREDICTED: protein LURP-one-related 5-like         109   5e-25   Sesamum indicum [beniseed]
ref|XP_011073427.1|  PREDICTED: protein LURP-one-related 5-like         107   6e-25   Sesamum indicum [beniseed]
ref|XP_009619477.1|  PREDICTED: protein LURP-one-related 17 isofo...    107   1e-24   Nicotiana tomentosiformis
ref|XP_011044842.1|  PREDICTED: protein LURP-one-related 5              106   1e-24   Populus euphratica
ref|XP_011659522.1|  PREDICTED: protein LURP-one-related 12             106   1e-24   Cucumis sativus [cucumbers]
ref|XP_009365431.1|  PREDICTED: protein LURP-one-related 12-like        106   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_010691138.1|  PREDICTED: protein LURP-one-related 12             106   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006655185.1|  PREDICTED: protein LURP-one-related 8-like         104   2e-24   Oryza brachyantha
ref|XP_008461125.1|  PREDICTED: protein LURP-one-related 12-like        105   2e-24   Cucumis melo [Oriental melon]
gb|KDO48547.1|  hypothetical protein CISIN_1g027996mg                   105   2e-24   Citrus sinensis [apfelsine]
ref|XP_004245562.1|  PREDICTED: protein LURP-one-related 8-like         105   3e-24   Solanum lycopersicum
ref|XP_010535140.1|  PREDICTED: protein LURP-one-related 12             105   4e-24   Tarenaya hassleriana [spider flower]
ref|NP_001236323.1|  uncharacterized protein LOC100527456               105   4e-24   Glycine max [soybeans]
gb|AFK37784.1|  unknown                                                 105   5e-24   Lotus japonicus
gb|AFK38610.1|  unknown                                                 105   7e-24   Lotus japonicus
ref|XP_006427287.1|  hypothetical protein CICLE_v10026490mg             104   8e-24   Citrus clementina [clementine]
gb|KHN22440.1|  Protein LURP-one-related 12                             104   9e-24   Glycine soja [wild soybean]
ref|XP_008346624.1|  PREDICTED: protein LURP-one-related 12-like        104   1e-23   Malus domestica [apple tree]
ref|XP_004235956.1|  PREDICTED: protein LURP-one-related 5              103   1e-23   Solanum lycopersicum
ref|XP_006343921.1|  PREDICTED: protein LURP-one-related 17-like ...    103   2e-23   Solanum tuberosum [potatoes]
ref|XP_007150755.1|  hypothetical protein PHAVU_005G178100g             103   2e-23   Phaseolus vulgaris [French bean]
ref|XP_009604016.1|  PREDICTED: protein LURP-one-related 5-like i...    102   3e-23   
ref|XP_009604015.1|  PREDICTED: protein LURP-one-related 5-like i...    102   3e-23   Nicotiana tomentosiformis
ref|XP_010465573.1|  PREDICTED: protein LURP-one-related 12-like        102   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009767463.1|  PREDICTED: protein LURP-one-related 5-like         102   4e-23   Nicotiana sylvestris
ref|XP_009777813.1|  PREDICTED: protein LURP-one-related 12             102   5e-23   Nicotiana sylvestris
ref|XP_006298512.1|  hypothetical protein CARUB_v10014588mg             102   6e-23   Capsella rubella
ref|XP_010553543.1|  PREDICTED: protein LURP-one-related 17             102   7e-23   Tarenaya hassleriana [spider flower]
gb|ABK25939.1|  unknown                                                 102   8e-23   Picea sitchensis
ref|XP_010487421.1|  PREDICTED: protein LURP-one-related 12             102   8e-23   Camelina sativa [gold-of-pleasure]
gb|KJB56382.1|  hypothetical protein B456_009G128500                    101   9e-23   Gossypium raimondii
ref|XP_010055794.1|  PREDICTED: protein LURP-one-related 17             102   1e-22   Eucalyptus grandis [rose gum]
ref|XP_011467084.1|  PREDICTED: protein LURP-one-related 12             101   1e-22   Fragaria vesca subsp. vesca
ref|XP_009610444.1|  PREDICTED: protein LURP-one-related 12-like        101   1e-22   Nicotiana tomentosiformis
ref|XP_002885109.1|  hypothetical protein ARALYDRAFT_897880             101   2e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_006343920.1|  PREDICTED: protein LURP-one-related 17-like ...    101   2e-22   Solanum tuberosum [potatoes]
gb|EMS46289.1|  Protein LURP-one-related 8                              100   2e-22   Triticum urartu
ref|XP_010503481.1|  PREDICTED: protein LURP-one-related 12-like        100   2e-22   Camelina sativa [gold-of-pleasure]
ref|NP_001240988.1|  uncharacterized protein LOC100787085               100   3e-22   Glycine max [soybeans]
gb|EYU23418.1|  hypothetical protein MIMGU_mgv1a022920mg                100   3e-22   Erythranthe guttata [common monkey flower]
ref|XP_010441323.1|  PREDICTED: protein LURP-one-related 17-like        100   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_004506948.1|  PREDICTED: protein LURP-one-related 12-like      99.8    5e-22   Cicer arietinum [garbanzo]
ref|XP_006284493.1|  hypothetical protein CARUB_v10005685mg           99.8    6e-22   Capsella rubella
ref|XP_010436109.1|  PREDICTED: protein LURP-one-related 17           99.8    6e-22   Camelina sativa [gold-of-pleasure]
gb|EPS59500.1|  hypothetical protein M569_15304                       98.6    7e-22   Genlisea aurea
ref|XP_010537995.1|  PREDICTED: protein LURP-one-related 5            99.4    7e-22   Tarenaya hassleriana [spider flower]
gb|KDO48546.1|  hypothetical protein CISIN_1g027996mg                 99.4    8e-22   Citrus sinensis [apfelsine]
ref|XP_003597904.1|  hypothetical protein MTR_2g103840                99.4    8e-22   Medicago truncatula
emb|CDX75845.1|  BnaC03g39280D                                        99.0    9e-22   
ref|XP_009135456.1|  PREDICTED: protein LURP-one-related 12           99.0    1e-21   Brassica rapa
ref|XP_003531715.1|  PREDICTED: protein LURP-one-related 12-like      99.0    1e-21   
ref|XP_003577127.1|  PREDICTED: protein LURP-one-related 8-like       99.0    1e-21   Brachypodium distachyon [annual false brome]
gb|KFK38935.1|  hypothetical protein AALP_AA3G179300                  98.6    1e-21   Arabis alpina [alpine rockcress]
ref|XP_008228690.1|  PREDICTED: protein LURP-one-related 12-like      98.6    1e-21   Prunus mume [ume]
ref|XP_010447690.1|  PREDICTED: protein LURP-one-related 17-like      98.6    1e-21   Camelina sativa [gold-of-pleasure]
gb|AAM63469.1|  unknown                                               98.2    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566526.1|  uncharacterized protein                             98.6    2e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY58464.1|  BnaA03g57510D                                        98.2    2e-21   Brassica napus [oilseed rape]
ref|XP_010539503.1|  PREDICTED: protein LURP-one-related 5-like       98.2    2e-21   Tarenaya hassleriana [spider flower]
gb|EEE64150.1|  hypothetical protein OsJ_18982                        98.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|ACU20466.1|  unknown                                               98.2    2e-21   Glycine max [soybeans]
emb|CDY30113.1|  BnaC05g37490D                                        97.8    3e-21   Brassica napus [oilseed rape]
ref|XP_009357948.1|  PREDICTED: protein LURP-one-related 11           97.4    3e-21   Pyrus x bretschneideri [bai li]
ref|XP_010097226.1|  hypothetical protein L484_025775                 97.4    3e-21   Morus notabilis
gb|ABK28736.1|  unknown                                               97.4    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198974.1|  uncharacterized protein                             97.4    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542248.1|  PREDICTED: protein LURP-one-related 12-like      97.4    5e-21   Tarenaya hassleriana [spider flower]
ref|XP_006405327.1|  hypothetical protein EUTSA_v10027919mg           97.4    5e-21   Eutrema salsugineum [saltwater cress]
ref|XP_007217265.1|  hypothetical protein PRUPE_ppa011426mg           97.1    5e-21   Prunus persica
gb|EYU21649.1|  hypothetical protein MIMGU_mgv1a013574mg              96.7    6e-21   Erythranthe guttata [common monkey flower]
ref|XP_009140102.1|  PREDICTED: protein LURP-one-related 17-like      96.7    8e-21   Brassica rapa
ref|XP_011081138.1|  PREDICTED: protein LURP-one-related 17-like      96.3    9e-21   Sesamum indicum [beniseed]
ref|XP_006364218.1|  PREDICTED: protein LURP-one-related 5-like       95.9    1e-20   Solanum tuberosum [potatoes]
ref|XP_007023188.1|  UPF0706 protein                                  95.5    1e-20   Theobroma cacao [chocolate]
ref|XP_011625017.1|  PREDICTED: protein LURP-one-related 5            95.5    2e-20   Amborella trichopoda
ref|XP_009370853.1|  PREDICTED: protein LURP-one-related 5-like       95.5    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_010247598.1|  PREDICTED: protein LURP-one-related 12-like ...  95.1    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010247599.1|  PREDICTED: protein LURP-one-related 12-like ...  95.1    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008393784.1|  PREDICTED: protein LURP-one-related 5-like       95.1    3e-20   
ref|XP_010247597.1|  PREDICTED: protein LURP-one-related 12-like ...  95.1    4e-20   Nelumbo nucifera [Indian lotus]
ref|XP_003528324.1|  PREDICTED: protein LURP-one-related 12-like      94.7    4e-20   Glycine max [soybeans]
ref|XP_007135756.1|  hypothetical protein PHAVU_010G156000g           94.7    4e-20   Phaseolus vulgaris [French bean]
ref|XP_006450881.1|  hypothetical protein CICLE_v10009475mg           94.4    5e-20   Citrus clementina [clementine]
ref|XP_009370854.1|  PREDICTED: protein LURP-one-related 5-like       94.4    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_010691139.1|  PREDICTED: protein LURP-one-related 5-like       94.0    8e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002868584.1|  predicted protein                                94.0    8e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010089135.1|  Protein LURP-one-related 11                      93.6    9e-20   Morus notabilis
ref|XP_006406916.1|  hypothetical protein EUTSA_v10021485mg           93.6    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006858665.1|  PREDICTED: protein LURP-one-related 5            93.2    1e-19   Amborella trichopoda
gb|EMT15004.1|  hypothetical protein F775_52281                       93.2    1e-19   
gb|ACG26735.1|  GTP binding protein                                   90.5    1e-19   Zea mays [maize]
ref|XP_012068801.1|  PREDICTED: protein LURP-one-related 11-like      92.8    1e-19   
ref|XP_008340381.1|  PREDICTED: protein LURP-one-related 11-like      92.8    1e-19   
ref|XP_009337843.1|  PREDICTED: protein LURP-one-related 5-like       93.2    2e-19   
ref|XP_004486664.1|  PREDICTED: protein LURP-one-related 12-like      93.2    2e-19   
ref|XP_009146197.1|  PREDICTED: protein LURP-one-related 12-like      93.2    2e-19   
gb|KCW88485.1|  hypothetical protein EUGRSUZ_A00877                   92.8    3e-19   
gb|ERN10195.1|  hypothetical protein AMTR_s00171p00023840             95.9    4e-19   
ref|XP_008355750.1|  PREDICTED: protein LURP-one-related 5-like       92.0    4e-19   
ref|XP_008244230.1|  PREDICTED: protein LURP-one-related 5-like       91.7    5e-19   
ref|XP_003604378.1|  hypothetical protein MTR_4g010180                91.3    6e-19   
gb|AFK48542.1|  unknown                                               91.3    6e-19   
ref|XP_011018912.1|  PREDICTED: protein LURP-one-related 5-like       91.7    6e-19   
ref|XP_006381290.1|  hypothetical protein POPTR_0006s11450g           91.7    7e-19   
ref|XP_010472986.1|  PREDICTED: protein LURP-one-related 5 isofor...  91.3    7e-19   
ref|XP_007207760.1|  hypothetical protein PRUPE_ppa026822mg           90.9    9e-19   
ref|XP_004152197.1|  PREDICTED: protein LURP-one-related 5            90.5    1e-18   
ref|XP_008454228.1|  PREDICTED: protein LURP-one-related 5            90.5    1e-18   
ref|XP_010036046.1|  PREDICTED: protein LURP-one-related 5-like       90.1    2e-18   
gb|KJB70630.1|  hypothetical protein B456_011G084100                  89.7    2e-18   
ref|XP_009338337.1|  PREDICTED: protein LURP-one-related 11-like      88.6    5e-18   
gb|ADE75958.1|  unknown                                               89.0    6e-18   
ref|XP_010489828.1|  PREDICTED: protein LURP-one-related 11           88.6    6e-18   
ref|XP_008344847.1|  PREDICTED: protein LURP-one-related 5-like       88.6    7e-18   
ref|NP_188043.2|  LURP-one-related 11 protein                         88.6    8e-18   
ref|XP_010278905.1|  PREDICTED: protein LURP-one-related 8-like i...  88.2    8e-18   
ref|XP_007216114.1|  hypothetical protein PRUPE_ppa018762mg           87.8    9e-18   
ref|XP_003597905.1|  hypothetical protein MTR_2g103850                88.2    1e-17   
emb|CDP06354.1|  unnamed protein product                              88.6    2e-17   
ref|XP_008355787.1|  PREDICTED: protein LURP-one-related 5-like       87.4    2e-17   
ref|XP_009128452.1|  PREDICTED: protein LURP-one-related 5            87.0    2e-17   
emb|CDY41119.1|  BnaC05g11100D                                        87.0    2e-17   
ref|XP_006302825.1|  hypothetical protein CARUB_v10020956mg           87.0    2e-17   
ref|XP_010472987.1|  PREDICTED: protein LURP-one-related 5 isofor...  87.0    2e-17   
ref|XP_010102063.1|  Protein LURP-one-related 11                      86.7    3e-17   
ref|XP_010501051.1|  PREDICTED: protein LURP-one-related 2-like       86.7    3e-17   
ref|XP_007024760.1|  Uncharacterized protein TCM_029242               87.0    3e-17   
ref|XP_010468165.1|  PREDICTED: protein LURP-one-related 11-like      86.7    3e-17   
ref|XP_006840481.1|  PREDICTED: protein LURP-one-related 5            85.9    4e-17   
ref|XP_010417747.1|  PREDICTED: protein LURP-one-related 5-like       86.3    4e-17   
gb|KCW81830.1|  hypothetical protein EUGRSUZ_C03188                   86.7    4e-17   
ref|XP_006407098.1|  hypothetical protein EUTSA_v10022232mg           85.9    6e-17   
ref|XP_008370573.1|  PREDICTED: protein LURP-one-related 5-like       86.7    6e-17   
ref|XP_010462293.1|  PREDICTED: protein LURP-one-related 2-like       85.9    6e-17   
gb|KFK42415.1|  hypothetical protein AALP_AA2G253200                  85.5    7e-17   
gb|AFK35128.1|  unknown                                               83.2    8e-17   
emb|CDX87294.1|  BnaA07g35790D                                        85.9    9e-17   
gb|KFK35690.1|  hypothetical protein AALP_AA4G024500                  85.1    9e-17   
ref|XP_002269437.1|  PREDICTED: protein LURP-one-related 4            85.1    1e-16   
emb|CBI34692.3|  unnamed protein product                              85.1    1e-16   
ref|NP_178129.1|  uncharacterized protein                             84.7    1e-16   
ref|XP_002885028.1|  hypothetical protein ARALYDRAFT_478843           84.3    2e-16   
ref|NP_974021.1|  TUB_2 domain-containing protein                     84.3    2e-16   
ref|XP_004244608.1|  PREDICTED: protein LURP-one-related 4-like       84.3    2e-16   
ref|XP_010259522.1|  PREDICTED: protein LURP-one-related 8-like       84.3    2e-16   
ref|XP_010044475.1|  PREDICTED: protein LURP-one-related 8-like       84.3    2e-16   
gb|AAF02862.1|AC009324_11  Hypothetical protein                       84.0    2e-16   
ref|XP_009788299.1|  PREDICTED: protein LURP-one-related 11-like      84.0    2e-16   
ref|XP_006299918.1|  hypothetical protein CARUB_v10016127mg           84.0    3e-16   
ref|NP_564642.1|  TUB_2 domain-containing protein                     84.0    3e-16   
ref|XP_002889309.1|  hypothetical protein ARALYDRAFT_895984           84.0    3e-16   
ref|XP_002532952.1|  GTP binding protein, putative                    83.6    3e-16   
emb|CDX82489.1|  BnaA03g33320D                                        83.6    4e-16   
ref|XP_002885027.1|  predicted protein                                83.6    4e-16   
ref|XP_010922834.1|  PREDICTED: protein LURP-one-related 5-like       83.2    4e-16   
ref|XP_010501814.1|  PREDICTED: protein LURP-one-related 11-like      83.2    6e-16   
ref|XP_002264699.2|  PREDICTED: protein LURP-one-related 5            83.2    7e-16   
emb|CBI34691.3|  unnamed protein product                              84.7    8e-16   
ref|XP_010250151.1|  PREDICTED: protein LURP-one-related 12-like      82.4    8e-16   
ref|XP_004143921.1|  PREDICTED: protein LURP-one-related 4            82.4    9e-16   
ref|XP_009135373.1|  PREDICTED: protein LURP-one-related 11-like      82.4    1e-15   
ref|XP_010931666.1|  PREDICTED: protein LURP-one-related 8-like       82.0    1e-15   
gb|AAM61058.1|  unknown                                               82.0    1e-15   
ref|XP_010652199.1|  PREDICTED: protein LURP-one-related 12-like      81.6    1e-15   
ref|NP_564643.2|  eukaryotic translation initiation factor 2B-lik...  84.7    2e-15   
ref|XP_008228114.1|  PREDICTED: protein LURP-one-related 11-like      81.6    2e-15   
ref|XP_004980120.1|  PREDICTED: protein LURP-one-related 5-like       82.0    2e-15   
ref|XP_009590012.1|  PREDICTED: protein LURP-one-related 4-like       81.3    2e-15   
ref|XP_002304253.2|  hypothetical protein POPTR_0003s06980g           81.6    2e-15   
ref|XP_011036538.1|  PREDICTED: protein LURP-one-related 11-like      81.3    2e-15   
ref|XP_004245620.2|  PREDICTED: protein LURP-one-related 11-like      81.6    2e-15   
ref|XP_004305058.1|  PREDICTED: protein LURP-one-related 5-like       81.6    2e-15   
ref|XP_006828635.2|  PREDICTED: protein LURP-one-related 11           81.3    2e-15   
dbj|BAD43193.1|  At1g53890                                            81.3    2e-15   
gb|KGN50118.1|  hypothetical protein Csa_5G154800                     81.3    3e-15   
ref|XP_004143985.2|  PREDICTED: protein LURP-one-related 4-like       81.3    3e-15   
ref|XP_012081223.1|  PREDICTED: protein LURP-one-related 12-like      80.9    3e-15   
ref|XP_010914723.1|  PREDICTED: protein LURP-one-related 8-like       80.9    3e-15   
ref|XP_006389754.1|  hypothetical protein EUTSA_v10019134mg           80.9    3e-15   
ref|XP_011006226.1|  PREDICTED: protein LURP-one-related 5-like       81.3    3e-15   
ref|XP_006429672.1|  hypothetical protein CICLE_v10012655mg           80.9    3e-15   
ref|XP_007013494.1|  Uncharacterized protein TCM_038117               81.3    4e-15   
emb|CDX75761.1|  BnaC03g38440D                                        80.9    4e-15   
ref|XP_006352280.1|  PREDICTED: protein LURP-one-related 4-like       80.5    4e-15   
ref|XP_002519979.1|  GTP binding protein, putative                    80.9    4e-15   
ref|XP_008812288.1|  PREDICTED: protein LURP-one-related 8-like       80.5    5e-15   
ref|XP_009117056.1|  PREDICTED: protein LURP-one-related 11           80.5    6e-15   
ref|XP_009779016.1|  PREDICTED: protein LURP-one-related 4-like       79.7    7e-15   
ref|XP_008807326.1|  PREDICTED: protein LURP-one-related 8-like       79.7    8e-15   
ref|XP_008238871.1|  PREDICTED: protein LURP-one-related 2-like       79.3    9e-15   
ref|XP_002527187.1|  conserved hypothetical protein                   79.7    9e-15   
ref|XP_002299542.1|  hypothetical protein POPTR_0001s09160g           79.3    1e-14   
ref|XP_008804650.1|  PREDICTED: protein LURP-one-related 5-like       79.3    1e-14   
gb|KJB06468.1|  hypothetical protein B456_001G043300                  79.3    1e-14   
ref|XP_002269469.2|  PREDICTED: protein LURP-one-related 4            79.0    1e-14   
ref|XP_006481273.1|  PREDICTED: protein LURP-one-related 5-like       79.3    1e-14   
emb|CDY33238.1|  BnaC01g37110D                                        79.3    1e-14   
ref|XP_004978337.1|  PREDICTED: protein LURP-one-related 5-like       79.3    1e-14   
ref|XP_009410485.1|  PREDICTED: protein LURP-one-related 8-like       79.0    2e-14   
ref|XP_007040185.1|  Uncharacterized protein TCM_016226               78.6    2e-14   
gb|KJB57087.1|  hypothetical protein B456_009G147600                  78.6    2e-14   
ref|XP_009393207.1|  PREDICTED: protein LURP-one-related 8-like       78.6    2e-14   
ref|XP_002509775.1|  GTP binding protein, putative                    78.2    2e-14   
ref|XP_010096543.1|  Protein LURP-one-related 11                      77.0    2e-14   
ref|XP_006429674.1|  hypothetical protein CICLE_v10012659mg           78.6    2e-14   
ref|XP_008437243.1|  PREDICTED: protein LURP-one-related 4-like i...  78.6    3e-14   
ref|XP_012090961.1|  PREDICTED: protein LURP-one-related 5-like       78.2    3e-14   
ref|XP_006305603.1|  hypothetical protein CARUB_v10010269mg           78.2    3e-14   
ref|XP_004246773.2|  PREDICTED: protein LURP-one-related 5-like       78.6    3e-14   
gb|EYU45913.1|  hypothetical protein MIMGU_mgv1a020479mg              77.8    4e-14   
ref|XP_010552187.1|  PREDICTED: protein LURP-one-related 11-like      77.8    4e-14   
ref|XP_010685226.1|  PREDICTED: protein LURP-one-related 11-like      77.8    4e-14   
gb|ERM96051.1|  hypothetical protein AMTR_s00129p00095850             77.0    4e-14   
ref|XP_008393340.1|  PREDICTED: protein LURP-one-related 11-like      77.8    4e-14   
ref|XP_002323110.2|  hypothetical protein POPTR_0016s15000g           77.8    4e-14   
emb|CDP09765.1|  unnamed protein product                              77.4    4e-14   
ref|XP_010053288.1|  PREDICTED: protein LURP-one-related 11-like      77.4    4e-14   
ref|XP_009383278.1|  PREDICTED: protein LURP-one-related 12-like      77.4    4e-14   
ref|XP_002308070.1|  hypothetical protein POPTR_0006s06590g           77.4    5e-14   
ref|XP_008437245.1|  PREDICTED: protein LURP-one-related 4            77.0    6e-14   
gb|EEE51543.1|  hypothetical protein OsJ_32752                        77.0    7e-14   
ref|XP_009785545.1|  PREDICTED: protein LURP-one-related 11-like      76.6    9e-14   
ref|XP_007208826.1|  hypothetical protein PRUPE_ppa025115mg           76.6    9e-14   
ref|XP_010269576.1|  PREDICTED: protein LURP-one-related 12-like ...  76.3    1e-13   
ref|XP_002269503.1|  PREDICTED: protein LURP-one-related 4 isofor...  76.3    1e-13   
ref|XP_010269577.1|  PREDICTED: protein LURP-one-related 12-like ...  75.9    1e-13   
ref|XP_002891776.1|  hypothetical protein ARALYDRAFT_314700           76.3    1e-13   
emb|CBI31132.3|  unnamed protein product                              75.9    1e-13   
ref|XP_009395971.1|  PREDICTED: protein LURP-one-related 5-like       76.3    1e-13   
ref|XP_010273088.1|  PREDICTED: protein LURP-one-related 11           75.9    1e-13   
ref|NP_001066020.1|  Os12g0120500                                     76.3    2e-13   
gb|KHG06868.1|  hypothetical protein F383_33418                       78.6    2e-13   
ref|XP_004249679.1|  PREDICTED: protein LURP-one-related 10-like      75.9    2e-13   
gb|KJB25798.1|  hypothetical protein B456_004G210100                  75.5    2e-13   
ref|XP_009619464.1|  PREDICTED: protein LURP-one-related 4-like       75.1    2e-13   
ref|XP_010660882.1|  PREDICTED: protein LURP-one-related 4 isofor...  75.9    2e-13   
ref|XP_004253430.2|  PREDICTED: protein LURP-one-related 11-like      75.5    2e-13   
ref|XP_008669925.1|  PREDICTED: protein LURP-one-related 5-like       75.9    2e-13   
gb|EMS47616.1|  Protein LURP-one-related 8                            73.6    2e-13   
ref|XP_010278906.1|  PREDICTED: protein LURP-one-related 8-like i...  75.5    2e-13   
ref|XP_009381602.1|  PREDICTED: protein LURP-one-related 8-like       75.5    2e-13   
ref|XP_006338963.1|  PREDICTED: protein LURP-one-related 15-like      75.1    3e-13   
ref|XP_011020156.1|  PREDICTED: protein LURP-one-related 12-like      74.7    4e-13   
ref|XP_010687947.1|  PREDICTED: protein LURP-one-related 12-like      75.1    4e-13   
ref|XP_008801112.1|  PREDICTED: protein LURP-one-related 11-like      74.7    4e-13   
ref|XP_009619956.1|  PREDICTED: protein LURP-one-related 4-like       74.7    4e-13   
emb|CDP09764.1|  unnamed protein product                              74.3    5e-13   
ref|XP_009773386.1|  PREDICTED: protein LURP-one-related 8-like       75.1    5e-13   
ref|XP_011081150.1|  PREDICTED: protein LURP-one-related 11-like      74.3    5e-13   
ref|XP_006300990.1|  hypothetical protein CARUB_v10021380mg           74.3    5e-13   
gb|KEH21051.1|  tubby C 2 protein                                     74.3    5e-13   
ref|XP_010931513.1|  PREDICTED: protein LURP-one-related 8-like       74.3    6e-13   
ref|XP_002891777.1|  predicted protein                                77.0    6e-13   
gb|EEC67562.1|  hypothetical protein OsI_34903                        74.7    6e-13   
ref|XP_006466131.1|  PREDICTED: protein LURP-one-related 11-like      74.3    6e-13   
gb|KDO53778.1|  hypothetical protein CISIN_1g028663mg                 74.3    6e-13   
ref|XP_009782969.1|  PREDICTED: protein LURP-one-related 4-like       73.9    6e-13   
ref|XP_008437244.1|  PREDICTED: protein LURP-one-related 4-like i...  73.9    6e-13   
ref|XP_011029241.1|  PREDICTED: protein LURP-one-related 4-like       74.3    6e-13   
ref|XP_008789973.1|  PREDICTED: protein LURP-one-related 11-like      73.9    6e-13   
ref|XP_006426792.1|  hypothetical protein CICLE_v10026945mg           73.9    7e-13   
ref|XP_009631813.1|  PREDICTED: protein LURP-one-related 11-like      73.9    7e-13   
ref|XP_004970113.1|  PREDICTED: protein LURP-one-related 5-like       74.3    7e-13   
gb|KCW88492.1|  hypothetical protein EUGRSUZ_A00880                   73.6    7e-13   
ref|XP_010686106.1|  PREDICTED: uncharacterized protein LOC104900389  77.0    7e-13   
ref|XP_006363601.1|  PREDICTED: protein LURP-one-related 5-like       74.7    7e-13   
ref|XP_004300776.1|  PREDICTED: protein LURP-one-related 2-like       73.9    8e-13   
ref|XP_010922298.1|  PREDICTED: protein LURP-one-related 5-like       73.9    8e-13   
ref|XP_003627442.1|  hypothetical protein MTR_8g023060                73.6    9e-13   
ref|XP_010668277.1|  PREDICTED: protein LURP-one-related 11-like      73.6    1e-12   
emb|CDY45367.1|  BnaA09g12520D                                        72.8    1e-12   
ref|XP_008238874.1|  PREDICTED: protein LURP-one-related 11-like      73.6    1e-12   
ref|XP_008238872.1|  PREDICTED: protein LURP-one-related 11-like      73.2    1e-12   
ref|XP_003630540.1|  hypothetical protein MTR_8g098580                73.2    1e-12   
ref|XP_004303751.1|  PREDICTED: protein LURP-one-related 11-like ...  73.2    1e-12   
emb|CDY49893.1|  BnaC09g51330D                                        73.2    1e-12   
ref|XP_009112747.1|  PREDICTED: protein LURP-one-related 4            72.8    1e-12   
ref|XP_009794494.1|  PREDICTED: protein LURP-one-related 4-like       73.2    1e-12   
gb|EMS61779.1|  Protein LURP-one-related 11                           71.2    1e-12   
ref|XP_006392740.1|  hypothetical protein EUTSA_v10011350mg           75.9    1e-12   
ref|XP_009394000.1|  PREDICTED: protein LURP-one-related 11-like      73.2    2e-12   
ref|XP_003632774.1|  PREDICTED: protein LURP-one-related 2-like       72.8    2e-12   
ref|XP_004300777.1|  PREDICTED: protein LURP-one-related 4            72.8    2e-12   
ref|XP_007160044.1|  hypothetical protein PHAVU_002G287800g           73.2    2e-12   
ref|NP_001065610.2|  Os11g0120700                                     74.7    2e-12   
ref|XP_004978496.1|  PREDICTED: protein LURP-one-related 5-like       73.2    2e-12   
ref|XP_008676148.1|  PREDICTED: protein LURP-one-related 11-like      72.8    2e-12   
emb|CAN62133.1|  hypothetical protein VITISV_043717                   72.8    2e-12   
ref|XP_006439562.1|  hypothetical protein CICLE_v10024046mg           72.4    2e-12   
ref|XP_008359781.1|  PREDICTED: protein LURP-one-related 2-like       72.4    2e-12   
gb|EAZ19468.1|  hypothetical protein OsJ_35034                        73.2    2e-12   
ref|XP_004977409.1|  PREDICTED: protein LURP-one-related 5-like       72.8    2e-12   
ref|XP_006663761.1|  PREDICTED: protein LURP-one-related 5-like       72.8    2e-12   
ref|NP_001235690.1|  uncharacterized protein LOC100527667             72.4    2e-12   
emb|CAQ58635.1|  Unknown gene                                         72.0    3e-12   
ref|XP_006358899.1|  PREDICTED: protein LURP-one-related 4-like       72.4    3e-12   
gb|KHN23659.1|  Protein LURP-one-related 4                            72.0    3e-12   
ref|XP_010049312.1|  PREDICTED: protein LURP-one-related 2-like       72.0    3e-12   
ref|XP_008800875.1|  PREDICTED: protein LURP-one-related 11-like      72.4    3e-12   
ref|XP_002886401.1|  F2K11.21                                         72.0    3e-12   
ref|XP_009402217.1|  PREDICTED: protein LURP-one-related 15-like      72.4    3e-12   
emb|CAN63770.1|  hypothetical protein VITISV_030104                   72.4    3e-12   
ref|XP_004245621.1|  PREDICTED: protein LURP-one-related 4-like       72.0    3e-12   
ref|XP_008392626.1|  PREDICTED: protein LURP-one-related 11-like      72.0    3e-12   
ref|XP_007135368.1|  hypothetical protein PHAVU_010G123600g           72.0    3e-12   
ref|XP_009345736.1|  PREDICTED: protein LURP-one-related 2-like       72.0    3e-12   
ref|XP_010462295.1|  PREDICTED: protein LURP-one-related 2-like       72.0    3e-12   
gb|EAY82074.1|  hypothetical protein OsI_37270                        72.4    4e-12   
ref|XP_009619463.1|  PREDICTED: protein LURP-one-related 11-like      71.6    4e-12   
ref|NP_176530.4|  uncharacterized protein                             71.6    4e-12   
ref|XP_010418357.1|  PREDICTED: protein LURP-one-related 4-like       71.6    4e-12   
ref|XP_006477519.1|  PREDICTED: protein LURP-one-related 11-like      71.6    4e-12   



>ref|XP_012090968.1| PREDICTED: protein LURP-one-related 8 [Jatropha curcas]
 gb|KDP21819.1| hypothetical protein JCGZ_00606 [Jatropha curcas]
Length=210

 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 128/176 (73%), Gaps = 10/176 (6%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPN A+A  T   +E+L + + H         VLTVWKKSLLFNC+GFTVFD KGN
Sbjct  1    MTKVHPNVAAAPATGPTEEKL-KSSAHL---EADAVVLTVWKKSLLFNCNGFTVFDSKGN  56

Query  261  LVYRVDNYYDSSN-RAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            LVYRVDNY   S    EI+LMDA G  L TIRRKRLSLADNW+VYDGETA  P +SVRK+
Sbjct  57   LVYRVDNYMGGSGANGEIILMDAGGKPLLTIRRKRLSLADNWLVYDGETAVNPRFSVRKN  116

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            V++LN+K LAH++S        SKN  ++EIEGSYA RSC +YD  RRRVAE+K+K
Sbjct  117  VNILNTKCLAHMSS-----TSNSKNKLMYEIEGSYAQRSCAVYDEKRRRVAELKQK  167



>ref|XP_010938083.1| PREDICTED: protein LURP-one-related 8-like [Elaeis guineensis]
Length=216

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 6/175 (3%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M ++HPNA+SA  + +++       C C    P+  VLTVW+KSLLFN +GFTVFD KGN
Sbjct  1    MARIHPNASSAEGSLMSEFS---GGCCCGGEAPETVVLTVWRKSLLFNGNGFTVFDAKGN  57

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY   S R EI+LMDA+G  L TIRRKRLSL D+W++YDGE A  P +S RKHV
Sbjct  58   LVFRVDNYTSGSKR-EIILMDAAGKPLLTIRRKRLSLGDHWLIYDGEEAANPRFSARKHV  116

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +LL+SK+LAHVTS RG GAKG   A  +EIEGSY+ R CV+YD  R+R+AEI+RK
Sbjct  117  NLLHSKALAHVTSCRG-GAKGCVAAH-YEIEGSYSQRCCVVYDEERQRLAEIRRK  169



>ref|XP_009792809.1| PREDICTED: protein LURP-one-related 8 [Nicotiana sylvestris]
Length=226

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 134/178 (75%), Gaps = 7/178 (4%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PNA  +   +    +L  PA H  SS     VLTVWKKSLLFNCDGFTVFD++GN
Sbjct  1    MTKVYPNANPSSGNSAVAPKLAFPADHANSST---VVLTVWKKSLLFNCDGFTVFDNQGN  57

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY ++  +AEIVLMDASGNSL TIRRKR+SLAD+W+V++GETA  PL+SV+K+V
Sbjct  58   LVFRVDNY-NAGTKAEIVLMDASGNSLLTIRRKRISLADSWLVFEGETAINPLFSVKKNV  116

Query  441  SLLNSKSLAHVTSLR---GSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +LLN+KSLA V+  R    S +   KN  V+EIEGSY  R C +YD+ RR VA+IKRK
Sbjct  117  NLLNTKSLAQVSEHRKGLSSTSSPKKNNVVYEIEGSYTQRCCAVYDHKRRPVAQIKRK  174



>ref|XP_009605860.1| PREDICTED: protein LURP-one-related 8 [Nicotiana tomentosiformis]
Length=259

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 141/201 (70%), Gaps = 12/201 (6%)
 Frame = +3

Query  3    SSLSLPSATTYISLHSSQSERHF**LMTKVHPNAASAIPTALADEELPRPACHCLSSPPQ  182
            S L +P +   +S++     R F  +MTKV+PN  ++   + A  +L  PA H  +    
Sbjct  19   SVLPIPPSNQELSIN-----RFFLPVMTKVYPNGNASSGNSAAAPKLAFPADHHAN----  69

Query  183  PTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR  362
              VLTVWKKSLLFNCDGFTVFD++GNLV+RVDNY ++  +AEIVLMDASGNSL TIRRKR
Sbjct  70   -VVLTVWKKSLLFNCDGFTVFDNQGNLVFRVDNY-NAGTKAEIVLMDASGNSLLTIRRKR  127

Query  363  LSLADNWVVYDGETADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            +SLAD+W+V++GETA  PL+SV+K+V+LLN+KSLA V   R       KN  V+EIEGSY
Sbjct  128  ISLADSWLVFEGETAVNPLFSVKKNVNLLNTKSLAQVYEHR-KALSSKKNNVVYEIEGSY  186

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
              R C +YD  RR VA IKRK
Sbjct  187  TQRCCAVYDQKRRPVALIKRK  207



>ref|XP_008782728.1| PREDICTED: protein LURP-one-related 8-like [Phoenix dactylifera]
Length=215

 Score =   198 bits (503),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 129/179 (72%), Gaps = 14/179 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRP----ACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFD  248
            MTKVHPNA+SA   A      PR      C C    P+  VLTVW+KSLLFN +GFTVFD
Sbjct  1    MTKVHPNASSAAEAA------PRADFSGGC-CGGGVPETAVLTVWRKSLLFNGNGFTVFD  53

Query  249  DKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSV  428
             KGNL++RVDNY  S N+ EIVLMDA+G  L TIRRKRLSL D+W++YDGE A  P +SV
Sbjct  54   AKGNLLFRVDNYA-SGNKGEIVLMDAAGKPLLTIRRKRLSLGDHWLIYDGEEAADPRFSV  112

Query  429  RKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            RKHV+LL SK+LAHVT   G GA+G   A  ++I+GSY+ R C++YD  RR++AEIKRK
Sbjct  113  RKHVNLLQSKALAHVTPCHG-GAEGCV-ATHYDIQGSYSQRCCLVYDERRRQLAEIKRK  169



>ref|XP_011018917.1| PREDICTED: protein LURP-one-related 8 [Populus euphratica]
Length=218

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 123/181 (68%), Gaps = 14/181 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSS-----PPQPTVLTVWKKSLLFNCDGFTVF  245
            MTKV+PN A   P   A  E  R      SS          VLTVWKKSLLFNC+GFTVF
Sbjct  1    MTKVYPNVA---PATAATNEKQRQLLKLKSSNNALDADHTVVLTVWKKSLLFNCNGFTVF  57

Query  246  DDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLY  422
            D KGNL++RVDNY  +S +  EIVLMDA+G  L T+RRKRLSL DNW+VYDGETA  P +
Sbjct  58   DSKGNLLFRVDNYMANSGSNGEIVLMDAAGKPLLTMRRKRLSLGDNWLVYDGETAINPGF  117

Query  423  SVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKR  602
            SV+KHVS+LN K LAH+     S A GS    ++EIEGSYA R C +YD  +RRVAEIK+
Sbjct  118  SVKKHVSILNKKCLAHI-----SQAAGSNKNVMYEIEGSYAQRCCAVYDEKKRRVAEIKQ  172

Query  603  K  605
            K
Sbjct  173  K  173



>ref|XP_006381286.1| hypothetical protein POPTR_0006s11410g [Populus trichocarpa]
 gb|ABK94888.1| unknown [Populus trichocarpa]
 gb|ERP59083.1| hypothetical protein POPTR_0006s11410g [Populus trichocarpa]
Length=218

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 124/181 (69%), Gaps = 14/181 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSS-----PPQPTVLTVWKKSLLFNCDGFTVF  245
            MTKV+PN A   PTA A  E  R      SS          VLTVWKKSLLFNC+GFTVF
Sbjct  1    MTKVYPNVA---PTAAATNEKQRQLLKLKSSNNALDADHAVVLTVWKKSLLFNCNGFTVF  57

Query  246  DDKGNLVYRVDNYYDSS-NRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLY  422
            D KGNL++RVDNY  +S +  EIVLMDA+G  L T+RRKRLSL D+W+VYDGETA  P +
Sbjct  58   DSKGNLLFRVDNYMATSGSNGEIVLMDAAGKPLLTMRRKRLSLGDSWLVYDGETAINPEF  117

Query  423  SVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKR  602
            SV+KHVS+LN K LAHV     S A GS    ++EIEGSY  R C +YD  +RRVAEIK+
Sbjct  118  SVKKHVSILNKKCLAHV-----SQAAGSNKNVMYEIEGSYTQRCCAVYDEKKRRVAEIKQ  172

Query  603  K  605
            K
Sbjct  173  K  173



>ref|XP_010278908.1| PREDICTED: protein LURP-one-related 8-like [Nelumbo nucifera]
Length=240

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 126/175 (72%), Gaps = 14/175 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+P+   +IP+ +A     + A           V+TVWKKSLLFNC+GFTVFD KGN
Sbjct  31   MTKVYPSTGISIPSPVASPTDGKAA-----------VITVWKKSLLFNCNGFTVFDAKGN  79

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            L++RVDNY  S N+ EIVLMDA G  L TIRRKRL L D W+VYDGETA  P +SV+K+V
Sbjct  80   LIFRVDNYL-SGNKGEIVLMDAEGKPLLTIRRKRLCLGDCWLVYDGETAVNPRFSVKKNV  138

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            + LNSKSLA+VT     G KG K+ +++E+EGSYA R C +YD+ RRRVAEIKRK
Sbjct  139  NPLNSKSLAYVTG--SCGGKGRKHDKLYEMEGSYAQRCCAVYDDKRRRVAEIKRK  191



>ref|XP_010921247.1| PREDICTED: protein LURP-one-related 8-like isoform X2 [Elaeis 
guineensis]
Length=214

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 125/175 (71%), Gaps = 7/175 (4%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPNA+S   +   D         C    P+  VLTVW+KSLLFN +GFTVFD KGN
Sbjct  1    MTKVHPNASSVEASLRED----FSGICCGGGVPETAVLTVWRKSLLFNGNGFTVFDAKGN  56

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  S N+ EIVLMDA+G  L TIRRKRLSL D+W++YDGE A  P +S+RKHV
Sbjct  57   LVFRVDNY-ASGNKGEIVLMDAAGKPLLTIRRKRLSLGDHWLIYDGEEAANPRFSMRKHV  115

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +LL+SK+LAHVT   G GAK     R +EIEGSY+ R C +YD  +R++AEI+RK
Sbjct  116  NLLHSKALAHVTPCHG-GAKSCVGTR-YEIEGSYSQRCCAVYDERQRQLAEIRRK  168



>ref|XP_007207350.1| hypothetical protein PRUPE_ppa011092mg [Prunus persica]
 gb|EMJ08549.1| hypothetical protein PRUPE_ppa011092mg [Prunus persica]
Length=224

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 129/183 (70%), Gaps = 15/183 (8%)
 Frame = +3

Query  81   MTKVHPNAASA-IPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            MTKV+PNAA+A I  A   E L        S     TVLTVWKKSLL NC+GFTVFD+KG
Sbjct  1    MTKVYPNAANAKIALAYEPERLKLSG----SDQEDATVLTVWKKSLLLNCNGFTVFDNKG  56

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            NLV+RVDNY  + ++ EIVLMDA G  L TIRRKRLSL DNWVVYDGETA  P + VRK+
Sbjct  57   NLVFRVDNYL-AGHKGEIVLMDACGKPLLTIRRKRLSLGDNWVVYDGETAVNPRFCVRKN  115

Query  438  VSLL-NSKSLAHVTSLRGSGAKGS------KNARVFEIEGSYANRSCVMYDNVRRRVAEI  596
            V +L N+K LAHVTS   +  KG+      KN+ ++++EGSY  R C +YDN RR+VAEI
Sbjct  116  VGILNNNKCLAHVTS--ANNDKGASKNYDNKNSMLYQVEGSYGQRCCAVYDNKRRKVAEI  173

Query  597  KRK  605
            KRK
Sbjct  174  KRK  176



>ref|XP_002519976.1| GTP binding protein, putative [Ricinus communis]
 gb|EEF42300.1| GTP binding protein, putative [Ricinus communis]
Length=215

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 123/180 (68%), Gaps = 15/180 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPT----VLTVWKKSLLFNCDGFTVFD  248
            MTKV+PN A+A            P    L S    T    VLTVWKKSLLFNC+GFTV+D
Sbjct  1    MTKVYPNIAAA----------STPVVEKLKSSSLDTADAIVLTVWKKSLLFNCNGFTVYD  50

Query  249  DKGNLVYRVDNYYDSSN-RAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYS  425
              GNLV+RVDNY   S    EIVLMDA G  L TIRRKRLSL DNW+VYDGETA  PL+S
Sbjct  51   GSGNLVFRVDNYMAGSGANGEIVLMDADGKPLLTIRRKRLSLGDNWLVYDGETAVNPLFS  110

Query  426  VRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            VRKHV +LN+KSLAHV+    SG+  +    V+EIEGSY+ RSC +YD+  RRVAEIK+K
Sbjct  111  VRKHVKILNTKSLAHVSGNSSSGSTSNSKNIVYEIEGSYSQRSCAVYDDKHRRVAEIKQK  170



>ref|XP_008365623.1| PREDICTED: protein LURP-one-related 8-like [Malus domestica]
Length=219

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 128/182 (70%), Gaps = 12/182 (7%)
 Frame = +3

Query  81   MTKVHPNAASA-IPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            MTKV+PN+A+A I  A   + L        S     TVLTVWKKSLL NC+GFTVFD KG
Sbjct  1    MTKVYPNSANANIVPAYEPQRLNXSG----SDDETATVLTVWKKSLLLNCNGFTVFDSKG  56

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            NLV+RVDNY  + ++ EIVLMDA+G  L TIRRKRLSL DNWVVYDGET + P +   KH
Sbjct  57   NLVFRVDNYL-AGHKGEIVLMDAAGKPLLTIRRKRLSLGDNWVVYDGETTENPRFCATKH  115

Query  438  VSLLNSKSLAHVTSL---RGSGAK---GSKNARVFEIEGSYANRSCVMYDNVRRRVAEIK  599
            V++L +K LAHVTS    +GS A     +KNA  +++EGSYA R C +YD+ RRRVAEIK
Sbjct  116  VNILKNKCLAHVTSANSRKGSDASKNYDNKNAVFYQMEGSYAQRCCAVYDSKRRRVAEIK  175

Query  600  RK  605
            RK
Sbjct  176  RK  177



>ref|XP_002269188.1| PREDICTED: protein LURP-one-related 8 [Vitis vinifera]
 emb|CBI39102.3| unnamed protein product [Vitis vinifera]
Length=200

 Score =   193 bits (490),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 122/175 (70%), Gaps = 13/175 (7%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PNA +A   +   +        C+     P VLTVWKKSLLFNC GFTVFD KGN
Sbjct  1    MTKVYPNATAASSGSEGVK-------LCIGGG-DPAVLTVWKKSLLFNCSGFTVFDGKGN  52

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + N+ EIVLMDASG  L TIRRKRLSL DNW+VYDGETA  P + +RKH+
Sbjct  53   LVFRVDNYV-AGNKGEIVLMDASGKPLLTIRRKRLSLGDNWLVYDGETAANPRFQMRKHL  111

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +LL+SKSLA V+     G+  S    ++EIEGSY+ R C +YD  RR VAEIKRK
Sbjct  112  NLLSSKSLARVS----GGSSSSMRKAMYEIEGSYSQRCCAVYDERRRCVAEIKRK  162



>ref|XP_009337833.1| PREDICTED: protein LURP-one-related 8-like [Pyrus x bretschneideri]
Length=220

 Score =   193 bits (490),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 127/181 (70%), Gaps = 9/181 (5%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PN+A+A    +   E  R      S     TVLTVWKKSLL NC+GFTVFD KGN
Sbjct  1    MTKVYPNSANA--NIVPAYEPQRLNSSSGSDNEAATVLTVWKKSLLLNCNGFTVFDSKGN  58

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + ++ EIVLMDA+G  L TIRRKRLSL DNWVVYDGET + P +   KHV
Sbjct  59   LVFRVDNYL-AGHKGEIVLMDAAGKPLLTIRRKRLSLGDNWVVYDGETTENPRFCATKHV  117

Query  441  SLLNSKSLAHVTSL---RGSGAK---GSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKR  602
            ++L +K LAHVTS    +GS A     +KNA  +++EGSYA R C +YD+ RRRVAEIKR
Sbjct  118  NILKNKCLAHVTSANSRKGSDASKNYDNKNAVFYQMEGSYAQRCCAVYDSKRRRVAEIKR  177

Query  603  K  605
            K
Sbjct  178  K  178



>ref|XP_008793393.1| PREDICTED: protein LURP-one-related 8-like [Phoenix dactylifera]
Length=217

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 124/176 (70%), Gaps = 6/176 (3%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTK+HPNA+SA+  +  +          L   P+ TVLTVW+KSLLFN  GFTVFD KGN
Sbjct  1    MTKIHPNASSAVACSRPEFSGGCCCGGGL---PETTVLTVWRKSLLFNGKGFTVFDAKGN  57

Query  261  LVYRVDNYYDSSNRAE-IVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            LV+RVDNY  +S R E IVLMDA+G  L +IRRKRLSL D+W++YDGE A  P +S RKH
Sbjct  58   LVFRVDNY--ASGRKEGIVLMDAAGKPLLSIRRKRLSLGDHWLIYDGEEAANPRFSARKH  115

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            V+LL+SK+LAHVT  RG G      A  +EI GSY+ R CV+YD  RRR+A I+RK
Sbjct  116  VNLLHSKALAHVTPCRGGGGAKGCVAAHYEIGGSYSQRCCVVYDEQRRRLAGIRRK  171



>ref|XP_011006230.1| PREDICTED: protein LURP-one-related 8-like [Populus euphratica]
Length=215

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 120/176 (68%), Gaps = 7/176 (4%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KV+PN A            P+PA + L       VLTVWKKSLLFNC GFTV+D +GN
Sbjct  1    MIKVYPNVAPTTTNKKQQLFNPKPANNALDVD-HAVVLTVWKKSLLFNCHGFTVYDGRGN  59

Query  261  LVYRVDNYYDSS-NRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            LV+RVDNY  +S N  EIVLMDA+G  L TIRRKRLSL DNW+VY+GET   P + V+KH
Sbjct  60   LVFRVDNYMATSGNNGEIVLMDAAGKPLLTIRRKRLSLGDNWLVYEGETTTNPRFLVKKH  119

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            V++LN+K LAHV     S A GS    V+EIEGSYA R C +YD  +RRVAEIK+K
Sbjct  120  VNILNTKCLAHV-----SPASGSNKNVVYEIEGSYAQRCCAVYDEKKRRVAEIKQK  170



>ref|XP_008244281.1| PREDICTED: protein LURP-one-related 8 [Prunus mume]
Length=224

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 127/182 (70%), Gaps = 13/182 (7%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PNAA+A     A    P       S     TVLTVWKKSLL NC+GFTVFD+KGN
Sbjct  1    MTKVYPNAANA---KFAPAYEPEKLMLSGSDKEDATVLTVWKKSLLLNCNGFTVFDNKGN  57

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + ++ EIVLMDA G  L TIRRKRLSL DNW+V+DGETA  P + VRK+V
Sbjct  58   LVFRVDNYL-AGHKGEIVLMDACGKPLLTIRRKRLSLGDNWMVHDGETAVNPRFCVRKNV  116

Query  441  SLL-NSKSLAHVTSLRGSGAKG------SKNARVFEIEGSYANRSCVMYDNVRRRVAEIK  599
            S+L N+K LAHVTS   +  KG      +KNA ++++EGSY  R C +YDN RR VAEIK
Sbjct  117  SILNNNKCLAHVTS--ANNGKGESKNYDNKNAMLYQVEGSYGQRCCAVYDNRRRMVAEIK  174

Query  600  RK  605
            RK
Sbjct  175  RK  176



>ref|XP_008804638.1| PREDICTED: protein LURP-one-related 8-like [Phoenix dactylifera]
Length=213

 Score =   190 bits (483),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 126/178 (71%), Gaps = 15/178 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSP---PQPTVLTVWKKSLLFNCDGFTVFDD  251
            M KVHPNAAS         ELPRPA  C       P+  VLTVW+KSLLFNC GFTVFD 
Sbjct  1    MPKVHPNAASPA------FELPRPAVSCRGGAVGLPEAAVLTVWRKSLLFNCSGFTVFDA  54

Query  252  KGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVR  431
            KG+LV+RVDNY  S ++ E+VLMDA+G  L TIRRK+LSL D+W++Y+GE    P +SV+
Sbjct  55   KGSLVFRVDNY-GSGSKGEVVLMDAAGKPLLTIRRKKLSLGDHWLIYNGEETVNPRFSVK  113

Query  432  KHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +HV+LL+SK+LAHVT   G+ A G      +E++GSY+ RSC +YD  RR VAE++RK
Sbjct  114  RHVNLLHSKALAHVTPC-GACAGGDG----YEVQGSYSQRSCAVYDERRRPVAEVRRK  166



>ref|XP_008370309.1| PREDICTED: protein LURP-one-related 8 [Malus domestica]
Length=219

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 127/181 (70%), Gaps = 10/181 (6%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PN A+A  T  A E  P+      S     TVLTVWKKSLL +C+GFTVFD KGN
Sbjct  1    MTKVYPNTANA-NTVXAXE--PQRLKSSSSDDENXTVLTVWKKSLLLSCNGFTVFDSKGN  57

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + ++ EIVLMDASG  L TIRRKRLSL DNWVVYDGET   P +   KHV
Sbjct  58   LVFRVDNYL-AGHKGEIVLMDASGKPLLTIRRKRLSLVDNWVVYDGETEVNPRFCATKHV  116

Query  441  SLLNSKSLAHVT---SLRGSGAK---GSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKR  602
            ++L +K LAH+T   S +GSG+     +KNA  +++EGSYA R C +YD+ RRRVAEIK 
Sbjct  117  NILKNKCLAHMTSANSCKGSGSSKNYDNKNAVFYQMEGSYATRCCAVYDSKRRRVAEIKM  176

Query  603  K  605
            K
Sbjct  177  K  177



>ref|XP_002323697.2| hypothetical protein POPTR_0016s14960g [Populus trichocarpa]
 gb|EEF05458.2| hypothetical protein POPTR_0016s14960g [Populus trichocarpa]
Length=215

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 119/176 (68%), Gaps = 7/176 (4%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PN A             +PA + L       VLTVWKKSLLFNC GFTV+D +GN
Sbjct  1    MTKVYPNVAPTTTNKKQQLFNLKPANNALDVD-HAVVLTVWKKSLLFNCHGFTVYDGRGN  59

Query  261  LVYRVDNYYDSS-NRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            LV+RVDNY  +S N  EIVLMDA G  L TIRRKRLSL DNW+VY+GET   P + V+KH
Sbjct  60   LVFRVDNYMATSGNNGEIVLMDAVGKPLLTIRRKRLSLGDNWLVYEGETTTNPRFLVKKH  119

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            V++LN+K LAHV     S A GS    V+EIEGSYA R C +YD  +RRVAEIK+K
Sbjct  120  VNILNTKCLAHV-----SPASGSNKNVVYEIEGSYAQRCCAVYDEKKRRVAEIKQK  170



>ref|XP_002266077.1| PREDICTED: protein LURP-one-related 8 [Vitis vinifera]
 emb|CAN65231.1| hypothetical protein VITISV_007600 [Vitis vinifera]
 emb|CAQ58606.1| unknown gene [Vitis vinifera]
 emb|CAQ58630.1| Unknown gene [Vitis vinifera]
Length=216

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 127/180 (71%), Gaps = 14/180 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PNA +A   +   E +      C+       VLTVWKKSLLFNC+GFTVFD KGN
Sbjct  1    MTKVYPNATAA---SCGSEGVN----LCIGVGRDAAVLTVWKKSLLFNCNGFTVFDGKGN  53

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + ++ EIVLMDASG  L TIRRKRLSL DNW+VYDGETA+ P + VRKH 
Sbjct  54   LVFRVDNYV-AGHKGEIVLMDASGKPLLTIRRKRLSLGDNWMVYDGETAENPRFQVRKHA  112

Query  441  SLLNSKSLAHVTSLRGSGAKGS-----KNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +LLNSKSLA V+   G+G   S     +NA ++EIEGSY+ R C +YD  RR VAEIKRK
Sbjct  113  NLLNSKSLARVSGGGGAGGSSSSSSSPRNA-MYEIEGSYSQRCCAVYDETRRCVAEIKRK  171



>ref|XP_004302498.1| PREDICTED: protein LURP-one-related 8 [Fragaria vesca subsp. 
vesca]
Length=207

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 125/178 (70%), Gaps = 17/178 (10%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALA---DEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDD  251
            MTKV+PN A+A  TA     + E  R     +S   + TVLTVWKKSLL NC+GFTVFD 
Sbjct  1    MTKVYPNGAAAAATANVAAYEAEQKRR----VSGSEEATVLTVWKKSLLLNCNGFTVFDT  56

Query  252  KGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVR  431
            KGNLV+RVDNY  S  + EIVLMDA G  L TIRRKRLSL DNWVVYDGETA+ P + VR
Sbjct  57   KGNLVFRVDNYL-SGRKGEIVLMDAHGKCLLTIRRKRLSLGDNWVVYDGETAENPRFCVR  115

Query  432  KHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            K+V++LN+K LA V          +KN+ ++++EGSYA R C +YD  RR+VAEIKRK
Sbjct  116  KNVNMLNNKYLAQVN---------NKNSVLYQVEGSYAQRCCAVYDGKRRKVAEIKRK  164



>ref|XP_009370857.1| PREDICTED: protein LURP-one-related 8-like [Pyrus x bretschneideri]
Length=219

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 127/181 (70%), Gaps = 10/181 (6%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PN A+A  T  A E  P+      S     TVLTVWKKSLL +C+GFTVFD KGN
Sbjct  1    MTKVYPNTANA-NTVPACE--PQRLKSSGSDDENATVLTVWKKSLLLSCNGFTVFDSKGN  57

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + ++ EIVLMDASG  L TIRRKRLSL DNWVVYDGET   P +   KHV
Sbjct  58   LVFRVDNYL-AGHKGEIVLMDASGKPLLTIRRKRLSLGDNWVVYDGETDVNPRFCATKHV  116

Query  441  SLLNSKSLAHVT---SLRGSGAK---GSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKR  602
            ++L +K LAH+T   S +GSG+     +KNA  +++EGSYA R C +YD+ RR VAEIKR
Sbjct  117  NILKNKCLAHMTSANSCKGSGSSKNYDNKNAVFYQMEGSYAERCCAVYDSKRRGVAEIKR  176

Query  603  K  605
            K
Sbjct  177  K  177



>ref|XP_011084643.1| PREDICTED: protein LURP-one-related 8 [Sesamum indicum]
Length=215

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 126/182 (69%), Gaps = 25/182 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPT---VLTVWKKSLLFNCDGFTVFDD  251
            MTKV+P A   +P       LP+P+  C+ +    +   VLTVW+KSLLFNCDGFTVFD 
Sbjct  1    MTKVYPKA---LP-------LPKPSDGCIKAGADDSSSRVLTVWRKSLLFNCDGFTVFDA  50

Query  252  KGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVR  431
             GNLVYRVDNY  S N+ EI LMDASG SL TIRRK+LSL D+W+V+DGETAD P +   
Sbjct  51   DGNLVYRVDNYM-SGNKGEIFLMDASGTSLLTIRRKKLSLTDSWLVFDGETADNPRFVAT  109

Query  432  KH-VSLLNSKS---LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIK  599
            K+ V+LL SKS   LAHVTS R       KN  V+EIEGSY+ R C +YD  RRRVAE+K
Sbjct  110  KNVVNLLKSKSKRLLAHVTSPR-------KNTAVYEIEGSYSQRCCAVYDEKRRRVAEMK  162

Query  600  RK  605
            +K
Sbjct  163  QK  164



>ref|XP_010113037.1| Protein LURP-one-related 8 [Morus notabilis]
 gb|EXC35208.1| Protein LURP-one-related 8 [Morus notabilis]
Length=221

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 128/180 (71%), Gaps = 8/180 (4%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTK++P+ ASA   + A E+L       L       VLTVW KSLLFNC+GFTV+D KGN
Sbjct  1    MTKIYPSFASANAASAAAEKLKSSGGSELGDSA--VVLTVWTKSLLFNCNGFTVYDGKGN  58

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + N+ EIVLMDASG  L TIRRKRLSL DNW+V+DGETA  P +SVRKHV
Sbjct  59   LVFRVDNYL-AGNKGEIVLMDASGKPLLTIRRKRLSLGDNWLVFDGETASNPRFSVRKHV  117

Query  441  SLLNSKSLAHV----TSLRGSGAKGSKNARV-FEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +LLN++ LAHV     S  G   + SKN+ V +EIEGSY+ RSC +YD  RRRV EI+RK
Sbjct  118  NLLNARCLAHVSSGGGSGSGGSLRSSKNSSVLYEIEGSYSQRSCAVYDQKRRRVVEIRRK  177



>ref|XP_004137667.1| PREDICTED: protein LURP-one-related 8 [Cucumis sativus]
 gb|KGN58676.1| hypothetical protein Csa_3G727940 [Cucumis sativus]
Length=199

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 116/175 (66%), Gaps = 20/175 (11%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV PN              P  +C    S    TVLTVWKKS+L NC+GFTVF+ +GN
Sbjct  1    MTKVFPNG-------------PSSSC----SDAIETVLTVWKKSMLLNCEGFTVFNAEGN  43

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LVYRVDNY  + N+ EI+LMDA+GN LFTIRRKRLSLAD+WVVY+GET   P +S RK +
Sbjct  44   LVYRVDNYL-AGNKGEILLMDAAGNPLFTIRRKRLSLADSWVVYEGETGANPRFSARKQM  102

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +LL SK LA V  L GS +   K   V+EIEG Y  R C +YD  RR VAEIKRK
Sbjct  103  NLLKSKCLARVVELAGSWS--GKGMSVYEIEGCYGKRCCAVYDEKRRIVAEIKRK  155



>ref|XP_006429667.1| hypothetical protein CICLE_v10012703mg [Citrus clementina]
 ref|XP_006481268.1| PREDICTED: protein LURP-one-related 8-like [Citrus sinensis]
 gb|ESR42907.1| hypothetical protein CICLE_v10012703mg [Citrus clementina]
Length=221

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 127/182 (70%), Gaps = 13/182 (7%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELP-RPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            MTKV+PNA  A         +P +P     +S    TVLTVWKKSLLFNC+GFTVFD KG
Sbjct  1    MTKVYPNANVAAAATATAPSIPAKPQ----ASDANATVLTVWKKSLLFNCNGFTVFDSKG  56

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETAD-RPLYSVRK  434
            +LV+RVDNY     + EIVLMDA+G SL TIRRKRLSL DNW+VYDGE  D  P +SV+K
Sbjct  57   DLVFRVDNYIQGV-KGEIVLMDAAGKSLLTIRRKRLSLGDNWLVYDGEKTDVNPRFSVKK  115

Query  435  HVSLLNSKSLAHVTSLRGSGAK-----GSKNARVFEIEGSYANRSCVMYDNVRRRVAEIK  599
            HV++L +K LAHV+   G G+       +KN  ++EIEGSYA R+C +YD  RRRVAEIK
Sbjct  116  HVNILTNKCLAHVSCKGGDGSSSSSPTNNKNV-LYEIEGSYAQRACAVYDGRRRRVAEIK  174

Query  600  RK  605
            +K
Sbjct  175  KK  176



>gb|KDO64215.1| hypothetical protein CISIN_1g027614mg [Citrus sinensis]
Length=221

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 127/182 (70%), Gaps = 13/182 (7%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELP-RPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            MTKV+PNA  A         +P +P     +S    TVLTVWKKSLLFNC+GFTVFD KG
Sbjct  1    MTKVYPNANVAAAATATAPSIPAKPQ----ASDANATVLTVWKKSLLFNCNGFTVFDSKG  56

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETAD-RPLYSVRK  434
            +LV+RVDNY     + EIVLMDA+G SL TIRRKRLSL DNW+VYDGE  D  P +SV+K
Sbjct  57   DLVFRVDNYIQGV-KGEIVLMDAAGKSLLTIRRKRLSLGDNWLVYDGEKTDVNPRFSVKK  115

Query  435  HVSLLNSKSLAHVTSLRGSGAK-----GSKNARVFEIEGSYANRSCVMYDNVRRRVAEIK  599
            HV++L +K LAHV+   G G+       +KN  ++EI+GSYA R+C +YD  RRRVAEIK
Sbjct  116  HVNILTNKCLAHVSCKGGDGSSSSSPTNNKNV-LYEIQGSYAQRACAVYDGRRRRVAEIK  174

Query  600  RK  605
            +K
Sbjct  175  KK  176



>emb|CDO98625.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 121/184 (66%), Gaps = 12/184 (7%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MT+V PNA S       ++  P    H  +    P VLTVWKKSLLFNCDGFTVFD +GN
Sbjct  1    MTRVFPNATSFKEVDQPNQ--PLAIDHGGNLDGGPVVLTVWKKSLLFNCDGFTVFDAEGN  58

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  S  + EIVLMDASG SL TIRRKRLS+ADNW+V+ GE A  P +SVRK V
Sbjct  59   LVFRVDNYM-SGAKGEIVLMDASGKSLLTIRRKRLSIADNWLVFAGEEAVNPRFSVRKQV  117

Query  441  SLLNSKSLAHVTSL---------RGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAE  593
            + LNS+SLA V+ L             +   K   V+EIEGSY  R C +YD+ RRRVAE
Sbjct  118  NFLNSRSLAQVSCLSCCDSGSPSSPCSSSSPKKKLVYEIEGSYKQRCCAVYDDKRRRVAE  177

Query  594  IKRK  605
            IKRK
Sbjct  178  IKRK  181



>gb|KJB35346.1| hypothetical protein B456_006G110200 [Gossypium raimondii]
Length=213

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 124/176 (70%), Gaps = 8/176 (5%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PNA+S   +    E  P+     L++P    +LTVWKKSLLFNC+GFTVF  KG+
Sbjct  1    MTKVYPNASSFSGSGTISERPPK----VLAAPESEAILTVWKKSLLFNCNGFTVFGSKGD  56

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGE-TADRPLYSVRKH  437
            LV+RVDNY D  N+ EI+LMDA+GN L TIRRK++SL D+W+VY GE T+  PL  VRK 
Sbjct  57   LVFRVDNYMD-GNKGEILLMDATGNPLLTIRRKKMSLGDSWLVYKGESTSTNPLLCVRKS  115

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +++LN+K LA+V  + G       N  V+EIEGSY+ RSC +YD+ RR  AEIK+K
Sbjct  116  MNILNNKCLAYV--IPGDNTSNRSNNVVYEIEGSYSQRSCSVYDDRRRLAAEIKKK  169



>ref|XP_008788144.1| PREDICTED: protein LURP-one-related 8-like [Phoenix dactylifera]
Length=211

 Score =   182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 121/177 (68%), Gaps = 18/177 (10%)
 Frame = +3

Query  87   KVHPNAASAIPTALADEELPRPACHCLSSP----PQPTVLTVWKKSLLFNCDGFTVFDDK  254
            KVHPNAA+    AL   ELP PA  C         +  +LTVW+KSLLFNC GFTVFD K
Sbjct  2    KVHPNAAA---PAL---ELPMPAVSCRGGVDGGRQEAAMLTVWRKSLLFNCRGFTVFDAK  55

Query  255  GNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRK  434
            GNLV+RVDNY  S ++ E+VLMDA+G  L TIRRK+LSL D+W++YDGE A  P +SV++
Sbjct  56   GNLVFRVDNY-GSESKGEVVLMDAAGKPLLTIRRKKLSLGDHWLIYDGEEAVNPRFSVKR  114

Query  435  HVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            H++L +SK+L HV    G GA        +++EGSY+ RSCV Y   RR VAE++RK
Sbjct  115  HLNLFHSKALVHVAPCGGGGA-------CYDVEGSYSQRSCVAYGERRRPVAEVRRK  164



>ref|XP_008442309.1| PREDICTED: protein LURP-one-related 8 [Cucumis melo]
Length=199

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 115/175 (66%), Gaps = 20/175 (11%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV PN              P  +C    S    TVLTVWKKS+L NC+GFTVF+  GN
Sbjct  1    MTKVFPNG-------------PSSSC----SDATETVLTVWKKSMLLNCEGFTVFNADGN  43

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LVYRVDNY  + N+ EI+LMDA+G+ LFTIRRKRLSLAD+WVVY+GET   P +S RK +
Sbjct  44   LVYRVDNYL-ADNKGEILLMDAAGSPLFTIRRKRLSLADSWVVYEGETGANPRFSARKQM  102

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +LL SK L  V  L GS +   K   V+EIEG Y  R CV+YD  RR VAEIKRK
Sbjct  103  NLLKSKCLTRVVELAGSWS--GKGMCVYEIEGCYGKRCCVVYDEKRRIVAEIKRK  155



>ref|XP_010922827.1| PREDICTED: protein LURP-one-related 8-like [Elaeis guineensis]
Length=213

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 15/178 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHC---LSSPPQPTVLTVWKKSLLFNCDGFTVFDD  251
            M KVHPNAAS    AL   ELPRPA  C    +   +  VLTVW+KSLLFNC GFTVFD 
Sbjct  1    MAKVHPNAAS---PAL---ELPRPAVSCRGGAAGRQEAAVLTVWRKSLLFNCSGFTVFDA  54

Query  252  KGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVR  431
            KG+LV+RVDNY  S ++ E++LMDA+G  L TIRRK+LSL D+W++Y+GE    P +SV+
Sbjct  55   KGSLVFRVDNY-GSGSKGEVLLMDAAGKPLLTIRRKKLSLGDHWLIYNGEETVNPGFSVK  113

Query  432  KHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +HV+ L SK+LAHVT                E++GSY+ RSC +YD  RR VAE++RK
Sbjct  114  RHVNFLQSKALAHVTP-----CGAGAGGAGHEVQGSYSQRSCAVYDERRRPVAEVRRK  166



>gb|KJB06398.1| hypothetical protein B456_001G120200 [Gossypium raimondii]
Length=212

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 129/175 (74%), Gaps = 6/175 (3%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV PNA+  I  A+++++ P+          + T+LTVWKKSLLFNC+GFTVFD KG+
Sbjct  1    MTKVFPNASFTIGDAISEKQPPQHKLLPAGEASEETILTVWKKSLLFNCNGFTVFDSKGD  60

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY D  N+ EI+LMDASGN L TIRRK++SL D+W+VY+GE+ ++P   V+K V
Sbjct  61   LVFRVDNYMD-GNKGEILLMDASGNPLLTIRRKKMSLGDSWLVYEGESMEKPRLCVKKSV  119

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            ++L SK LA+V+S        S+N  ++EIEGSY+ R+C ++D+ RR VAEIKRK
Sbjct  120  NIL-SKCLAYVSSG----NNNSRNNIMYEIEGSYSQRNCAVFDDKRRLVAEIKRK  169



>ref|XP_009410488.1| PREDICTED: protein LURP-one-related 8-like [Musa acuminata subsp. 
malaccensis]
Length=202

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 124/177 (70%), Gaps = 15/177 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPR-PACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            MT+V+PN A++        +LP  PAC   +      VLTVW+KSLLF+C+GFTVFD +G
Sbjct  1    MTRVYPNTAASCV------DLPSLPACCGATREDGAVVLTVWRKSLLFSCNGFTVFDAEG  54

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            NLV+RVD  Y S +  E+VLMD++G  L T RRK+LSL + W+VY+GE AD PLYSV++ 
Sbjct  55   NLVFRVD-IYGSGSAGELVLMDSAGKPLVTARRKKLSLGETWLVYNGEDADNPLYSVKRQ  113

Query  438  VSLLNSKSLAHVTSLR-GSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            VSLL+ K LAHVT LR GSG+ G      + +EGSY+ RSC +YD  RR VAEI+RK
Sbjct  114  VSLLHCKGLAHVTPLRGGSGSAG------YGVEGSYSRRSCTVYDERRRAVAEIQRK  164



>ref|XP_009399917.1| PREDICTED: protein LURP-one-related 8-like [Musa acuminata subsp. 
malaccensis]
Length=213

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 127/175 (73%), Gaps = 8/175 (5%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPNAA+A    L   E P   C   +   +  VLTVW+KSLLFN +GFTV+D KGN
Sbjct  1    MTKVHPNAAAAAVAELRRAEFP---CAGGARATEAEVLTVWRKSLLFNGNGFTVYDSKGN  57

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + +R E+VLMDA+G  L TIRRK+LSL D+W++Y+GE A  P ++V+KH 
Sbjct  58   LVFRVDNY-SAGSRGEVVLMDAAGRPLLTIRRKKLSLGDHWLIYNGEEAVNPRFAVKKHA  116

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
             LL+SK+LA VT   GSGA   K+   ++IEGSY++R C +YD+ R+++AEIKRK
Sbjct  117  GLLHSKALARVTPC-GSGA---KSCLAYDIEGSYSHRCCAVYDDRRQQLAEIKRK  167



>gb|KHG04426.1| hypothetical protein F383_30201 [Gossypium arboreum]
Length=213

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 123/176 (70%), Gaps = 8/176 (5%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PNA+S   +    E  P+     L++     +LTVWKKSLLFNC+GFTVF  KG+
Sbjct  1    MTKVYPNASSFSGSGTISERPPK----VLAAAESEAILTVWKKSLLFNCNGFTVFGSKGD  56

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGE-TADRPLYSVRKH  437
            LV+RVDNY D  N+ EI+LMDA+GN L TIRRK++SL D+W+VY GE T+  PL  VRK 
Sbjct  57   LVFRVDNYMD-GNKGEILLMDATGNPLLTIRRKKMSLGDSWLVYKGESTSTNPLLCVRKS  115

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +++LN+K LA+V  + G       N  V+EIEGSY+ RSC +YD+ RR  AEIK+K
Sbjct  116  MNILNNKCLAYV--IPGENTSNRSNNVVYEIEGSYSQRSCSVYDDRRRLAAEIKKK  169



>ref|XP_009384338.1| PREDICTED: protein LURP-one-related 8-like [Musa acuminata subsp. 
malaccensis]
Length=213

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 116/175 (66%), Gaps = 8/175 (5%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP  ++ IP    D E P PA           VLTVW+KSLLF+C GFTVFD +GN
Sbjct  1    MTKVHP--SNTIP----DLEFPEPA-GARRKDSNTVVLTVWRKSLLFSCSGFTVFDAEGN  53

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  S +  EIVLMDA+G  L TIRRK+LS    WV+YDGE    PL+SV+KH 
Sbjct  54   LVFRVDNY-GSGSTGEIVLMDAAGKPLLTIRRKKLSFGATWVIYDGEDVVDPLFSVKKHS  112

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +LL+SK LAHVTS              +E+EGSY+ RSC +YD +RR VAEI+RK
Sbjct  113  NLLHSKVLAHVTSPCRRRRHRGGCGAGYEVEGSYSRRSCTVYDEMRRSVAEIRRK  167



>ref|XP_010921246.1| PREDICTED: protein LURP-one-related 8-like isoform X1 [Elaeis 
guineensis]
Length=243

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 125/204 (61%), Gaps = 36/204 (18%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPNA+S   +   D         C    P+  VLTVW+KSLLFN +GFTVFD KGN
Sbjct  1    MTKVHPNASSVEASLRED----FSGICCGGGVPETAVLTVWRKSLLFNGNGFTVFDAKGN  56

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRK---------------------------  359
            LV+RVDNY  S N+ EIVLMDA+G  L TIRRK                           
Sbjct  57   LVFRVDNYA-SGNKGEIVLMDAAGKPLLTIRRKGFDSNEERDVIKKLGDLFWILTRWCSR  115

Query  360  --RLSLADNWVVYDGETADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIE  533
              RLSL D+W++YDGE A  P +S+RKHV+LL+SK+LAHVT   G GAK     R +EIE
Sbjct  116  VQRLSLGDHWLIYDGEEAANPRFSMRKHVNLLHSKALAHVTPCHG-GAKSCVGTR-YEIE  173

Query  534  GSYANRSCVMYDNVRRRVAEIKRK  605
            GSY+ R C +YD  +R++AEI+RK
Sbjct  174  GSYSQRCCAVYDERQRQLAEIRRK  197



>ref|XP_010931417.1| PREDICTED: protein LURP-one-related 8-like isoform X1 [Elaeis 
guineensis]
Length=202

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 119/176 (68%), Gaps = 16/176 (9%)
 Frame = +3

Query  87   KVHPNAASAIPTALADEELPRPACHC---LSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            KVHPNAA+    AL   ELP PA  C   +    +  VLTVW+KSLLFNC GFTVFD  G
Sbjct  2    KVHPNAAA---PAL---ELPMPAISCRGGVGGRQEVAVLTVWRKSLLFNCSGFTVFDANG  55

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            +LV+RVDNY  S ++ E+VLMDA+G  L TIRRK+LSL D+W++++GE A  P +SV+KH
Sbjct  56   SLVFRVDNY-GSDSKGEVVLMDAAGKPLLTIRRKKLSLGDHWLIHNGEEAVNPRFSVKKH  114

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            V+L NSK+LAHV    G G         +E+EGSY+ R C +YD  RR V ++ RK
Sbjct  115  VNLFNSKALAHVAPCSGGGGVD------YEVEGSYSQRCCAVYDEQRRPVVKVHRK  164



>gb|EYU39695.1| hypothetical protein MIMGU_mgv1a013322mg [Erythranthe guttata]
Length=223

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 119/185 (64%), Gaps = 23/185 (12%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPP----QPTVLTVWKKSLLFNCDGFTVFD  248
            MTKV+PNAAS +P A      P P     S        PTVLTVWKKSLLFNCDGFTV+D
Sbjct  1    MTKVYPNAASPLPAAD-----PAPVTENFSGGKGDDRNPTVLTVWKKSLLFNCDGFTVYD  55

Query  249  DKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKRLS-LADNWVVYDGETADRPLY  422
             +GNLVYRVDNY   +   E+VLMDASG+SL TI RRK+L  L D+W VYDGETA  P +
Sbjct  56   ARGNLVYRVDNYISGNRAGEVVLMDASGSSLLTIRRRKKLRLLGDSWSVYDGETAVNPRF  115

Query  423  SVRKHVSLLNSKS----LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVA  590
            SV K+V+L+   S    LA V            NA V+ IEGSY+ R C +YD  RR+VA
Sbjct  116  SVEKNVNLVGGGSSKTVLAQVAE--------KNNASVYGIEGSYSQRRCAVYDGKRRQVA  167

Query  591  EIKRK  605
            EIK+K
Sbjct  168  EIKQK  172



>gb|KHG04896.1| hypothetical protein F383_28888 [Gossypium arboreum]
Length=212

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 128/175 (73%), Gaps = 6/175 (3%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV PNA+  I  A+++++  +          + T+LTVWKKSLLFNC+GFTVFD KG+
Sbjct  1    MTKVFPNASFTIGDAISEKQPRQNKLLSAGETSEETILTVWKKSLLFNCNGFTVFDSKGD  60

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +  N+ EI+LMDASGN L TIRRK++SL D+W+VY+GE+ ++P   V+K V
Sbjct  61   LVFRVDNYME-GNKGEILLMDASGNPLLTIRRKKMSLGDSWLVYEGESMEKPRLCVKKSV  119

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            ++L SK LA+V+S        S+N  ++EIEGSY+ R+C ++D+ RR VAEIKRK
Sbjct  120  NIL-SKCLAYVSSG----NNNSRNNIMYEIEGSYSQRNCAVFDDKRRLVAEIKRK  169



>ref|XP_007015922.1| LURP-one-related 8, putative [Theobroma cacao]
 gb|EOY33541.1| LURP-one-related 8, putative [Theobroma cacao]
Length=215

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 126/177 (71%), Gaps = 10/177 (6%)
 Frame = +3

Query  81   MTKVHPNAA-SAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            MT+V+PNA+ +A   A++   +  P         +  VLTVW KSLLFNC+GFTVFD KG
Sbjct  1    MTRVYPNASFNAGGDAIS---VTPPKLLVADDQKREAVLTVWTKSLLFNCNGFTVFDGKG  57

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            +LVYRVDNY +  N+ EI+LMDA+G  L TIRRK++SL D+W+VY+GET+  P  SVRK 
Sbjct  58   DLVYRVDNYMEG-NKGEILLMDATGKPLLTIRRKKMSLGDSWLVYEGETSVNPRLSVRKS  116

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARV-FEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            V++LNSK LA+V+     G+  ++N  + +EIEGSY+ R C +YD+ RR VAEIKRK
Sbjct  117  VNILNSKCLAYVS----PGSTNNRNNNIMYEIEGSYSQRCCAVYDDKRRLVAEIKRK  169



>ref|XP_009395223.1| PREDICTED: protein LURP-one-related 8-like [Musa acuminata subsp. 
malaccensis]
Length=208

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 116/180 (64%), Gaps = 17/180 (9%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPACHCLS----SPPQPTVLTVWKKSLLFNCDGFTVF  245
            +  KVHPNAA+         E PR A  C            VLTVW+KSLLF+C GFTVF
Sbjct  1    MTRKVHPNAAAPA------REPPRIASCCGGDDAWGKDSAAVLTVWRKSLLFSCSGFTVF  54

Query  246  DDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYS  425
            D KG+LV+RV+ Y  S    E+VLMDA+G  L T+RRKRLSL +NW++YDGE A  PLYS
Sbjct  55   DAKGDLVFRVETY-GSGTAGELVLMDAAGKPLLTLRRKRLSLGENWLIYDGEDAGNPLYS  113

Query  426  VRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            VRKHV+L   K+LAHVT     G  G      +E+EGSY+ RSC ++D+  R VAE+++K
Sbjct  114  VRKHVNLRRCKALAHVTPCGSDGCGG------YEVEGSYSRRSCTVFDDRGRAVAEVQQK  167



>ref|XP_004978499.1| PREDICTED: protein LURP-one-related 8-like [Setaria italica]
Length=215

 Score =   172 bits (437),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 117/180 (65%), Gaps = 21/180 (12%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPNAA        D E P PA   +  PP  TVLTVW+KSLLFNCDGFTVFD KG+
Sbjct  1    MAKVHPNAA--------DTEPPSPAPE-VEEPP--TVLTVWRKSLLFNCDGFTVFDAKGD  49

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLS-LADNWVVYDGETAD----RPLYS  425
            L +RVD Y     RAE+VLMD +G  L T+RRKRLS LA++WV+YDG+ A+    RPL S
Sbjct  50   LAFRVDCYGSGRRRAEVVLMDVAGKPLLTVRRKRLSFLAEHWVIYDGDAAEDESSRPLLS  109

Query  426  VRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            VR+HVSL  SK+LAHVT         S  +  + +EGSY  R+C + D     VAE++RK
Sbjct  110  VRRHVSLRASKALAHVTP-----HAASATSAAYVVEGSYGQRACAVRDARGDAVAEVRRK  164



>ref|XP_010931418.1| PREDICTED: protein LURP-one-related 8-like isoform X2 [Elaeis 
guineensis]
Length=201

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 118/176 (67%), Gaps = 17/176 (10%)
 Frame = +3

Query  87   KVHPNAASAIPTALADEELPRPACHC---LSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            KVHPNAA+    AL   ELP PA  C   +    +  VLTVW+KSLLFNC GFTVFD  G
Sbjct  2    KVHPNAAA---PAL---ELPMPAISCRGGVGGRQEVAVLTVWRKSLLFNCSGFTVFDANG  55

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            +LV+RVDN Y S ++ E+VLMDA+G  L TIRRK LSL D+W++++GE A  P +SV+KH
Sbjct  56   SLVFRVDN-YGSDSKGEVVLMDAAGKPLLTIRRK-LSLGDHWLIHNGEEAVNPRFSVKKH  113

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            V+L NSK+LAHV    G G         +E+EGSY+ R C +YD  RR V ++ RK
Sbjct  114  VNLFNSKALAHVAPCSGGGGVD------YEVEGSYSQRCCAVYDEQRRPVVKVHRK  163



>ref|XP_009417848.1| PREDICTED: protein LURP-one-related 8-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 125/176 (71%), Gaps = 9/176 (5%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPNAA+A   +   E     +C   +   + T LTVW+KSLLFN +GFTVFD KGN
Sbjct  1    MPKVHPNAAAAAAESPTAEA----SCDGRARAAEATALTVWRKSLLFNGNGFTVFDSKGN  56

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  S +  EIVLMDA+G  L TIR+K+LSL D+W+VYDGE A  P ++V+KH 
Sbjct  57   LVFRVDNY-SSGSSDEIVLMDAAGKPLLTIRKKKLSLGDHWLVYDGEEAVNPRFAVKKHK  115

Query  441  SLLNS-KSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
             LL+S K+LA VT+       GSK+  V+++EGSY+ R CV+YD+ RR++AEIK+K
Sbjct  116  GLLHSTKALARVTA---PCTSGSKSRLVYDVEGSYSRRCCVVYDDRRRQLAEIKKK  168



>ref|XP_009406860.1| PREDICTED: protein LURP-one-related 8-like [Musa acuminata subsp. 
malaccensis]
Length=196

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 117/175 (67%), Gaps = 25/175 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPNA+S               C       +   LTVW+KSLLF+ DGFTVFD KGN
Sbjct  1    MTKVHPNASSG-------------GC-------EAAALTVWRKSLLFHGDGFTVFDAKGN  40

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  S ++ EIVLM+A G  L TIRRK+LSL ++W++Y GE    P ++V+K V
Sbjct  41   LVFRVDNY-ASGSKGEIVLMEADGKPLLTIRRKKLSLGEHWLIYQGEEVANPRFAVKKQV  99

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +L++S+S+ HVTS     +  +K+   +E+EGSY+ R C +YD+ RR++A+IKRK
Sbjct  100  NLISSRSVVHVTSC----SSRAKSCLAYEVEGSYSRRCCAVYDDGRRQLAQIKRK  150



>ref|XP_009391657.1| PREDICTED: protein LURP-one-related 8-like [Musa acuminata subsp. 
malaccensis]
Length=213

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 122/179 (68%), Gaps = 16/179 (9%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPAC---HCLSSPPQPTVLTVWKKSLLFNCDGFTVFDD  251
            MTKVHP+A +A       EE PRP         +  + TVLTVW+KSLLFN +GFTVFD 
Sbjct  1    MTKVHPHATAA-------EEPPRPESPRAGGGRAAAEATVLTVWRKSLLFNGNGFTVFDS  53

Query  252  KGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSV-  428
            KG+LV+RVDN Y S +R  IVLMDA+G  L TIRRK+LSL ++W +YDGE A  P ++V 
Sbjct  54   KGHLVFRVDN-YSSGSRDCIVLMDAAGKPLLTIRRKKLSLGEHWRIYDGEEAINPRFAVK  112

Query  429  RKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +KH  LL+SK LA VT      A G+++   ++ EGSY+ R C +YD+ RR++AEI++K
Sbjct  113  KKHTGLLHSKGLARVTPC----ASGTESRLAYDAEGSYSRRCCAIYDSRRRQLAEIQKK  167



>ref|XP_004978498.1| PREDICTED: protein LURP-one-related 8-like [Setaria italica]
Length=215

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 118/185 (64%), Gaps = 29/185 (16%)
 Frame = +3

Query  81   MTKVHPNAASA----IPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFD  248
            M KVHPN A A    I +  A EE P            P VLTVW+KSLLFNCDGFTVFD
Sbjct  1    MAKVHPNGAVAPEPTISSGAAAEEQP------------PAVLTVWRKSLLFNCDGFTVFD  48

Query  249  DKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLS-LADNWVVYDGETAD----R  413
             KG+L +RVD Y  S  RAE+VLMD +G  L T+RRKRLS L ++WV+YDG+ A+    +
Sbjct  49   AKGDLAFRVDCYGSSRRRAEVVLMDVAGKPLLTVRRKRLSLLGEHWVIYDGDAAEHKSSK  108

Query  414  PLYSVRKHVSL-LNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVA  590
            PL SVR+HVSL  +SK+LAHVT +       + +   F +EGSY  R+C + D+    VA
Sbjct  109  PLLSVRRHVSLRASSKTLAHVTPV-------ASSTSAFVVEGSYGRRACAVRDSRGDAVA  161

Query  591  EIKRK  605
            E++RK
Sbjct  162  EVRRK  166



>ref|XP_009383277.1| PREDICTED: protein LURP-one-related 8-like [Musa acuminata subsp. 
malaccensis]
Length=199

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 122/176 (69%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            +MTKVHP+AA+   T    E++ R       +     VLTVW+KSLLF+C GFTVFD +G
Sbjct  1    MMTKVHPSAAACCATG---EDVGR-------NGFGVKVLTVWRKSLLFSCRGFTVFDAEG  50

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKH  437
            +LV+RVD Y  S +  E+VLMDA+G  L T+RRK+LSL + W+VYDGE A  PL SV+KH
Sbjct  51   SLVFRVDTY-GSGSTGEVVLMDAAGKPLLTLRRKKLSLGEKWLVYDGEDAVNPLCSVKKH  109

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            VSLL+S++LAHVT       +G   A  +E+EGSYA RSC +YD  RRRVAEI+ K
Sbjct  110  VSLLHSRALAHVTPC----RRGGGGAYGYEVEGSYARRSCAVYDRRRRRVAEIREK  161



>gb|EMT22804.1| hypothetical protein F775_12487 [Aegilops tauschii]
Length=206

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 114/176 (65%), Gaps = 16/176 (9%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN    +P   A +E P   C   SS  +PT  TVW++SLLF+C GFTVFD KGN
Sbjct  1    MAKVHPNM---VPAPGAVDEAP---CAPSSSTEEPTTPTVWRQSLLFDCKGFTVFDAKGN  54

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETADRPLYSVRKH  437
            L YRVD+Y   S   E+VLMDA+G   FT+RRKR SL  + W+V+ GE   R +Y+VR+ 
Sbjct  55   LAYRVDSYASESGD-EVVLMDAAGCPAFTVRRKRFSLQGEQWLVFSGEETRRAVYTVRRS  113

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                  K+LAHVT+  G+GA  S     +E+EGSYA RSCV+YD  RR VAEI+ K
Sbjct  114  ---GRGKTLAHVTACGGAGAGPS-----YEVEGSYARRSCVVYDGERRAVAEIRPK  161



>ref|XP_009417847.1| PREDICTED: protein LURP-one-related 8-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=227

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 125/182 (69%), Gaps = 15/182 (8%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPNAA+A   +   E     +C   +   + T LTVW+KSLLFN +GFTVFD KGN
Sbjct  1    MPKVHPNAAAAAAESPTAEA----SCDGRARAAEATALTVWRKSLLFNGNGFTVFDSKGN  56

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR------LSLADNWVVYDGETADRPLY  422
            LV+RVDN Y S +  EIVLMDA+G  L TIR+KR      LSL D+W+VYDGE A  P +
Sbjct  57   LVFRVDN-YSSGSSDEIVLMDAAGKPLLTIRKKRVFMMQKLSLGDHWLVYDGEEAVNPRF  115

Query  423  SVRKHVSLLNS-KSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIK  599
            +V+KH  LL+S K+LA VT+       GSK+  V+++EGSY+ R CV+YD+ RR++AEIK
Sbjct  116  AVKKHKGLLHSTKALARVTA---PCTSGSKSRLVYDVEGSYSRRCCVVYDDRRRQLAEIK  172

Query  600  RK  605
            +K
Sbjct  173  KK  174



>gb|EMS64898.1| Protein LURP-one-related 8 [Triticum urartu]
Length=277

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 16/176 (9%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN    +P   A ++ P   C   SS  +PT LTVW+KSLLF+C GFTVFD KGN
Sbjct  72   MAKVHPNM---VPAPGAVDQAP---CPPASSTEEPTTLTVWRKSLLFDCKGFTVFDAKGN  125

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETADRPLYSVRKH  437
            L YRVD+Y   S   E+VLMDA+G   FT+RRKR +L  + W+V+ GE   +P+Y+VR+ 
Sbjct  126  LAYRVDSYASESGD-EVVLMDAAGRPAFTVRRKRFTLQGEQWLVFSGEETRKPVYTVRRS  184

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                  K+ AHVT+  G+GA  S     +E+EGSYA RSCV+YD  RR VAEI+ K
Sbjct  185  G---RGKTSAHVTACAGAGAGPS-----YEVEGSYARRSCVVYDGERRAVAEIRPK  232



>ref|XP_010553189.1| PREDICTED: protein LURP-one-related 8 [Tarenaya hassleriana]
Length=192

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 117/179 (65%), Gaps = 31/179 (17%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPN A                  C S   + +VLTVWKKSLLFNC+GFTV+D KGN
Sbjct  1    MTKVHPNNA------------------CTSFDERASVLTVWKKSLLFNCEGFTVYDGKGN  42

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLS-LADNWVVYDGETADRPLYSVRKH  437
            LV+RVDNY +  ++ +IVLM+ASG  L TIRRK+LS L D W+VYDGET   P +  RKH
Sbjct  43   LVFRVDNYMN-GHKHKIVLMNASGEPLLTIRRKKLSLLGDCWLVYDGETERDPRFCARKH  101

Query  438  VSLL--NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVA-EIKRK  605
            VS++  NSKSLA+V S        +K   ++EIEGSY+ RSC + D  R+R A E+KRK
Sbjct  102  VSIMPKNSKSLAYVMS--------TKKTTLYEIEGSYSQRSCRILDEKRKRKAGEMKRK  152



>emb|CBI31137.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 8/133 (6%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PNA +A   +   E +      C+       VLTVWKKSLLFNC+GFTVFD KGN
Sbjct  1    MTKVYPNATAA---SCGSEGVN----LCIGVGRDAAVLTVWKKSLLFNCNGFTVFDGKGN  53

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + ++ EIVLMDASG  L TIRRKRLSL DNW+VYDGETA+ P + VRKH 
Sbjct  54   LVFRVDNYV-AGHKGEIVLMDASGKPLLTIRRKRLSLGDNWMVYDGETAENPRFQVRKHA  112

Query  441  SLLNSKSLAHVTS  479
            +LLNSKSLA V+ 
Sbjct  113  NLLNSKSLARVSG  125



>emb|CDM84729.1| unnamed protein product [Triticum aestivum]
 emb|CDM84742.1| unnamed protein product [Triticum aestivum]
Length=205

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 112/176 (64%), Gaps = 17/176 (10%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M +VHPN   A P A+ D     P     S+   PT LTVW+KSLLF+C GFTVFD KGN
Sbjct  1    MARVHPNMVPA-PGAVGDV----PCAPASSAVEGPTTLTVWRKSLLFDCKGFTVFDAKGN  55

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETADRPLYSVRKH  437
            L YRVD+ Y S    E+VLMDA+G   FT+RRKR SL  + W+V+ GE   RP+Y+VR+ 
Sbjct  56   LAYRVDS-YASETGDEVVLMDAAGRPSFTVRRKRFSLQGEQWLVFAGEETRRPVYAVRRS  114

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                  K++AHVT+  G+G         +E+EGSYA RSCV+YD  RR VAEI+ K
Sbjct  115  ---GRGKTMAHVTACAGAGPS-------YEVEGSYAQRSCVVYDGQRRAVAEIRPK  160



>ref|XP_004977407.1| PREDICTED: protein LURP-one-related 8-like [Setaria italica]
Length=232

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 113/180 (63%), Gaps = 20/180 (11%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPNAA          E+  P          PTVLTVW+KSLLFNCDGFTVFD KG+
Sbjct  17   MAKVHPNAADPAEPPSPAPEVEEP----------PTVLTVWRKSLLFNCDGFTVFDAKGD  66

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLS-LADNWVVYDGETAD----RPLYS  425
            L +RVD Y     RAE+VLMD +G  L T+RRKRLS LA++WV+YDG+ A+    RPL S
Sbjct  67   LAFRVDCYGSGRRRAEVVLMDVAGKPLLTVRRKRLSFLAEHWVIYDGDAAEDESSRPLLS  126

Query  426  VRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            VR+HVSL  SK+LAHVT         S  +  + +EGSY  R+C + D     VAE++RK
Sbjct  127  VRRHVSLRASKALAHVTP-----HAASATSATYVVEGSYGRRACAVRDARGDAVAEVRRK  181



>gb|EMT17787.1| hypothetical protein F775_12401 [Aegilops tauschii]
Length=201

 Score =   161 bits (408),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 11/164 (7%)
 Frame = +3

Query  117  PTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSS  296
            P   A  E P   C   SS   PT LTVW+KSLLF+C GFTVFD KGNL YRVD+Y   S
Sbjct  3    PAPGAVGEAP---CAPASSAEGPTTLTVWRKSLLFDCKGFTVFDAKGNLAYRVDSYASES  59

Query  297  NRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETADRPLYSVRKHVSLLNSKSLAHV  473
               E+VLMDA+G   FT+RRKR SL  + W+V+ GE   RP+Y+VR+       K+LAHV
Sbjct  60   GD-EVVLMDAAGRPPFTVRRKRFSLQGEQWLVFSGEETRRPVYTVRRS---GRGKTLAHV  115

Query  474  TSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            T+  G+GA  S +   +E+EGSYA RSCV+YD  RR VAEI+ K
Sbjct  116  TACAGAGAGPSYD---YEVEGSYARRSCVVYDGERRAVAEIRPK  156



>ref|XP_010553182.1| PREDICTED: protein LURP-one-related 8-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010553183.1| PREDICTED: protein LURP-one-related 8-like isoform X2 [Tarenaya 
hassleriana]
Length=190

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 26/176 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+P    A+  A               S    T LTVWKKSLLFNC+GFTVFD KG+
Sbjct  1    MTKVYPKG-EAVEKA---------------STSATTELTVWKKSLLFNCNGFTVFDPKGD  44

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LSLADNWVVYDGETADRPLYSVRKH  437
            L++RVDNY +  +R + +LMDA+G  L TIRRKR LSL D WVV DGET   PL+S+RK+
Sbjct  45   LIFRVDNYME-GHRGQTLLMDAAGKPLLTIRRKRKLSLGDCWVVCDGETTSNPLFSMRKN  103

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            VS+LNSKSLA+ +       KG   A ++E+EGSY  R C +YD  RR++AE++ K
Sbjct  104  VSVLNSKSLAYASK------KG--RAVLYEVEGSYGKRCCTVYDGKRRKMAEVRSK  151



>dbj|BAK04409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=238

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 116/176 (66%), Gaps = 13/176 (7%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M +VHPN A A P A+ D+    PA    S+   PT LTVW+KSLLF+C GFTVFD  G+
Sbjct  32   MARVHPNIAPA-PGAV-DKAPANPA----SAAEGPTTLTVWRKSLLFDCKGFTVFDAVGD  85

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETADRPLYSVRKH  437
            L YRVD+Y   +   E+VLMDA+G   FT+RRKR SL  + W+V+ GE   RP+Y+VR+ 
Sbjct  86   LAYRVDSYASETGD-EVVLMDAAGRPAFTVRRKRFSLQGEQWLVFAGEETRRPVYAVRRS  144

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                  K++AHVT+  G+GA  S  +  FE+EGSYA RSCV+YD  RR VAEI  K
Sbjct  145  ---GRGKTMAHVTACAGAGAGPSSPS--FEVEGSYARRSCVVYDGERRAVAEIMPK  195



>ref|XP_009404681.1| PREDICTED: protein LURP-one-related 8-like [Musa acuminata subsp. 
malaccensis]
Length=203

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 102/140 (73%), Gaps = 5/140 (4%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRL  365
             VLTVW++SLLFN +GF VFD KGNLV+RVDNY  S ++AE++LMDA+G  L TIRRK+L
Sbjct  28   AVLTVWRRSLLFNGNGFAVFDAKGNLVFRVDNY-ASGSKAEVLLMDAAGKPLLTIRRKKL  86

Query  366  SLADNWVVYDGETADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYA  545
            SL D W++Y+GE A  P ++ ++HVSLL+  +LAHVT        G+K    +EI+GSY 
Sbjct  87   SLKDQWLIYEGEEAANPRFAAKRHVSLLHHGALAHVTPC----VSGAKPCHAYEIQGSYL  142

Query  546  NRSCVMYDNVRRRVAEIKRK  605
             R C + D+ RR++ EIKRK
Sbjct  143  QRCCAVVDDKRRQLMEIKRK  162



>emb|CDM84727.1| unnamed protein product [Triticum aestivum]
Length=203

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 111/176 (63%), Gaps = 17/176 (10%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M +VHPN   A P A+ D     P     S+   PT LTVW+KSLLF+C GFTVFD KGN
Sbjct  1    MARVHPNMVPA-PGAVGDV----PCAPASSAVEGPTTLTVWRKSLLFDCKGFTVFDAKGN  55

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETADRPLYSVRKH  437
            L YRVD+ Y S    E+VLMDA+G   FT+RRKR SL  + W+V+ GE   RP+Y+VR+ 
Sbjct  56   LAYRVDS-YASETGDEVVLMDAAGRPSFTVRRKRFSLQGEQWLVFAGEETRRPVYAVRRS  114

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                  K++AHVT+  G+G         +E+EGSYA RSCV+YD  RR V EI+ K
Sbjct  115  ---GRGKTMAHVTACAGAGPS-------YEVEGSYARRSCVVYDGERRAVVEIRPK  160



>gb|ERN04305.1| hypothetical protein AMTR_s00077p00184480 [Amborella trichopoda]
Length=208

 Score =   159 bits (402),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 119/177 (67%), Gaps = 24/177 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PNAAS         E+PRP    ++  P  T LTVWKKSLLFNC+GFTV+D +GN
Sbjct  1    MTKVYPNAAS---------EVPRP----VTRGPVVT-LTVWKKSLLFNCNGFTVYDSRGN  46

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGE--TADRPLYSVRK  434
            LV+RVDNY  S ++ E+VLMDA G SL T+RRK LSL+D+W+++DG+  +  +P +S++K
Sbjct  47   LVFRVDNYL-SDHKGELVLMDACGKSLLTLRRKMLSLSDHWLIFDGDFGSGAKPRFSMKK  105

Query  435  HVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
              + LN KSLAHV S        +    ++EIEG Y+ R C + D  ++ VAEIK K
Sbjct  106  SRNFLNPKSLAHVFS-------SASKTPIYEIEGIYSQRCCTILDEKQQHVAEIKCK  155



>gb|KJB21683.1| hypothetical protein B456_004G008600 [Gossypium raimondii]
Length=229

 Score =   160 bits (404),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 119/180 (66%), Gaps = 24/180 (13%)
 Frame = +3

Query  81   MTKVHPNAA--SAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDK  254
            MTKV+PNA+    +P   A+ E                V+TVWKKSL+FNC+GFTVFD K
Sbjct  31   MTKVYPNASFTGGVPPCKAEME---------------EVMTVWKKSLIFNCNGFTVFDGK  75

Query  255  GNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLS--LADNWVVYDG-ETADRPLYS  425
            G+LVYRVDNY +  N+  I+LMDA+G +L T+RRK++S  L DNW+VY+G ET   P  S
Sbjct  76   GDLVYRVDNYME-GNKGSILLMDANGKALLTLRRKKMSLGLGDNWLVYEGEETMAIPRLS  134

Query  426  VRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            V+K +++ N+K LA+VT+     + G  N  ++EIEGSY+ R C + D+ RR  AEIKRK
Sbjct  135  VKKSLNIFNNKCLAYVTA---GESDGRNNKTMYEIEGSYSRRCCAVSDDRRRLAAEIKRK  191



>emb|CDM84728.1| unnamed protein product [Triticum aestivum]
Length=206

 Score =   159 bits (402),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 112/176 (64%), Gaps = 16/176 (9%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN    +P   A +  P   C   SS   PT LTVW+KSLLF+C GFTVF+ KGN
Sbjct  1    MAKVHPNM---VPAPGAVDRTP---CAPASSTEGPTTLTVWRKSLLFDCKGFTVFNTKGN  54

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETADRPLYSVRKH  437
            L YRVD+Y   S   E+VLMDA+G   FT+RRKR SL  + W+V+ GE   RP+Y+V++ 
Sbjct  55   LAYRVDSYASESGD-EVVLMDAAGRPAFTVRRKRFSLQGEQWLVFSGEETRRPVYTVKRS  113

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                  K+LAHVT+  G+ A  S     +++EGSYA RSCV+YD  RR VAEI  K
Sbjct  114  GC---GKTLAHVTACAGAVAGPS-----YDVEGSYARRSCVVYDGERRAVAEITPK  161



>dbj|BAK07033.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 112/176 (64%), Gaps = 15/176 (9%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN A A P A+             S+   PT LTVW+KSLLF+C GFTVFD KGN
Sbjct  1    MAKVHPNMAPA-PGAVDRAP----CAPASSAAEGPTTLTVWRKSLLFDCKGFTVFDVKGN  55

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETADRPLYSVRKH  437
            L YRVD+Y   S   E+VLMDA+G   FT+RRKR SL  + W+V+ GE   RP+Y+VR+ 
Sbjct  56   LAYRVDSYASESGD-EVVLMDAAGRPAFTVRRKRFSLQGEQWLVFAGEETRRPVYAVRRS  114

Query  438  VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                  K++AHVT+  G+GA  S     +E+EGSYA RSCV+YD  RR VAEI  K
Sbjct  115  ---GRGKTMAHVTACAGAGAGPS-----YEVEGSYARRSCVVYDGERRTVAEIMPK  162



>ref|XP_006842630.2| PREDICTED: protein LURP-one-related 8 [Amborella trichopoda]
Length=236

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 119/177 (67%), Gaps = 24/177 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+PNAAS         E+PRP    ++  P  T LTVWKKSLLFNC+GFTV+D +GN
Sbjct  29   MTKVYPNAAS---------EVPRP----VTRGPVVT-LTVWKKSLLFNCNGFTVYDSRGN  74

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGE--TADRPLYSVRK  434
            LV+RVDNY  S ++ E+VLMDA G SL T+RRK LSL+D+W+++DG+  +  +P +S++K
Sbjct  75   LVFRVDNYL-SDHKGELVLMDACGKSLLTLRRKMLSLSDHWLIFDGDFGSGAKPRFSMKK  133

Query  435  HVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
              + LN KSLAHV S        +    ++EIEG Y+ R C + D  ++ VAEIK K
Sbjct  134  SRNFLNPKSLAHVFS-------SASKTPIYEIEGIYSQRCCTILDEKQQHVAEIKCK  183



>ref|XP_010044440.1| PREDICTED: protein LURP-one-related 8 [Eucalyptus grandis]
Length=230

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 120/197 (61%), Gaps = 29/197 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPNAA+A   A A           LS   +  VLTVWKKSLL NC+GFTVFD KGN
Sbjct  1    MTKVHPNAAAAAAQAAAPAR-----GFSLSYGKEE-VLTVWKKSLLLNCNGFTVFDCKGN  54

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY  + N+ E+VLMDA+G  L T+RRKRLSL+DNW V+DGE A  P ++ RK+ 
Sbjct  55   LVFRVDNYL-AGNKGEVVLMDAAGKPLLTVRRKRLSLSDNWQVFDGEGAANPRFTARKNA  113

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNAR----------------------VFEIEGSYANRS  554
            +LLN+K LA V++   +G      +                        +EIEGSYA R 
Sbjct  114  NLLNNKGLAQVSNGAAAGGGSGSGSSSPSSAPSSPSSSWSPRSGGRNVAYEIEGSYAQRR  173

Query  555  CVMYDNVRRRVAEIKRK  605
            C +YD  RR VAEI++K
Sbjct  174  CTVYDATRRVVAEIRQK  190



>gb|EAY82072.1| hypothetical protein OsI_37268 [Oryza sativa Indica Group]
Length=224

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 114/192 (59%), Gaps = 30/192 (16%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPACHCLSS---------PPQPTVLTVWKKSLLFNCD  230
            +  KVHPN A+A          PRP C   +S            P VLTVW+KSLLFNC 
Sbjct  1    MAAKVHPNVAAA----------PRPPCITTTSIVSQQQQEEEEPPVVLTVWRKSLLFNCH  50

Query  231  GFTVFDDKGNLVYRVDNY-YDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETA  407
            GFTVFD KGNL +R+D Y   SS RA++VLMDA+G  L TIRRKRLSL D+W++YDG+ A
Sbjct  51   GFTVFDAKGNLAFRLDCYDATSSRRADLVLMDAAGKPLLTIRRKRLSLYDSWIIYDGDGA  110

Query  408  ----DRPLYSVRKH--VSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYD  569
                  PL SVR+H  V L  SK++AHVT L  S          + +EGSY  RSC + D
Sbjct  111  ATATATPLLSVRRHRRVGLRASKAIAHVTPLSSS----LPLPEAYVVEGSYGRRSCAVRD  166

Query  570  NVRRRVAEIKRK  605
                 VAE++RK
Sbjct  167  ARGDAVAEVRRK  178



>ref|NP_181398.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9ZVI6.1|LOR8_ARATH RecName: Full=Protein LURP-one-related 8 [Arabidopsis thaliana]
 gb|AAC67354.1| unknown protein [Arabidopsis thaliana]
 gb|AAX49367.1| At2g38640 [Arabidopsis thaliana]
 dbj|BAE98840.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09560.1| uncharacterized protein AT2G38640 [Arabidopsis thaliana]
Length=196

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 111/178 (62%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   S    +L D +                VLTVWKKSLLFNCDGFTV++  G 
Sbjct  1    MTKVHPKFPSTCEESLCDSK-------------AAVVLTVWKKSLLFNCDGFTVYNANGE  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +   R  IVLMDASG  L +IRRK+LSL D W+VYDGET   P+++ RK+V
Sbjct  48   LVFRVDNYMNCP-RDNIVLMDASGFPLLSIRRKKLSLGDCWMVYDGETERDPIFTARKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            S++ N KSLA V+         +K   ++EIEGSY  RSC + D  R  ++ AEIKRK
Sbjct  107  SIISNRKSLAWVS---------AKKTVLYEIEGSYGQRSCKILDERRNKKKTAEIKRK  155



>emb|CDY18377.1| BnaA04g22100D [Brassica napus]
Length=196

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVWKKSLLFNCDGFTV++  G+
Sbjct  1    MTKVHPKFPNTCEESLCDSK-------------AAAVLTVWKKSLLFNCDGFTVYNSSGD  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +SS +  IVLMDASG  L +IRRK+LSL D W+VYDGET   P+++ RK+V
Sbjct  48   LVFRVDNYMNSS-KDNIVLMDASGLPLLSIRRKKLSLGDCWMVYDGETQRDPIFTARKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            S++ N +SLA V+         +K   ++EIEGS+  RSC + D  R  ++ AEIKRK
Sbjct  107  SIMTNRRSLAWVS---------TKKTLLYEIEGSFGQRSCKILDERRNKKKAAEIKRK  155



>emb|CDY62436.1| BnaC03g72180D [Brassica napus]
Length=196

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 113/178 (63%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVW+KSLLFNCDGFTV++  GN
Sbjct  1    MTKVHPKFPNTYEESLCDSK-------------AAVVLTVWRKSLLFNCDGFTVYNSNGN  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +S+ R  IVLMDASG  L +IRRK+LS+ D W VYDGET   P+++ +K+V
Sbjct  48   LVFRVDNYMNST-RDNIVLMDASGLPLLSIRRKKLSMGDCWAVYDGETQRDPIFTAKKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            S+L N +SLA V+         +K   ++E+EGSY  RSC + D  R  R+ AEIKRK
Sbjct  107  SILTNKRSLAWVS---------AKKTILYEVEGSYGQRSCKIVDVRRNKRKTAEIKRK  155



>emb|CDX93313.1| BnaC04g45830D [Brassica napus]
Length=196

 Score =   154 bits (388),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVWKKSLLFNCDGFTV++  G+
Sbjct  1    MTKVHPKFPNTCEESLCDSK-------------AAAVLTVWKKSLLFNCDGFTVYNSSGD  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +S+ + +IVLMDASG  L +IRRK+LSL D W+VYDGET   P+++ RK+V
Sbjct  48   LVFRVDNYMNST-KDKIVLMDASGLPLLSIRRKKLSLGDCWMVYDGETQRDPIFTARKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNV--RRRVAEIKRK  605
            S++ N +SLA V+         +K   ++EIEGS+  RSC + D    +++ AEIKRK
Sbjct  107  SIMTNRRSLAWVS---------TKKTLLYEIEGSFGQRSCKILDERMNKKKAAEIKRK  155



>ref|XP_009141749.1| PREDICTED: protein LURP-one-related 8-like [Brassica rapa]
Length=196

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 112/178 (63%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP             +LP      L       VLTVWKKSLLFNCDGFTV++  G+
Sbjct  1    MTKVHP-------------KLPNTCEESLCDSKAAAVLTVWKKSLLFNCDGFTVYNSNGD  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +SS +  IVLMDA G  L +IRRK+LSL D W+VYDGET   P+++ RK+V
Sbjct  48   LVFRVDNYMNSS-KDNIVLMDAYGLPLLSIRRKKLSLGDCWMVYDGETQRDPIFTARKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            S++ N +SLA V+         +K   ++EIEGS+  RSC + D  R  ++ AEIKRK
Sbjct  107  SIMTNRRSLAWVS---------TKKTLLYEIEGSFGQRSCKILDERRNKKKAAEIKRK  155



>emb|CDX91482.1| BnaC04g06680D [Brassica napus]
Length=195

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 112/178 (63%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +             +  VLTVWKKSLLFNCDGFTV++  G 
Sbjct  1    MTKVHPKFQNTCEESLCDSK-------------EAVVLTVWKKSLLFNCDGFTVYNSNGE  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +   +  IVLMDASG  L +IRRK+LSL D W+VYDGET   P+++ +K+V
Sbjct  48   LVFRVDNYMNCP-KDNIVLMDASGLPLLSIRRKKLSLGDWWMVYDGETQRDPIFTAKKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            S++ N KSL  V+         SK   ++EIEGSY+ RSC + D  R  ++ AEIKRK
Sbjct  107  SIMTNKKSLVSVS---------SKKTVLYEIEGSYSQRSCKILDERRNKKKTAEIKRK  155



>ref|XP_009143370.1| PREDICTED: protein LURP-one-related 8 [Brassica rapa]
Length=195

 Score =   153 bits (387),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 112/178 (63%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +             +  VLTVWKKSLLFNCDGFTV++  G 
Sbjct  1    MTKVHPKFQNTCEESLCDSK-------------EAVVLTVWKKSLLFNCDGFTVYNSNGE  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +   +  IVLMDASG  L +IRRK+LSL D W+VYDGET   P+++ +K+V
Sbjct  48   LVFRVDNYMNCP-KDNIVLMDASGLPLLSIRRKKLSLGDCWMVYDGETQRDPMFTAKKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            S++ N +SL  V+         SK   ++EIEGSY+ RSC + D  R  ++ AEIKRK
Sbjct  107  SIMTNKRSLVSVS---------SKKTVLYEIEGSYSQRSCKILDERRNKKKTAEIKRK  155



>emb|CDY07715.1| BnaA03g17960D [Brassica napus]
Length=196

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 114/179 (64%), Gaps = 28/179 (16%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVW+KSLLFNCDGFTV++  GN
Sbjct  1    MTKVHPKFPNTYEESLCDSK-------------AAVVLTVWRKSLLFNCDGFTVYNSNGN  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +S+ R  IVLMDASG  L +IRRK+LS+ D W VYDGET   P+++ +K+V
Sbjct  48   LVFRVDNYMNST-RDNIVLMDASGLPLLSIRRKKLSMGDCWAVYDGETQRDPIFTAKKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRR---RVAEIKRK  605
            S+L N +SLA V+         +K   ++E+EGSY  RSC + D VRR   + AEIKRK
Sbjct  107  SILTNKRSLAWVS---------AKKTILYEVEGSYGQRSCKIVD-VRRNKKKTAEIKRK  155



>ref|XP_006843503.1| PREDICTED: protein LURP-one-related 8 [Amborella trichopoda]
 gb|ERN05178.1| hypothetical protein AMTR_s00053p00223120 [Amborella trichopoda]
Length=240

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 112/177 (63%), Gaps = 23/177 (13%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPN            E  +       S    TVLTVWKKSLL +C GFTVFD +GN
Sbjct  42   MTKVHPNGFL--------REFRQ------DSDGSATVLTVWKKSLLLSCSGFTVFDSRGN  87

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGE--TADRPLYSVRK  434
            LV+RVDNY  + NR E+VLMD  G +LFT+RRK+LSL++ W V++GE  +   P++S+RK
Sbjct  88   LVFRVDNYV-AGNREELVLMDFEGKTLFTMRRKKLSLSEQWQVFEGEALSPSPPIFSMRK  146

Query  435  HVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            H SLL SK LAHV   RG   K       +++EGSY+ R C +++   R VAEIKRK
Sbjct  147  HSSLLQSKVLAHV--YRGCDTK----RWAYQVEGSYSRRICEIHNEAHRVVAEIKRK  197



>ref|XP_009381350.1| PREDICTED: protein LURP-one-related 8-like [Musa acuminata subsp. 
malaccensis]
Length=209

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 113/185 (61%), Gaps = 24/185 (13%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPAC-------HCLSSPPQPTVLTVWKKSLLFNCDGFT  239
            M KVHPN  SA+P+     ELPR A                  VLTVW+KSLLF+C+GFT
Sbjct  1    MAKVHPN--SAVPSL----ELPRLATCGNGADSSAAGRKENAAVLTVWRKSLLFSCNGFT  54

Query  240  VFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPL  419
            VFD +GNL +RVD  Y S    ++VLMDA+G  L T+RRK+LSL + W++Y GE    P+
Sbjct  55   VFDAEGNLAFRVD-VYGSGTPEDLVLMDAAGKPLLTVRRKKLSLGEKWLMYGGEDTVNPI  113

Query  420  YSVRKHVSLLNSK---SLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVA  590
            Y V++ V+LL SK   ++AHV   RG G         +E+EGSY+ RSC +YD  R  VA
Sbjct  114  YVVKRRVTLLPSKPTAAIAHVAQCRGGGPG-------YEVEGSYSRRSCTIYDKRRLVVA  166

Query  591  EIKRK  605
            E++ K
Sbjct  167  EVRPK  171



>ref|XP_006398550.1| hypothetical protein EUTSA_v10014772mg [Eutrema salsugineum]
 gb|ESQ40003.1| hypothetical protein EUTSA_v10014772mg [Eutrema salsugineum]
Length=187

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 107/175 (61%), Gaps = 23/175 (13%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHP   +     +  E                +VLTVW KSL+FNC+GFTVFD KG+
Sbjct  1    MAKVHPKGGNNRSLEMGGE---------------ASVLTVWNKSLMFNCNGFTVFDSKGD  45

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY   S R +I+LMDASG  L TIRRKRLS  D W+V +GETA +P  +VRK +
Sbjct  46   LVFRVDNYMHGS-RGQILLMDASGKPLLTIRRKRLSFGDCWLVCEGETALKPQLTVRKCL  104

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            ++L +K LA+ T       + +     + I+GSY+ R CV+YD  +R+V E+ RK
Sbjct  105  NILKTKRLAYAT-------RTNSQTTTYNIQGSYSGRHCVVYDANQRKVGELIRK  152



>ref|XP_007134598.1| hypothetical protein PHAVU_010G060200g [Phaseolus vulgaris]
 gb|ESW06592.1| hypothetical protein PHAVU_010G060200g [Phaseolus vulgaris]
Length=214

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 101/144 (70%), Gaps = 7/144 (5%)
 Frame = +3

Query  189  VLTVWKKSLLFNCDGFTVFDDK-GNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRL  365
            VLTVWKKSLL NC GFTVFD K GNLV+RVDNY  + N+  I+LMDA+G  L TIRRKRL
Sbjct  32   VLTVWKKSLLPNCIGFTVFDTKRGNLVFRVDNYI-AGNKDHILLMDAAGTPLLTIRRKRL  90

Query  366  SLADNWVVYDGETAD-RPLYSVRKHVSLLNS---KSLAHVTSLRGSGAKGSKNARVFEIE  533
            SL D W+V++GE    +P+++ RK V++LNS   K LAH+ S   SG +  K    +EIE
Sbjct  91   SLGDTWLVFEGEGESLKPVFTARKSVNILNSSKNKCLAHLMS-SSSGTENMKKEVAYEIE  149

Query  534  GSYANRSCVMYDNVRRRVAEIKRK  605
            GSYA R C  Y   RR+VAEIK K
Sbjct  150  GSYAQRCCTFYSKNRRKVAEIKMK  173



>ref|XP_006295029.1| hypothetical protein CARUB_v10024098mg [Capsella rubella]
 gb|EOA27927.1| hypothetical protein CARUB_v10024098mg [Capsella rubella]
Length=197

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 112/178 (63%), Gaps = 25/178 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP      P    DE L      C S      VLTVWKKSLLFNCDGFTV++  G 
Sbjct  1    MTKVHPK----FPNTTCDESL------CDSKAA--VVLTVWKKSLLFNCDGFTVYNANGE  48

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +S  R  IVLMDASG  L ++RRK+LS  D W+VYDGETA  P+ + RK+V
Sbjct  49   LVFRVDNYMNSP-RDNIVLMDASGLPLLSVRRKKLSFGDCWMVYDGETARDPILTARKNV  107

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            +++ N +SLA V+         +K   ++EIEGSY  RSC + D  R  ++ AEIKRK
Sbjct  108  NIISNRRSLAWVS---------TKKTVLYEIEGSYGQRSCKIVDERRNKKKTAEIKRK  156



>ref|XP_004977408.1| PREDICTED: protein LURP-one-related 8-like [Setaria italica]
Length=219

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 111/186 (60%), Gaps = 27/186 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCL---SSPPQPTVLTVWKKSLLFNCDGFTVFDD  251
            M KVHPNA +           P PA   +   +    P VLTVW+KSLLFNCDGFTVFD 
Sbjct  1    MGKVHPNAVA-----------PEPATTTVRRSAEEEAPAVLTVWRKSLLFNCDGFTVFDA  49

Query  252  KGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLS-LADNWVVY------DGETAD  410
            KG+L +RVD Y  S  RAE+VLMD +G  L T+RRKRLS L ++WV+Y            
Sbjct  50   KGDLAFRVDCYGSSRRRAEVVLMDVAGKPLLTVRRKRLSLLGEHWVIYDGDAADAAAGKA  109

Query  411  RPLYSVRKHVSL-LNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRV  587
            +PL SVR+HVSL  +SK+LAHVT +  +    +     F +EGSY  R+C + D     V
Sbjct  110  KPLLSVRRHVSLKASSKTLAHVTPMASAATSAA-----FVVEGSYGRRACAVRDARGDAV  164

Query  588  AEIKRK  605
            AE++RK
Sbjct  165  AEVRRK  170



>emb|CDY62435.1| BnaC03g72170D [Brassica napus]
Length=195

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 112/177 (63%), Gaps = 25/177 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVW+KSLLFNCDGFTV++  GN
Sbjct  1    MTKVHPKFPNTYEESLCDSK-------------AAVVLTVWRKSLLFNCDGFTVYNSNGN  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +S  +  IVLMDASG  L +IRRK+LSL D W VYDGET   P+++ +K+V
Sbjct  48   LVFRVDNYMNSP-KDNIVLMDASGLPLLSIRRKKLSLGDCWAVYDGETQRDPIFTAKKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYD-NVRRRVAEIKRK  605
            S+L N +SLA V+         +K   ++E+EGSY  +SC + D   +++ AEIKRK
Sbjct  107  SILTNKRSLAWVS---------AKKTILYEVEGSYGQKSCKIVDVRNKKKTAEIKRK  154



>ref|XP_002881606.1| hypothetical protein ARALYDRAFT_482873 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57865.1| hypothetical protein ARALYDRAFT_482873 [Arabidopsis lyrata subsp. 
lyrata]
Length=196

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 111/178 (62%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVWKKSLLFNCDGFTV++  G 
Sbjct  1    MTKVHPKFPNTCDESLCDSK-------------AAVVLTVWKKSLLFNCDGFTVYNANGE  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +   R  IVLMDASG  L +IRRK+LSL D W+VYDGET   P+ + RK+V
Sbjct  48   LVFRVDNYMNCP-RDNIVLMDASGFPLLSIRRKKLSLGDCWMVYDGETERDPILTARKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            ++L N +SLA V+         +K   ++EIEGSY+ RSC + D  R  ++ AEIKRK
Sbjct  107  NILTNRRSLAWVS---------AKKTVLYEIEGSYSQRSCKILDERRNKKKTAEIKRK  155



>ref|XP_009133276.1| PREDICTED: protein LURP-one-related 8-like [Brassica rapa]
Length=196

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 112/179 (63%), Gaps = 28/179 (16%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVW+KSLLFNCDGFTV++  GN
Sbjct  1    MTKVHPKFPNTYEESLCDSK-------------AAVVLTVWRKSLLFNCDGFTVYNSNGN  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +S  +  IVLMDASG  L +IRRK+LS+ D W VYDGET   P+++ +K+V
Sbjct  48   LVFRVDNYMNSP-KDNIVLMDASGLPLLSIRRKKLSMGDCWAVYDGETQRDPIFTAKKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRR---RVAEIKRK  605
            S+L N +SLA V+          K   ++E+EGSY  RSC + D VRR   + AEIKRK
Sbjct  107  SILTNKRSLAWVS---------VKKTILYEVEGSYGQRSCKIVD-VRRNKKKTAEIKRK  155



>ref|NP_001065608.2| Os11g0120300 [Oryza sativa Japonica Group]
 dbj|BAF27453.2| Os11g0120300, partial [Oryza sativa Japonica Group]
Length=213

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 115/190 (61%), Gaps = 28/190 (15%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPAC-HCLSSPPQ-----PTVLTVWKKSLLFNCDGFT  239
            +  KVHPN A+A          P+P C   + S  Q     P VLTVW+KSLLFNC GFT
Sbjct  1    MAAKVHPNVAAA----------PQPPCISSIVSQQQEEEEPPVVLTVWRKSLLFNCHGFT  50

Query  240  VFDDKGNLVYRVDNY-YDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETA---  407
            VFD KGNL +R+D Y   SS RA++VLMDA+G  L TIRRKR+SL+D+W++YDG+ A   
Sbjct  51   VFDAKGNLAFRLDCYDSTSSRRADLVLMDAAGKPLLTIRRKRMSLSDSWIIYDGDGAATS  110

Query  408  -DRPLYSV-RKHVSLLNSKS--LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNV  575
               PL SV R+ V L  SKS  +AHVT L  S          + +EGSY  RSC + D  
Sbjct  111  TATPLLSVRRRRVGLRASKSKAIAHVTPLSSS----LPLPEAYVVEGSYGRRSCAVRDAR  166

Query  576  RRRVAEIKRK  605
               VAE++RK
Sbjct  167  GDAVAEVRRK  176



>ref|NP_001066017.1| Os12g0120100 [Oryza sativa Japonica Group]
 gb|ABA95671.1| eukaryotic translation initiation factor 2B family protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29036.1| Os12g0120100 [Oryza sativa Japonica Group]
 dbj|BAG93448.1| unnamed protein product [Oryza sativa Japonica Group]
Length=222

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 115/190 (61%), Gaps = 28/190 (15%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPAC-HCLSSPPQ-----PTVLTVWKKSLLFNCDGFT  239
            +  KVHPN A+A          P+P C   + S  Q     P VLTVW+KSLLFNC GFT
Sbjct  1    MAAKVHPNVAAA----------PQPPCISSIVSQQQEEEEPPVVLTVWRKSLLFNCHGFT  50

Query  240  VFDDKGNLVYRVDNY-YDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETA---  407
            VFD KGNL +R+D Y   SS RA++VLMDA+G  L TIRRKR+SL+D+W++YDG+ A   
Sbjct  51   VFDAKGNLAFRLDCYDSTSSRRADLVLMDAAGKPLLTIRRKRMSLSDSWIIYDGDGAATS  110

Query  408  -DRPLYSV-RKHVSLLNSKS--LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNV  575
               PL SV R+ V L  SKS  +AHVT L  S          + +EGSY  RSC + D  
Sbjct  111  TATPLLSVRRRRVGLRASKSKAIAHVTPLSSS----LPLPEAYVVEGSYGRRSCAVRDAR  166

Query  576  RRRVAEIKRK  605
               VAE++RK
Sbjct  167  GDAVAEVRRK  176



>ref|XP_006411081.1| hypothetical protein EUTSA_v10017266mg [Eutrema salsugineum]
 gb|ESQ52534.1| hypothetical protein EUTSA_v10017266mg [Eutrema salsugineum]
Length=196

 Score =   149 bits (375),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 109/178 (61%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP             + P       S      VLTVWKKSLLFNCDGFTV++  G+
Sbjct  1    MTKVHP-------------KFPNTCEESFSDSKAAVVLTVWKKSLLFNCDGFTVYNSNGD  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +S  +  IVLMDASG  L +IRRK+LSL D W+V+DGET   P+++ RK+V
Sbjct  48   LVFRVDNYMNSP-KDNIVLMDASGLPLLSIRRKKLSLGDCWMVFDGETERDPIFTARKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            +++ N +SL  V+          K   ++EIEGSY  RSC + D  R  ++ AEIKRK
Sbjct  107  NIMTNRRSLVWVS---------MKKTVLYEIEGSYGQRSCKILDERRNKKKAAEIKRK  155



>gb|ABA91200.1| eukaryotic translation initiation factor 2B family protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAH01042.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 115/190 (61%), Gaps = 28/190 (15%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPAC-HCLSSPPQ-----PTVLTVWKKSLLFNCDGFT  239
            +  KVHPN A+A          P+P C   + S  Q     P VLTVW+KSLLFNC GFT
Sbjct  1    MAAKVHPNVAAA----------PQPPCISSIVSQQQEEEEPPVVLTVWRKSLLFNCHGFT  50

Query  240  VFDDKGNLVYRVDNY-YDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETA---  407
            VFD KGNL +R+D Y   SS RA++VLMDA+G  L TIRRKR+SL+D+W++YDG+ A   
Sbjct  51   VFDAKGNLAFRLDCYDSTSSRRADLVLMDAAGKPLLTIRRKRMSLSDSWIIYDGDGAATS  110

Query  408  -DRPLYSV-RKHVSLLNSKS--LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNV  575
               PL SV R+ V L  SKS  +AHVT L  S          + +EGSY  RSC + D  
Sbjct  111  TATPLLSVRRRRVGLRASKSKAIAHVTPLSSS----LPLPEAYVVEGSYGRRSCAVRDAR  166

Query  576  RRRVAEIKRK  605
               VAE++RK
Sbjct  167  GDAVAEVRRK  176



>emb|CDY07714.1| BnaA03g17970D [Brassica napus]
Length=195

 Score =   148 bits (374),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 111/177 (63%), Gaps = 25/177 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVW+KSLLFNCDGFTV++  GN
Sbjct  1    MTKVHPKFPNTYEESLCDSK-------------AAVVLTVWRKSLLFNCDGFTVYNSNGN  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +S  +  IVLMDASG  L +IRRK+LSL D W VYDGET   P ++ +K+V
Sbjct  48   LVFRVDNYMNSP-KDNIVLMDASGLPLLSIRRKKLSLGDCWAVYDGETQRDPKFTAKKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYD-NVRRRVAEIKRK  605
            S+L N +SLA V+         +K   ++E+EGSY  +SC + D   +++ AEIKRK
Sbjct  107  SILTNKRSLAWVS---------AKKTILYEVEGSYGQKSCKIVDVRNKKKTAEIKRK  154



>ref|XP_010509151.1| PREDICTED: protein LURP-one-related 8-like [Camelina sativa]
Length=196

 Score =   148 bits (374),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 111/178 (62%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVWKKSLLFNCDGFTV++  G 
Sbjct  1    MTKVHPKFPNTCDVSLCDSK-------------AAAVLTVWKKSLLFNCDGFTVYNANGE  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +   R  IVLMDASG  L ++RRK+LSL D W+VYDGET   P+ + RK+V
Sbjct  48   LVFRVDNYMNCP-RDNIVLMDASGLPLLSVRRKKLSLGDCWMVYDGETERDPIMTARKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            +++ N ++LA V+         SK   ++EIEGSY+ RSC + D  R  ++ AEIKRK
Sbjct  107  NIITNRRTLAWVS---------SKRTVLYEIEGSYSQRSCKILDERRNKKKTAEIKRK  155



>ref|XP_009133277.1| PREDICTED: protein LURP-one-related 8-like [Brassica rapa]
Length=195

 Score =   148 bits (374),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 111/177 (63%), Gaps = 25/177 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVW+KSLLFNCDGFTV++  GN
Sbjct  1    MTKVHPKFPNTYEESLCDSK-------------AAVVLTVWRKSLLFNCDGFTVYNSNGN  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +S  +  IVLMDASG  L +IRRK+LS+ D W VYDGET   P+++ +K+V
Sbjct  48   LVFRVDNYMNSP-KDNIVLMDASGLPLLSIRRKKLSMGDCWAVYDGETQRDPIFTAKKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYD-NVRRRVAEIKRK  605
            S+L N +SLA V+          K   ++E+EGSY  +SC + D   +++ AEIKRK
Sbjct  107  SILTNKRSLAWVS---------VKKTILYEVEGSYGQKSCKIVDVRNKKKTAEIKRK  154



>ref|XP_010517169.1| PREDICTED: protein LURP-one-related 8-like [Camelina sativa]
Length=196

 Score =   148 bits (374),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 111/178 (62%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVWKKSLLFNCDGFTV++  G 
Sbjct  1    MTKVHPKFPNTCDVSLCDSK-------------AAAVLTVWKKSLLFNCDGFTVYNANGE  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +   R  IVLMDASG  L ++RRK+LSL D W+VYDGET   P+ + RK+V
Sbjct  48   LVFRVDNYMNCP-RDNIVLMDASGLPLLSVRRKKLSLGDCWMVYDGETERDPILTARKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            +++ N ++LA V+         SK   ++EIEGSY+ RSC + D  R  ++ AEIKRK
Sbjct  107  NIITNRRTLAWVS---------SKRTVLYEIEGSYSQRSCKILDERRNKKKTAEIKRK  155



>gb|EAZ17233.1| hypothetical protein OsJ_32751 [Oryza sativa Japonica Group]
Length=221

 Score =   149 bits (376),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 115/190 (61%), Gaps = 28/190 (15%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPAC-HCLSSPPQ-----PTVLTVWKKSLLFNCDGFT  239
            +  KVHPN A+A          P+P C   + S  Q     P VLTVW+KSLLFNC GFT
Sbjct  1    MAAKVHPNVAAA----------PQPPCISSIVSQQQEEEEPPVVLTVWRKSLLFNCHGFT  50

Query  240  VFDDKGNLVYRVDNY-YDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETA---  407
            VFD KGNL +R+D Y   SS RA++VLMDA+G  L TIRRKR+SL+D+W++YDG+ A   
Sbjct  51   VFDAKGNLAFRLDCYDSTSSRRADLVLMDAAGKPLLTIRRKRMSLSDSWIIYDGDGAATS  110

Query  408  -DRPLYSV-RKHVSLLNSKS--LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNV  575
              RPL SV R+ V L  SKS  +AHVT L  S          + +EGSY   SC + D  
Sbjct  111  TARPLLSVRRRRVGLRASKSKAIAHVTPLSSS----LPLPEAYVVEGSYGRPSCAVRDAR  166

Query  576  RRRVAEIKRK  605
               VAE++RK
Sbjct  167  GDAVAEVRRK  176



>ref|XP_004970372.1| PREDICTED: protein LURP-one-related 8-like [Setaria italica]
Length=196

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 109/177 (62%), Gaps = 26/177 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQ-PTVLTVWKKSLLFNCDGFTVFDDKG  257
            M KVHPN             LP PA    ++  + PT LTVW+KSLLFNC GFTVFD KG
Sbjct  1    MAKVHPNV------------LPSPAERAAAAGEEEPTSLTVWRKSLLFNCRGFTVFDAKG  48

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETADRPLYSVRK  434
            +L YRVD+Y D+   AE+VLMD +G   FT+RRKRLSL  + W+++ GE A RP+Y+V++
Sbjct  49   DLAYRVDSYDDAE--AEVVLMDPAGRPAFTVRRKRLSLSGEQWLIFAGEEARRPVYAVKR  106

Query  435  HVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                   KS+A V     +GA        FE+EGSY  R CV+YD  RR VAE++ K
Sbjct  107  GG---GGKSMARVAPQCAAGAP-------FEVEGSYGRRRCVVYDGERRAVAEVQPK  153



>gb|KFK36769.1| hypothetical protein AALP_AA4G168000 [Arabis alpina]
Length=198

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 116/179 (65%), Gaps = 26/179 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKV+P   +       DE L     +C S   +  VLTVWKKSLLFNCDGFTV++  G+
Sbjct  1    MTKVYPKFPNT-----CDESL-----YCDSK--EAVVLTVWKKSLLFNCDGFTVYNSNGD  48

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY + S +  IVLMDASG  L +IRRK+LSL D W+VYDGET   P+++V+K+ 
Sbjct  49   LVFRVDNYMNCS-KDNIVLMDASGLPLLSIRRKKLSLGDCWMVYDGETERDPIFTVKKNS  107

Query  441  SLLNS--KSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNV--RRRVAEIKRK  605
            S++ +  KSLA V          +K   ++EIEGSY  RSC + D    ++++AEIKRK
Sbjct  108  SIITNKRKSLACV---------NAKKTILYEIEGSYGQRSCKILDERKNKKKIAEIKRK  157



>ref|XP_010505504.1| PREDICTED: protein LURP-one-related 8 [Camelina sativa]
Length=196

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 111/178 (62%), Gaps = 26/178 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +                VLTVWKKSLLFNCDGFTV++  G 
Sbjct  1    MTKVHPKFPNTCDESLCDSK-------------AAVVLTVWKKSLLFNCDGFTVYNANGE  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +   R  IVLMDASG  L ++RRK+LSL D W+VYDGET   P+ + RK+V
Sbjct  48   LVFRVDNYMNCP-RDNIVLMDASGLPLLSVRRKKLSLGDCWMVYDGETERDPILTARKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR--RRVAEIKRK  605
            +++ N ++LA V+         SK   ++EIEGSY+ RSC + D  R  ++ AEIKRK
Sbjct  107  NIITNRRTLAWVS---------SKRTILYEIEGSYSQRSCKILDERRNKKKTAEIKRK  155



>gb|EAY79743.1| hypothetical protein OsI_34901 [Oryza sativa Indica Group]
Length=221

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 115/190 (61%), Gaps = 28/190 (15%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPAC-HCLSSPPQ-----PTVLTVWKKSLLFNCDGFT  239
            +  KVHPN A+A          P+P C   + S  Q     P VLTVW+KSLLFNC GFT
Sbjct  1    MAAKVHPNVATA----------PQPPCISSIVSQQQEEEEPPVVLTVWRKSLLFNCHGFT  50

Query  240  VFDDKGNLVYRVDNY-YDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETA---  407
            VFD KGNL +R+D Y   SS RA++VLMDA+G  L TIRRKR+SL+D+W++YDG+ A   
Sbjct  51   VFDAKGNLAFRLDCYDSTSSRRADLVLMDAAGKPLLTIRRKRMSLSDSWIIYDGDGAATA  110

Query  408  -DRPLYSV-RKHVSLLNSKS--LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNV  575
               PL SV R+ V L  SKS  +AHVT L  S          + +EGSY  RSC + D  
Sbjct  111  TATPLLSVRRRRVGLRASKSKAIAHVTPLSYS----LPLPEAYVVEGSYGRRSCAVRDAR  166

Query  576  RRRVAEIKRK  605
               VAE++RK
Sbjct  167  GDAVAEVRRK  176



>ref|XP_003568228.1| PREDICTED: protein LURP-one-related 8-like [Brachypodium distachyon]
Length=222

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 113/189 (60%), Gaps = 27/189 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN A+  P       L  P         +P   TVW+KSLLFNC GFTVFD +G+
Sbjct  1    MAKVHPNVAAPSPP------LATPGAAEAEE--EPVAFTVWRKSLLFNCRGFTVFDARGD  52

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR----LSLADNWVVYDGE-TADRPLYS  425
            LVYRVD+ Y S +RAE+VLMDA+G +L T+RR++    L   D W+V+ GE T   PLY+
Sbjct  53   LVYRVDS-YASDSRAEVVLMDAAGRALLTVRRRKKPIGLGGGDQWLVFPGEDTRAPPLYA  111

Query  426  VRKHV---------SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR  578
            V++              +SKS+A V + RG G  G+K    +E+EGSYA R C +YD  R
Sbjct  112  VKRRAPQYIRGGGGGGSSSKSMAQVAACRGGGDGGNK----YEVEGSYARRCCAVYDERR  167

Query  579  RRVAEIKRK  605
            R VAE++ K
Sbjct  168  RAVAEVRPK  176



>emb|CDY60759.1| BnaA05g34820D [Brassica napus]
Length=195

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 104/167 (62%), Gaps = 24/167 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP   +    +L D +             +  VLTVWKKSLLFNCDGFTV++  G 
Sbjct  1    MTKVHPKFQNTCEKSLCDSK-------------EAVVLTVWKKSLLFNCDGFTVYNSNGE  47

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            LV+RVDNY +   +  I+LMDASG  L +IRRK+LSL D W+VYDGET   P+++ +K+V
Sbjct  48   LVFRVDNYMNCP-KDNILLMDASGLPLLSIRRKKLSLGDCWMVYDGETQRDPIFTAKKNV  106

Query  441  SLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR  578
            S++ N +SL  V+         SK   ++EIEGSY+ RSC + D  R
Sbjct  107  SIMTNKRSLVSVS---------SKKTVLYEIEGSYSQRSCKILDERR  144



>ref|NP_001241138.1| uncharacterized protein LOC100795046 [Glycine max]
 gb|ACU19395.1| unknown [Glycine max]
Length=208

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 120/181 (66%), Gaps = 23/181 (13%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFD-DKG  257
            MTKVHPNA +++  +  + E P       +S     VLTVWKKSLL NC+GFTVFD  +G
Sbjct  1    MTKVHPNANASVCVSETETEKPNK-----NSDAMAVVLTVWKKSLLPNCNGFTVFDTQRG  55

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-ADNWVVYDGETA--DRPLYS-  425
            NLV+RVDNY  + N+ +I+LMDA+G  L TIRRKRLSL +D W+V++GE +   + L++ 
Sbjct  56   NLVFRVDNYV-ARNKDQILLMDAAGTPLLTIRRKRLSLVSDTWLVFEGEGSVKQKLLFTA  114

Query  426  VRKHVSLLNSK-SLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKR  602
             RK+V   N+K +LAH+ +++   A        +EIEGSYA R C  Y+N + +VAE+K 
Sbjct  115  ARKNV---NAKCTLAHIFNIKKEVA--------YEIEGSYAQRCCTFYNNNKIKVAEMKM  163

Query  603  K  605
            K
Sbjct  164  K  164



>ref|NP_001170576.1| hypothetical protein [Zea mays]
 gb|ACR34096.1| unknown [Zea mays]
 gb|AFW78425.1| hypothetical protein ZEAMMB73_154721 [Zea mays]
Length=226

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 117/193 (61%), Gaps = 27/193 (14%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPACHCLS-SPP---QPTVLTVWKKSLLFNCDGFTVF  245
            +  KVHPN A  +P+      L +PA   ++ SPP   +P  LTVW+KSLLFNC GFTVF
Sbjct  1    MTAKVHPNVA--VPSV----GLGQPAAVAVAVSPPADEEPVTLTVWRKSLLFNCRGFTVF  54

Query  246  DDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL-----ADNWVVYDGETAD  410
            D +G+LVYRVD  Y S +RAE+VLMDA+G  + T+RR++  +     AD W+VY GE A 
Sbjct  55   DARGDLVYRVDT-YASDSRAEVVLMDAAGRPVLTVRRRQRPIGLGLGADQWLVYPGEEAR  113

Query  411  R--PLYSVRKHVSLL------NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMY  566
            R  PLY+V++  +         +KS+AHV +   S          +E+EGSY  R C +Y
Sbjct  114  RLPPLYAVKRPAAQYMRGGGGGAKSMAHVAA---SSGGAGAGGGGYEVEGSYLRRRCTVY  170

Query  567  DNVRRRVAEIKRK  605
            D  RR VAE++ K
Sbjct  171  DERRRAVAEVRPK  183



>ref|XP_004961716.1| PREDICTED: protein LURP-one-related 8-like [Setaria italica]
Length=213

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 113/181 (62%), Gaps = 16/181 (9%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            +  KVHPN A  +PT L  +    PA        +P  LTVW+KSLLFNC GFTVFD  G
Sbjct  1    MTAKVHPNVA--VPT-LGQQPAAAPADE------EPVTLTVWRKSLLFNCRGFTVFDASG  51

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LSL-ADNWVVYDG-ETADRPLYSV  428
            NLVYRVD+ Y S +RAE+VLMDA+G +L T+RR++ + L AD W+VY G ET   PLY+V
Sbjct  52   NLVYRVDS-YASDSRAEVVLMDAAGRALLTVRRRKVIGLGADQWLVYPGEETRLPPLYAV  110

Query  429  RKHVSLLN--SKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKR  602
            ++    +    KS+AHV       A G +    +E+EGSY  R C +YD  RR VAE++ 
Sbjct  111  KRAAQYMRGAGKSMAHVAPC-SGAAGGKQAGGGYEVEGSYLRRCCTVYDARRRAVAEVRP  169

Query  603  K  605
            K
Sbjct  170  K  170



>ref|NP_001149433.1| GTP binding protein [Zea mays]
 gb|ACG35426.1| GTP binding protein [Zea mays]
Length=216

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 108/187 (58%), Gaps = 28/187 (15%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALA----DEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFD  248
            M KV+PN+A+            ++ P P          PTVLTVW+KSLLFNCDGFTV+D
Sbjct  1    MAKVYPNSAAVAAEPATRAAAGDQQPEP----------PTVLTVWRKSLLFNCDGFTVYD  50

Query  249  DKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYD---GETAD---  410
             +G+L +RVD Y  S  RAE+ LMDA+G  L T+ RKRLSLA+ W++Y+   G T     
Sbjct  51   ARGDLAFRVDCYATSRRRAEVALMDAAGAPLLTLHRKRLSLAERWLIYEDGAGTTQPQPR  110

Query  411  RPLYSVRKHVSLLNS--KSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRR  584
            RPL SV +HV L  S  K+LAHV       A  S     F +EGSY  R C + D     
Sbjct  111  RPLLSVHRHVGLRASGGKTLAHVF------APSSAAQEAFVVEGSYGRRDCAVRDARGDV  164

Query  585  VAEIKRK  605
            +AE++RK
Sbjct  165  MAEVRRK  171



>ref|XP_003567222.1| PREDICTED: protein LURP-one-related 8-like [Brachypodium distachyon]
Length=215

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 106/175 (61%), Gaps = 9/175 (5%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN    +P   A E          ++    TVLTVW+KSLLF+C GFTVFD +G+
Sbjct  1    MAKVHPNVV--VPARGAGERAAAEEEPTTAT----TVLTVWRKSLLFDCKGFTVFDARGD  54

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPLYSVRKHV  440
            L YRVD+Y   S   E+VLMDA+G   FT+RRKR      W+V+ GE   RP+Y VR+  
Sbjct  55   LAYRVDSYASESGD-EVVLMDAAGRPAFTVRRKRSFSGQQWLVFAGEETRRPVYCVRRS-  112

Query  441  SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                 K+LAHVT    +   G  ++  +E+EGSYA RSCV+YD  RR VAE++ K
Sbjct  113  GARGGKTLAHVTPC-CASGSGELSSSGYEVEGSYAKRSCVVYDGERRAVAEVRPK  166



>ref|XP_006663759.1| PREDICTED: protein LURP-one-related 8-like [Oryza brachyantha]
Length=222

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 110/192 (57%), Gaps = 31/192 (16%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPAC-------HCLSSPPQPTVLTVWKKSLLFNCDGF  236
            +  KVHPN A           +P P C               P VLTVW+KSLLFNC GF
Sbjct  1    MAAKVHPNVA-----------VPEPPCISAGIVSQQQDQDQPPVVLTVWRKSLLFNCHGF  49

Query  237  TVFDDKGNLVYRVDNYYDSSN----RAEIVLMDASGNSLFTIRRKR--LSLADNWVVYDG  398
            TVFD KGNL +RVD Y  SS+    R E+VLMD +GN L TIRRKR  LSL+D WV+YDG
Sbjct  50   TVFDAKGNLAFRVDCYDASSSTTSRRPELVLMDVAGNPLLTIRRKRLSLSLSDTWVIYDG  109

Query  399  E--TADRPLYSVRKHV-SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYD  569
            +   A  PL SVR+ +  L  SK+LAHVT L  S  +       + +EGSY  R+C + D
Sbjct  110  DGKGASTPLLSVRRQLRGLRASKALAHVTPLSSSLPR----PEAYVVEGSYGRRACAVRD  165

Query  570  NVRRRVAEIKRK  605
                 VAE++RK
Sbjct  166  ARGDAVAEVRRK  177



>ref|XP_002442752.1| hypothetical protein SORBIDRAFT_08g002230 [Sorghum bicolor]
 gb|AAO16698.1| hypothetical protein-like protein [Sorghum bicolor]
 gb|EES16590.1| hypothetical protein SORBIDRAFT_08g002230 [Sorghum bicolor]
Length=225

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 111/187 (59%), Gaps = 21/187 (11%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQP--TVLTVWKKSLLFNCDGFTVFDDK  254
            M KVHPNAA+                      P+P  TVLTVW+KSLLFNCDGFTV+D  
Sbjct  1    MAKVHPNAAAVATELATATTR-----AAADQQPEPPTTVLTVWRKSLLFNCDGFTVYDAN  55

Query  255  GNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADR----PLY  422
            G+L +RVD Y  +   AE+VLMDA+G  L T+RRKRLSLA+ W+VYDG+ A      PL 
Sbjct  56   GDLAFRVDCY--ARRHAEVVLMDAAGAPLLTVRRKRLSLAERWLVYDGDAAASTTRPPLL  113

Query  423  SVRKHVSLL------NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRR  584
            SVR+HV  L      + K++AHV +   S A G   A  F +EGSY  R+C + D     
Sbjct  114  SVRRHVGGLRVRGASSGKTMAHVVAAASSSAAGGGEA--FVVEGSYGRRACAVRDARGDV  171

Query  585  VAEIKRK  605
            VAE++RK
Sbjct  172  VAEVRRK  178



>ref|XP_002441779.1| hypothetical protein SORBIDRAFT_08g002190 [Sorghum bicolor]
 gb|AAO16702.1| hypothetical protein-like protein [Sorghum bicolor]
 gb|EES15617.1| hypothetical protein SORBIDRAFT_08g002190 [Sorghum bicolor]
Length=230

 Score =   139 bits (350),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 111/193 (58%), Gaps = 29/193 (15%)
 Frame = +3

Query  81   MTKVHPNAAS-----AIPT---ALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGF  236
            M KVHPNAA+       PT   A   ++ P         PP   VLTVW+KSLLFNCDGF
Sbjct  1    MAKVHPNAAAVAAELGTPTRRAAAGQDQEP--------EPPTTAVLTVWRKSLLFNCDGF  52

Query  237  TVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADR-  413
            TV+D  G+L +RVD Y  +   AE+VLMDA+G  L T+RRKRLSLA+ W VY G+ A   
Sbjct  53   TVYDADGDLAFRVDCY--ARRHAEVVLMDAAGAPLLTVRRKRLSLAERWHVYHGDAAASS  110

Query  414  ---PLYSVRKHV------SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMY  566
               P+ SVR+HV      +    K+LAHV +   S +  +     F +EGSY  R+C + 
Sbjct  111  SRPPVLSVRRHVGGGLRGASGGGKTLAHVVAAS-SSSADAGGGEAFVVEGSYGRRACAVR  169

Query  567  DNVRRRVAEIKRK  605
            D     VAE++RK
Sbjct  170  DARGDVVAEVRRK  182



>ref|XP_010261398.1| PREDICTED: protein LURP-one-related 8-like [Nelumbo nucifera]
Length=225

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 101/153 (66%), Gaps = 20/153 (13%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRL-S  368
            LTVW+KSLLF+C+GFTV D  G LV+RVDNY D  +R EI+LMD SGN L T+RRK+L +
Sbjct  35   LTVWRKSLLFSCNGFTVIDSDGKLVFRVDNYMD-GHREEILLMDGSGNPLLTMRRKKLMT  93

Query  369  LADNWVVYDGETADR------------PLYSVRKHVSLL--NSKSLAHVTSLRGSGAKGS  506
              +NW++++GE ++             P++ VRKH++LL  NS  LAHV     +G+  S
Sbjct  94   FVENWLIFEGEGSEEVCRSRSAKKKPTPIFCVRKHMNLLSSNSSVLAHVF----TGSSSS  149

Query  507  KNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                ++ IEGSY  RSC + D  R+ +AEIKRK
Sbjct  150  NTRFLYVIEGSYCQRSCQVLDESRKVMAEIKRK  182



>ref|NP_001147232.1| GTP binding protein [Zea mays]
 gb|ACG26255.1| GTP binding protein [Zea mays]
Length=182

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 102/181 (56%), Gaps = 23/181 (13%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN A+         ELP      +    QPTVLTVW+KSLLFNCDGFTVFD  G 
Sbjct  1    MAKVHPNVAA--------PELP-AGGRAVVEEEQPTVLTVWRKSLLFNCDGFTVFDAAGG  51

Query  261  LVYRVDNYYDSS---NRAE-IVLMDASGNSLFTIRRK---RLSLADNWVVYDGE---TAD  410
            L +RVD Y  SS    RAE +VLMDA+G  L T+RRK    L L ++WVVYDGE   +  
Sbjct  52   LAFRVDRYGSSSRIRRRAEDVVLMDAAGKPLLTVRRKIKLSLGLGEHWVVYDGEASASTA  111

Query  411  RPLYSVRKHVSLL----NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR  578
            +PL SVR+H + L    + K+LAHVT L  S A     A V E       RSC      R
Sbjct  112  KPLLSVRRHHAGLRRRASDKTLAHVTPLGPSSAGADAAAYVVEGSPRRGRRSCPGAGRRR  171

Query  579  R  581
            R
Sbjct  172  R  172



>ref|XP_003558566.1| PREDICTED: protein LURP-one-related 8-like [Brachypodium distachyon]
Length=220

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 114/188 (61%), Gaps = 16/188 (9%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEE----LPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFD  248
            MTKVHPNAA+   +    EE        +        +P  LTVW++SLLFN  GFTVFD
Sbjct  1    MTKVHPNAAAVAASLAVAEEKREATAVASLAAAGEKREPVALTVWRRSLLFNGKGFTVFD  60

Query  249  DKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRP--LY  422
             KG+LV+RV+ Y   S R E+VLMDA G +L TI RK+LSLAD W + DG+ A      +
Sbjct  61   SKGDLVFRVETYAGGSPR-EVVLMDADGRALLTICRKKLSLADEWSIMDGDAASAAPKRF  119

Query  423  SVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVR-------R  581
            + R+++SLL +KSLA ++S+RG+  +G  +A  + +EGSY  RS  M+ +         R
Sbjct  120  TARRNMSLLPTKSLARLSSVRGASDRG--DAPRYHVEGSYVGRSLDMFASASGGGGEQGR  177

Query  582  RVAEIKRK  605
            RVA + RK
Sbjct  178  RVATVCRK  185



>ref|XP_008676388.1| PREDICTED: protein LURP-one-related 8-like [Zea mays]
 tpg|DAA58974.1| TPA: hypothetical protein ZEAMMB73_099861 [Zea mays]
Length=240

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 117/204 (57%), Gaps = 37/204 (18%)
 Frame = +3

Query  84   TKVHPNAASAIPTALADEELPRPACHCLSSPP----QPTVLTVWKKSLLFNCDGFTVFDD  251
            TKVHPNAA+A P           +  C  + P     PTVLTVW+KSLLFNCDGFTV+D 
Sbjct  4    TKVHPNAAAAEPVLTV-------STACARADPGEEEPPTVLTVWRKSLLFNCDGFTVYDA  56

Query  252  KGNLVYRVDNYYDSS-NRAEIVLMDASGNSLFTIRRKRL--SLADNWVVYDGETA-----  407
            +G+L +RVD+Y  +   RAE+VLMD +G  L T+RRKR    LA++WV+YDG+ A     
Sbjct  57   RGDLAFRVDSYDATGRRRAEVVLMDGAGTPLLTVRRKRRLGVLAEHWVIYDGDAAAEAKE  116

Query  408  ------DRPLYSVRKH-----VSLLNSKSLAHVTSLRGSGAKGSKNARV-----FEIEGS  539
                   RPL SVR+H      S   +K+LAHVT L  S +  S   R      + +EGS
Sbjct  117  TPSSRISRPLLSVRRHRASASASKAKAKALAHVTPLPASSSSLSGYHRASAEASYVMEGS  176

Query  540  YANRSCVMYDNVRRR--VAEIKRK  605
            Y  R+CV+ D       VAE+ RK
Sbjct  177  YGRRACVVRDRAHGDAVVAEVSRK  200



>gb|KDO76359.1| hypothetical protein CISIN_1g039555mg [Citrus sinensis]
Length=214

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 105/168 (63%), Gaps = 17/168 (10%)
 Frame = +3

Query  135  EELPRPACHCLS-SPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEI  311
            +E P PA    +    + T LTVW+KSL+  C+GFTV D  GNLVYRVDNY  S +  E+
Sbjct  14   QEEPEPALIKKNIDEGECTSLTVWRKSLVICCNGFTVIDSHGNLVYRVDNYVGSCH--EL  71

Query  312  VLMDASGNSLFTI-RRKRLSLADNWVVYDGET---------ADRPLYSVRKHVSLLNSKS  461
            +LMD SG S+FT+ RRK+L++AD+W V++GE          + RP+  V+KH+  +NS  
Sbjct  72   ILMDGSGKSIFTMRRRKKLTVADSWRVFEGEVDECSRRKKLSKRPVCYVKKHMMSINSNV  131

Query  462  LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            LA+V      G   S     + +EGSYANRSC + D  RR VAEIKRK
Sbjct  132  LAYVY----YGGASSNKRYAYTVEGSYANRSCKVLDESRRVVAEIKRK  175



>ref|XP_006439454.1| hypothetical protein CICLE_v10024192mg [Citrus clementina]
 gb|ESR52694.1| hypothetical protein CICLE_v10024192mg [Citrus clementina]
Length=214

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 99/152 (65%), Gaps = 16/152 (11%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RR  356
            + T LTVW+KSL+  C+GFTV D  GNLVYRVDNY  S +  E++LMD SG S+FT+ RR
Sbjct  30   ECTSLTVWRKSLVICCNGFTVIDSHGNLVYRVDNYVGSCH--ELILMDGSGKSIFTMHRR  87

Query  357  KRLSLADNWVVYDGET---------ADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSK  509
            K+L++AD+W V++GE          + RP+  V+KH+  +NS  LA+V      G   S 
Sbjct  88   KKLTVADSWRVFEGEVDECSRRKKLSKRPVCYVKKHMMSINSNVLAYVY----YGGASSN  143

Query  510  NARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                + +EGSYANRSC + D  RR VAEIKRK
Sbjct  144  KRYAYTVEGSYANRSCKVLDESRRVVAEIKRK  175



>ref|NP_001141080.1| uncharacterized protein LOC100273162 [Zea mays]
 ref|XP_008676795.1| PREDICTED: uncharacterized protein LOC100273162 isoform X1 [Zea 
mays]
 ref|XP_008676797.1| PREDICTED: uncharacterized protein LOC100273162 isoform X1 [Zea 
mays]
 gb|ACF85360.1| unknown [Zea mays]
 gb|AFW64647.1| hypothetical protein ZEAMMB73_548785 [Zea mays]
Length=220

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 110/186 (59%), Gaps = 26/186 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPNAA ++  A A+ ELP             TVLTVW+KSLLFNCDGFTV+D +G+
Sbjct  1    MAKVHPNAAESV-QAEAEGELP-------------TVLTVWRKSLLFNCDGFTVYDARGD  46

Query  261  LVYRVDNYYDS---SNRAEIVLMDASGNSLFTIRRK-RLSLADNWVVYDGETAD------  410
            L +RVD Y  S     RA++VLMDA+G  L T+RRK R  LA+ WV+YDG+  D      
Sbjct  47   LAFRVDCYAGSFRRRRRADVVLMDATGKPLLTVRRKTRFGLAERWVIYDGDADDGTTAGA  106

Query  411  RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYD-NVRRRV  587
             PL SVR+       K+LA       S A G+ +A  + +EGSY  R+C + D      V
Sbjct  107  TPLLSVRRRRIGACCKTLALARPRPRSAAAGT-DAPSYVVEGSYGRRACAVRDARGGAVV  165

Query  588  AEIKRK  605
            AE++RK
Sbjct  166  AEVQRK  171



>dbj|BAJ98118.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=208

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 105/178 (59%), Gaps = 17/178 (10%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN        LA   L  PA   +    +P  LTVW+KSLLFNC GFTVFD  GN
Sbjct  1    MAKVHPN--------LAVPSLGMPAAAAVDE--EPVTLTVWRKSLLFNCRGFTVFDASGN  50

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LSL-ADNWVVYDG-ETADRPLYSVR  431
            LVYRVD  Y S +RAE+VLMDA+G  + T+RRK+ +SL  D W+V+ G ET   PLY+V+
Sbjct  51   LVYRVD-IYASDSRAEVVLMDAAGRPVLTVRRKKAISLMGDQWLVFPGEETRAPPLYAVK  109

Query  432  KHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +    +        T+   +    +   R +E+EGSYA R C +YD  RR V E++ K
Sbjct  110  RTPQYMRGG--GKSTAHVAACGGAAGGGR-YEVEGSYARRCCAVYDEQRRAVVEVQPK  164



>ref|XP_006477514.1| PREDICTED: protein LURP-one-related 17-like [Citrus sinensis]
Length=214

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (62%), Gaps = 17/168 (10%)
 Frame = +3

Query  135  EELPRPACHCLS-SPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEI  311
            +E P PA    +    + T LTVW+KSL+  C+GFTV D  GNLVYRVDNY  S +  E+
Sbjct  14   QEEPEPALIKKNIDEGECTALTVWRKSLVICCNGFTVIDSDGNLVYRVDNYVGSCH--EL  71

Query  312  VLMDASGNSLFTI-RRKRLSLADNWVVYDGET---------ADRPLYSVRKHVSLLNSKS  461
            +LMD SG S+FT+ RRK+L++AD+W V++GE          + RP+  V+KH   ++S  
Sbjct  72   ILMDGSGKSIFTMRRRKKLTVADSWHVFEGEVDECSRRKKLSKRPVCYVKKHTMSISSNV  131

Query  462  LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            LA+V      G   S     + +EGSYANRSC + D  RR VAEIKRK
Sbjct  132  LAYVY----YGGASSNKRYAYTVEGSYANRSCKVLDESRRVVAEIKRK  175



>ref|XP_003517483.1| PREDICTED: protein LURP-one-related 17-like [Glycine max]
 gb|KHN25672.1| Protein LURP-one-related 17 [Glycine soja]
Length=227

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 95/160 (59%), Gaps = 22/160 (14%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKR  362
            T LTVW+KSL+ +C GFTV D  GNLVYRVDNY    N  E+ LMDASG S+ T+ RR++
Sbjct  31   TSLTVWRKSLVMSCKGFTVIDSHGNLVYRVDNYIGRPN--EVTLMDASGKSILTMCRRRK  88

Query  363  LSLADNWVVYDGETAD-------------------RPLYSVRKHVSLLNSKSLAHVTSLR  485
            L + D+W VY+GE  +                   RP+  VRKHV++L+  +       R
Sbjct  89   LGVLDSWFVYEGEVGNNNMRTRTRRSSSNLSKSSNRPICCVRKHVNILHGNTNVQAYVYR  148

Query  486  GSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            G+ +   K    F IEGSYA+R+C + D  RR VAEIKRK
Sbjct  149  GASSHSDKRCAAFTIEGSYAHRTCKVLDECRRVVAEIKRK  188



>ref|XP_002456535.1| hypothetical protein SORBIDRAFT_03g038010 [Sorghum bicolor]
 gb|EES01655.1| hypothetical protein SORBIDRAFT_03g038010 [Sorghum bicolor]
Length=209

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 98/141 (70%), Gaps = 9/141 (6%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRL  365
            T LTVW+KSLLFNC G+TVFD +G+L +RVD+Y D    AE+VLMD  G   FT+RRKRL
Sbjct  32   TSLTVWRKSLLFNCRGYTVFDARGDLAFRVDSYDDE---AEVVLMDPDGRPAFTVRRKRL  88

Query  366  SLA-DNWVVYDGETADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            SL+ ++W++Y GE   RP+Y+V++       KS+A VT   G+ A    ++  +E+EGSY
Sbjct  89   SLSGEHWLIYAGEETRRPVYAVKRGG---GGKSMARVTPCAGARAGAGASS--YEVEGSY  143

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            A R CV+YD  RR VAE++ K
Sbjct  144  ARRRCVVYDAERRAVAEVQPK  164



>ref|XP_003538270.1| PREDICTED: protein LURP-one-related 17-like [Glycine max]
 gb|KHN35049.1| Protein LURP-one-related 17 [Glycine soja]
Length=234

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 94/162 (58%), Gaps = 24/162 (15%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKR  362
            T LTVW+KSLL +C+GFTV D  GNLVYRVDNY    N  E+ LMDASG S+ T+ RR+R
Sbjct  36   TSLTVWRKSLLMSCNGFTVIDSYGNLVYRVDNYIGRPN--EVTLMDASGKSILTMCRRRR  93

Query  363  LSLADNWVVYDGETADR---------------------PLYSVRKHVSLLNSKSLAHVTS  479
            L L D+W VY+GE  +                      P+  VRKHV++L+  +      
Sbjct  94   LGLLDSWFVYEGEVGNNINNMRTRTRRRSSNLSKSSKTPICCVRKHVNILHGNTNVQAYV  153

Query  480  LRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
             RG+ +   K    F IEGSYA+R+C + D   R VAEIKRK
Sbjct  154  YRGASSHSDKRCAAFTIEGSYAHRTCKVLDECGRVVAEIKRK  195



>ref|NP_001172625.1| Os01g0817650 [Oryza sativa Japonica Group]
 dbj|BAB62578.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB64831.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY76277.1| hypothetical protein OsI_04212 [Oryza sativa Indica Group]
 dbj|BAH91355.1| Os01g0817650 [Oryza sativa Japonica Group]
Length=213

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 98/142 (69%), Gaps = 8/142 (6%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LS  368
            LTVW+KSLLFNC GFTVFD KGNL YRVD+ YD+ +  E+VLMDA+G   FT+RRKR LS
Sbjct  33   LTVWRKSLLFNCKGFTVFDAKGNLAYRVDS-YDTESGDEVVLMDAAGAPAFTVRRKRQLS  91

Query  369  L-ADNWVVYDGETADR--PLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGS  539
            L  + W+V+ GE   R  P+Y+VR+       KSLA VT    +GA  +  +  +E+EGS
Sbjct  92   LQGEQWLVFAGEADGRRPPVYAVRR-TGRGGGKSLARVTPC--AGAAAAGASAAYEVEGS  148

Query  540  YANRSCVMYDNVRRRVAEIKRK  605
            YA R CV+YD  RR VAE++ K
Sbjct  149  YARRCCVVYDGERRAVAEVRPK  170



>ref|XP_010676398.1| PREDICTED: protein LURP-one-related 17-like [Beta vulgaris subsp. 
vulgaris]
Length=224

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 97/148 (66%), Gaps = 14/148 (9%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRR-KR  362
            TVLTVWKKSLL NC GFTVF+ KGNL+YRVDNY   +   EIVLMDASG S+FT+RR K 
Sbjct  44   TVLTVWKKSLLMNCTGFTVFNCKGNLIYRVDNY--RARPGEIVLMDASGTSMFTMRRHKT  101

Query  363  LSLADNWVVYDGETAD------RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVF  524
            L L D+W+VY G+ +D      +PL  V+K+V++L + S        G+  K       +
Sbjct  102  LRLVDDWLVYQGDASDQNSKKKQPLCYVKKNVNILQTNSNVLAQVFLGTSNKNP----TY  157

Query  525  EIEGSYANRSCVMYDNVRRR-VAEIKRK  605
             IEGSY  RSC + D + ++ VAEIKRK
Sbjct  158  VIEGSYGRRSCKVIDKLSKKIVAEIKRK  185



>ref|XP_007158538.1| hypothetical protein PHAVU_002G160600g [Phaseolus vulgaris]
 gb|ESW30532.1| hypothetical protein PHAVU_002G160600g [Phaseolus vulgaris]
Length=221

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 96/154 (62%), Gaps = 21/154 (14%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKRLS  368
            LTVW+KSL+ +C GFTV D  GNLVYRVDNY    N  E+ LMDASG S+ T+ RR+RL 
Sbjct  34   LTVWRKSLVMSCKGFTVIDCCGNLVYRVDNYIGRPN--EVTLMDASGKSILTMFRRRRLG  91

Query  369  LADNWVVYDGETADR-------------PLYSVRKHVSLL--NSKSLAHVTSLRGSGAKG  503
            L D W VY+GE  +              P+Y V+KHV++L  NS  LA+V   RG  +  
Sbjct  92   LLDGWFVYEGEVGNNIRTRSDFSKPSKSPIYRVKKHVNILHGNSNVLAYV--FRGV-SHS  148

Query  504  SKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
             K    F +EGSYA+RSC + D  RR VAEIKRK
Sbjct  149  DKRCVAFTVEGSYAHRSCKVLDQCRRVVAEIKRK  182



>ref|XP_004503664.1| PREDICTED: protein LURP-one-related 17-like [Cicer arietinum]
Length=233

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 92/156 (59%), Gaps = 19/156 (12%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRL  365
            T LTVWKKSLL NC GFTV D  GNLVYRVDNY  S +  E++LMDASGNSL T+RR RL
Sbjct  42   TTLTVWKKSLLMNCKGFTVIDSDGNLVYRVDNY--SLHPHEVILMDASGNSLLTMRRHRL  99

Query  366  SLADNWVVYDGETADR----------------PLYSVRKHVSLLNSKSLAHVTSLRGSGA  497
             L D+W VY GE   +                P+  VRK V++LN          R +  
Sbjct  100  GLVDSWNVYKGEKIGKHCTRRTCKLSRSRKSSPVCCVRKSVNILNGNPNVQAYVYRVTSD  159

Query  498  KGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
               ++A  F +EGSYANR+C + D  +  +AEIKRK
Sbjct  160  SCKRHA-AFTVEGSYANRTCKVLDEYKNTLAEIKRK  194



>gb|ACU20683.1| unknown [Glycine max]
Length=230

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 93/146 (64%), Gaps = 11/146 (8%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LS  368
            LTVW+KSL+ +C GFTV D  GNLVYRVDNY    N  E++LMDASGNS+ T+RR R L 
Sbjct  43   LTVWRKSLVISCKGFTVIDPYGNLVYRVDNYIVHPN--EVILMDASGNSVLTLRRSRKLG  100

Query  369  LADNWVVYDGETA-------DRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFE  527
            L D+W VY+GE         D P+  VRK V++L+ K        R +     ++A  F 
Sbjct  101  LVDSWFVYEGEMGKQKVKSRDSPVCCVRKRVNILDGKPKVQAYVYRVTSDSDKRHA-AFT  159

Query  528  IEGSYANRSCVMYDNVRRRVAEIKRK  605
            IEGSYA+R+C + D  ++ VAEIKRK
Sbjct  160  IEGSYAHRTCKVLDEYKKAVAEIKRK  185



>ref|XP_002272759.1| PREDICTED: protein LURP-one-related 17 [Vitis vinifera]
 ref|XP_010658453.1| PREDICTED: protein LURP-one-related 17 [Vitis vinifera]
 emb|CBI34400.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 97/153 (63%), Gaps = 23/153 (15%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LS  368
            LTVW+KSLLF+C GFTV D  G+LVYRVDNY       E+ LMDASG S+ T+RR++ L 
Sbjct  37   LTVWRKSLLFSCTGFTVIDSYGDLVYRVDNYI-GQRPGEVTLMDASGKSVLTVRRRKNLR  95

Query  369  LADNWVVYDGETAD-----------RPLYSVRKHVSLL--NSKSLAHVTSLRGSGAKGSK  509
            L +NW VY+GE  D           +P+ SV+KH+++L  N   LA+V         G+ 
Sbjct  96   LVENWHVYEGEVGDTSRTKRPSSSKQPICSVKKHINILHANHNVLAYV-------FLGNS  148

Query  510  NAR-VFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            + R  + IEGSYANRSC + D  RR VAEIKRK
Sbjct  149  DKRYAYRIEGSYANRSCKVLDKSRRVVAEIKRK  181



>ref|XP_003532987.1| PREDICTED: protein LURP-one-related 17-like [Glycine max]
 gb|KHN16781.1| Protein LURP-one-related 17 [Glycine soja]
Length=224

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 93/146 (64%), Gaps = 11/146 (8%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LS  368
            LTVW+KSL+ +C GFTV D  GNLVYRVDNY    N  E++LMDASGNS+ T+RR R L 
Sbjct  43   LTVWRKSLVISCKGFTVIDPYGNLVYRVDNYIVHPN--EVILMDASGNSVLTLRRSRKLG  100

Query  369  LADNWVVYDGETA-------DRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFE  527
            L D+W VY+GE         D P+  VRK V++L+ K        R +     ++A  F 
Sbjct  101  LVDSWFVYEGEMGKQKVKSRDSPVCCVRKRVNILDGKPKVQAYVYRVTSDSDKRHA-AFT  159

Query  528  IEGSYANRSCVMYDNVRRRVAEIKRK  605
            IEGSYA+R+C + D  ++ VAEIKRK
Sbjct  160  IEGSYAHRTCKVLDEYKKAVAEIKRK  185



>gb|KHN24576.1| Protein LURP-one-related 8 [Glycine soja]
Length=180

 Score =   127 bits (320),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 101/145 (70%), Gaps = 18/145 (12%)
 Frame = +3

Query  189  VLTVWKKSLLFNCDGFTVFD-DKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRL  365
            VLTVWKKSLL NC+GFTVFD  +GNLV+RVDNY  + N+ +I+LMDA+G  L TIRRKRL
Sbjct  4    VLTVWKKSLLPNCNGFTVFDTQRGNLVFRVDNYV-ARNKDQILLMDAAGTPLLTIRRKRL  62

Query  366  SL-ADNWVVYDGETADRP---LYSVRKHVSLLNSK-SLAHVTSLRGSGAKGSKNARVFEI  530
            SL +D W+V++GE + +      + RK+V   N+K +LAH+ +++   A        +EI
Sbjct  63   SLVSDTWLVFEGEGSVKQKLLFTAARKNV---NAKCTLAHIFNIKKEVA--------YEI  111

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGSYA R C  Y+N + +VAE+K K
Sbjct  112  EGSYAQRCCTFYNNNKIKVAEMKMK  136



>gb|EEE55581.1| hypothetical protein OsJ_03872 [Oryza sativa Japonica Group]
Length=293

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 98/142 (69%), Gaps = 8/142 (6%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LS  368
            LTVW+KSLLFNC GFTVFD KGNL YRVD+ YD+ +  E+VL+DA+G   FT+RRKR LS
Sbjct  113  LTVWRKSLLFNCKGFTVFDAKGNLAYRVDS-YDTESGDEVVLIDAAGAPAFTVRRKRQLS  171

Query  369  L-ADNWVVYDGETADR--PLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGS  539
            L  + W+V+ GE   R  P+Y+VR+       KSLA VT    +GA  +  +  +E+EGS
Sbjct  172  LQGEQWLVFAGEADGRRPPVYAVRR-TGRGGGKSLARVTPC--AGAAAAGASAAYEVEGS  228

Query  540  YANRSCVMYDNVRRRVAEIKRK  605
            YA R CV+YD  RR VAE++ K
Sbjct  229  YARRCCVVYDGERRAVAEVRPK  250



>emb|CDP12084.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 100/153 (65%), Gaps = 17/153 (11%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNR-AEIVLMDASGNSLFTI-RRK  359
            T LTVW+KSL+F+C+GFTVF   G+LVYRVD+Y     R  +++LMD SG  + TI RRK
Sbjct  36   TSLTVWRKSLIFSCEGFTVFGSDGSLVYRVDSYTGRGRRPGQVILMDGSGKPILTISRRK  95

Query  360  RLSLADNWVVYDGETAD---------RPLYSVRKHVSLL--NSKSLAHVTSLRGSGAKGS  506
            +L L D+W+VY+GE  +          P++ VRK +++L  N   LA+V   RG G    
Sbjct  96   KLGLVDSWLVYEGEVDEYCSNKKSVIEPIFCVRKSLNVLQPNFNVLAYV--YRGGGMSDK  153

Query  507  KNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            +++ V  +EGSYA+RSC + D  RR VAEIKRK
Sbjct  154  RHSYV--VEGSYAHRSCKVLDGSRRVVAEIKRK  184



>gb|KEH21151.1| tubby C 2 protein [Medicago truncatula]
Length=233

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 94/153 (61%), Gaps = 18/153 (12%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LS  368
            LTVWKKSL+ NC GFTV D  GNLVYRVDNY  S +  E+VLMDASGNSL ++RR+R L 
Sbjct  45   LTVWKKSLVINCKGFTVIDSCGNLVYRVDNY--SLHPHEVVLMDASGNSLLSMRRQRKLG  102

Query  369  LADNWVVYDGETADR--------------PLYSVRKHVSLLNSKSLAHVTSLRGSGAKGS  506
            L D+W VY+GET +               P+  VRK V++LN  +       R +     
Sbjct  103  LGDSWFVYEGETGNHSTRKTCKLERSRKSPVCCVRKSVNILNGNTNVQAYVHRVASDSDK  162

Query  507  KNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            + A  F +EGSYA R+C + D  +R VAE+KRK
Sbjct  163  RQA-AFTVEGSYARRTCKVLDENKRAVAELKRK  194



>ref|XP_004962480.1| PREDICTED: protein LURP-one-related 8-like [Setaria italica]
Length=223

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 100/154 (65%), Gaps = 17/154 (11%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL  371
            LTVW++SLLFN  GFTVFD KGNLVYRV+ Y   S R E+VLMDA G+ L TIRRK+LSL
Sbjct  36   LTVWRRSLLFNGKGFTVFDCKGNLVYRVETYGGGSPR-EVVLMDADGHGLLTIRRKKLSL  94

Query  372  ADNWVVYDGETADRPL-------YSVRKHVSLLNSKSLAHVTSLR---GSGAKGSKNARV  521
            AD W++YDG+ A  P        ++ R+HVSL  ++SLAH++  R    S   G+  +  
Sbjct  95   ADEWLIYDGDAAASPSAAAPPKRFTARRHVSLRPTRSLAHLSPARRPSCSTDAGAAPSCR  154

Query  522  FEIEGSYANRSCVMY------DNVRRRVAEIKRK  605
            +++EGSYA RS  ++         RRRVA + +K
Sbjct  155  YDVEGSYAGRSLDVFASSVSGGEQRRRVATVCQK  188



>ref|XP_008679348.1| PREDICTED: protein LURP-one-related 8-like [Zea mays]
 gb|AFW64648.1| hypothetical protein ZEAMMB73_908287 [Zea mays]
Length=242

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 112/190 (59%), Gaps = 21/190 (11%)
 Frame = +3

Query  81   MTKVHPNAA-SAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            M KVHPNAA S + TA A    P  A       P  TVLTVW+KSLLFNCDGFTV+D  G
Sbjct  1    MAKVHPNAAGSVVATAAAVGRAPAEA----DGEPS-TVLTVWRKSLLFNCDGFTVYDASG  55

Query  258  NLVYRVDNYYDSS---NRAEIVLMDASGNSLFTIRRK-RLSLADNWVVYDGETAD-----  410
            +L +RVD Y  S+    RA +VLMDASG  L T+RRK RL LA+ WV+YD +  D     
Sbjct  56   DLAFRVDCYAGSTRRWRRAGVVLMDASGKPLLTVRRKTRLGLAERWVIYDADADDGTTTT  115

Query  411  ---RPLYSVRKHV-SLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSC-VMYDNV  575
                PL SVR+ + +   + +LAH ++  G+    +  A  + +EGSY  R+C V  +  
Sbjct  116  ARATPLLSVRRRIGACCKTLALAH-SAAAGTDDAAAAAALSYVVEGSYGRRACAVREERG  174

Query  576  RRRVAEIKRK  605
               VAE++RK
Sbjct  175  GAVVAEVQRK  184



>ref|XP_002441278.1| hypothetical protein SORBIDRAFT_09g023720 [Sorghum bicolor]
 gb|EES19708.1| hypothetical protein SORBIDRAFT_09g023720 [Sorghum bicolor]
Length=224

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 113/196 (58%), Gaps = 36/196 (18%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            +  KVHPN A  +P +L       PA   ++       LTVW+KSLLFN  GFTVFD +G
Sbjct  1    MTAKVHPNVA--VPPSLGQPPAVAPAPAPVT-------LTVWRKSLLFNGRGFTVFDARG  51

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLS----LADNWVVYDGETADR--PL  419
            +LVYRVD+ Y S +RAE+VLMDA+G  + T+RR++L      +D W+VY GE   R  PL
Sbjct  52   DLVYRVDS-YASDSRAEVVLMDAAGCPVLTLRRRKLIGLGLGSDQWLVYPGEETRRLPPL  110

Query  420  YSVRKHVSLL-------NSKSLAHV-------TSLRGSGAKGSKNARVFEIEGSYANRSC  557
            Y+V++             +KS+AHV        + + +GA G      +E+EGSY  R C
Sbjct  111  YAVKRAAPQYMRGGFGGGAKSMAHVAACSGGGAAAKTTGAGG------YEVEGSYLRRRC  164

Query  558  VMYDNVRRRVAEIKRK  605
             +YD  RR VAE++ K
Sbjct  165  TVYDERRRAVAEVRPK  180



>ref|NP_001147495.1| GTP binding protein [Zea mays]
 gb|ACG27721.1| GTP binding protein [Zea mays]
 tpg|DAA57104.1| TPA: GTP binding protein [Zea mays]
Length=212

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 107/180 (59%), Gaps = 17/180 (9%)
 Frame = +3

Query  81   MTKVHPNA--ASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDK  254
            M KVHPN   +S+ P   A       A        + T LTVW+KSLLFNC G+TVFD +
Sbjct  1    MAKVHPNVLLSSSSPAEGA-------AAAAAGGEGEETSLTVWRKSLLFNCRGYTVFDAR  53

Query  255  GNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLA-DNWVVYDGETADRPLYSVR  431
            G+L YR D+Y      AE+VLMD +G   FT+RR+RLSL+ + W++Y GE   RP Y+V+
Sbjct  54   GDLAYRADSY---DAEAEVVLMDPAGRPAFTVRRRRLSLSGEQWLIYAGEETRRPAYAVK  110

Query  432  KHVSLLNSKSLAHVT-SLRGSGAKGSKNARVFEIEGSYANRSCVMYD-NVRRRVAEIKRK  605
            +       KS+A VT       A G+     +E+EGSYA R CV+YD + RR VAE++ K
Sbjct  111  RGGG--GGKSVARVTPCAAVPAAAGAAALPAYEVEGSYARRRCVVYDAHQRRAVAEVQPK  168



>gb|AFK37758.1| unknown [Medicago truncatula]
Length=233

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 93/153 (61%), Gaps = 18/153 (12%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LS  368
            LTVWKKSL+ NC GFTV D  GNLVYRVDNY  S +  E+VLMDASGN L ++RR+R L 
Sbjct  45   LTVWKKSLVINCKGFTVIDSCGNLVYRVDNY--SLHPHEVVLMDASGNFLLSMRRQRKLG  102

Query  369  LADNWVVYDGETADR--------------PLYSVRKHVSLLNSKSLAHVTSLRGSGAKGS  506
            L D+W VY+GET +               P+  VRK V++LN  +       R +     
Sbjct  103  LGDSWFVYEGETGNHSTRKTCKLERSRKSPVCCVRKSVNILNGNTNVQAYVHRVASDSDK  162

Query  507  KNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            + A  F +EGSYA R+C + D  +R VAE+KRK
Sbjct  163  RQA-AFTVEGSYARRTCKVLDENKRAVAELKRK  194



>ref|NP_001239726.1| uncharacterized protein LOC100782098 [Glycine max]
 gb|ACU23823.1| unknown [Glycine max]
 gb|KHM99940.1| Protein LURP-one-related 17 [Glycine soja]
Length=229

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 92/151 (61%), Gaps = 15/151 (10%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LS  368
            LTVW+KSL+ +C GFTV D  GNLVYRVDNY    N  E++LMDASGNSL T+RR R L 
Sbjct  42   LTVWRKSLVISCKGFTVIDSYGNLVYRVDNYIMHPN--ELILMDASGNSLLTMRRSRKLG  99

Query  369  LADNWVVYDGE------------TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKN  512
            L D W VY+GE            + +RP+  VRK V++L+ K+      +  + +   K 
Sbjct  100  LVDRWFVYEGEMGKQSTRSKSVKSKERPVCCVRKRVNILDGKANKVQAYVYRAASDSDKR  159

Query  513  ARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
               F +EGSYA+R+C + D  +  V EIKRK
Sbjct  160  HPAFTVEGSYAHRTCKVLDEYKNAVVEIKRK  190



>ref|XP_012086809.1| PREDICTED: protein LURP-one-related 17 [Jatropha curcas]
Length=224

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 97/151 (64%), Gaps = 13/151 (9%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKR  362
            T LTVW+KSLL NC+GFTV +  G+LVYRVDNY    +  E+VLMDASG S+ T+ R+K+
Sbjct  37   TSLTVWRKSLLVNCNGFTVINSNGDLVYRVDNYIVRPH--ELVLMDASGKSILTMHRKKK  94

Query  363  LSLADNWVVYDGET---------ADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNA  515
            L L D+W+VY+GE          + +P++SV+KH ++L +    +  ++     +G+   
Sbjct  95   LGLGDSWLVYEGEVGKCCSTTRISKKPIWSVKKHSNILQASKNNNNNNVLAYVFRGTAEK  154

Query  516  RV-FEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            R  + IEGSY  RSC + D  R  VAEIKRK
Sbjct  155  RYSYVIEGSYTQRSCKVVDESRTTVAEIKRK  185



>ref|XP_008656402.1| PREDICTED: protein LURP-one-related 8-like [Zea mays]
 gb|AFW82333.1| hypothetical protein ZEAMMB73_916080 [Zea mays]
Length=226

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 109/194 (56%), Gaps = 35/194 (18%)
 Frame = +3

Query  78   LMTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            +  KVHPN A+  P  L  +    PA       P    LTVW+KSLLFNC GFTVFD +G
Sbjct  1    MTAKVHPNVAAPSP-GLGQQ----PAVAPGDGEPAAVTLTVWRKSLLFNCRGFTVFDARG  55

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL---------ADNWVVYDGETAD  410
            +LVYRVD+ Y S +RAE+VLMDA+G  + T+RR+   L         +D W++Y G    
Sbjct  56   DLVYRVDS-YASDSRAEVVLMDAAGRPVLTVRRRCRKLIGLVGLGLSSDQWLLYRGVDEA  114

Query  411  R---PLYSVRKHVSLLN-----SKSLAHVTSLR-GSGAKGSKNARVFEIEGSYANRSCVM  563
            R   PLY++++  +        +KS+AHV +   G+G         +E+EGSY  R C +
Sbjct  115  RRLPPLYAMKRAAAQSQHMRGGAKSVAHVAACSAGAG---------YEVEGSYLRRRCTV  165

Query  564  --YDNVRRRVAEIK  599
              YD  RR VAE++
Sbjct  166  YEYDGRRRAVAEVR  179



>gb|AFK40792.1| unknown [Lotus japonicus]
Length=236

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 93/156 (60%), Gaps = 18/156 (12%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDG-FTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIR--R  356
            T LTVW+KSL+ +C G FTV D  GNLVYRVDNY    +  E+ LMDASGNSL T+R  R
Sbjct  44   TSLTVWRKSLVISCKGGFTVIDSHGNLVYRVDNYILHPD--EVTLMDASGNSLLTMRHRR  101

Query  357  KRLSLADNWVVYDGETAD-------------RPLYSVRKHVSLLNSKSLAHVTSLRGSGA  497
            K+L L D+W VY+GET                P+  VRK V++LN  S       R +  
Sbjct  102  KKLGLVDSWFVYEGETGKLHIKRSKLGNLRKSPVCCVRKRVNILNGNSGVQACVYRVAPD  161

Query  498  KGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
               K   +F +EGSYA+R+C + D  ++ VAEIKRK
Sbjct  162  SDDKGHAMFTVEGSYADRTCKVLDEYKKTVAEIKRK  197



>ref|NP_001055161.1| Os05g0311500 [Oryza sativa Japonica Group]
 dbj|BAF17075.1| Os05g0311500 [Oryza sativa Japonica Group]
 gb|EEE63199.1| hypothetical protein OsJ_18009 [Oryza sativa Japonica Group]
Length=215

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 111/190 (58%), Gaps = 31/190 (16%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPN A   P  + +E+             +   LTVW++SLLFN  GFTVFD KGN
Sbjct  1    MTKVHPNVAVVAPAVVEEEK------------GEAVSLTVWRRSLLFNGKGFTVFDGKGN  48

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPL-----YS  425
            LV+RV++Y   S R E+VLMDA G +L TIRRK+LS AD W++YDG+ A         ++
Sbjct  49   LVFRVESYAGGSPR-EVVLMDADGRALLTIRRKKLSFADEWLIYDGDAASPAAPGPKRFT  107

Query  426  VRKHVSLLNSKSLAHVTSLRGSGAKGS--------KNARVFEIEGSYANRSCVMYDNV--  575
             R+HVSL  +KSLAH++  R S +  +          A  +++EGSYA R   ++ +   
Sbjct  108  ARRHVSLRPTKSLAHLSPARASSSAAAGGGSATAPSGACRYDVEGSYAARCLDVFASASA  167

Query  576  ---RRRVAEI  596
               RRRVA +
Sbjct  168  GEQRRRVAAV  177



>ref|XP_007040364.1| UPF0706 protein, putative [Theobroma cacao]
 gb|EOY24865.1| UPF0706 protein, putative [Theobroma cacao]
Length=214

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 92/152 (61%), Gaps = 20/152 (13%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRR-KR  362
            T LTVW+KSL+ NC+GFTV D  GNLVYRVDNY       E++LMD SG S+ T+RR K 
Sbjct  32   TSLTVWRKSLIVNCNGFTVIDSDGNLVYRVDNYMGRPK--ELILMDGSGKSILTMRRGKN  89

Query  363  LSLADNWVVYDGETAD---------RPLYSVRKHVSLL--NSKSLAHVTSLRGSGAKGSK  509
            L L D W+VY GE  D         +P++ VRK +++L  N   LA+V        + S 
Sbjct  90   LGLVDTWLVYRGEVDDYCTSSTPSEKPIFYVRKRINILHANPNVLAYVYR------RSSD  143

Query  510  NARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                + IEGSY+ RSC + D  +R VAEI+RK
Sbjct  144  KRYAYMIEGSYSQRSCKVLDETKRVVAEIRRK  175



>ref|XP_007160113.1| hypothetical protein PHAVU_002G293600g [Phaseolus vulgaris]
 gb|ESW32107.1| hypothetical protein PHAVU_002G293600g [Phaseolus vulgaris]
Length=228

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 92/151 (61%), Gaps = 16/151 (11%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LS  368
            LTVWKKSL+ +C GFTV D  GNL YRVDNY    +  E++LMDASGNS+ T+ R R L 
Sbjct  42   LTVWKKSLVISCKGFTVIDSYGNLAYRVDNYI--GHPKEVILMDASGNSVLTLHRSRKLG  99

Query  369  LADNWVVYDGETADRPLYS------------VRKHVSLLNSKSLAHVTSLRGSGAKGSKN  512
            L D+W VY+GET  +   S            VRK V+LL+ K        R +     ++
Sbjct  100  LVDSWFVYEGETGTQSPRSKWCKSKNSAVCCVRKRVNLLDGKPKVQAFVYRVASDSDKRH  159

Query  513  ARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            A  F +EGSYA+R+C ++D  R+ VAEIKRK
Sbjct  160  A-AFTVEGSYAHRTCKVFDEYRKVVAEIKRK  189



>ref|XP_011074224.1| PREDICTED: protein LURP-one-related 8 [Sesamum indicum]
Length=218

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 94/150 (63%), Gaps = 19/150 (13%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKRLS  368
            LTVW KSL+F+C GFTV    G+LVYRVDNY    ++   +LMD SGN +FTI RRK+L 
Sbjct  37   LTVWTKSLVFSCKGFTVIGPDGSLVYRVDNYTGRPDQT--LLMDGSGNPIFTICRRKKLG  94

Query  369  LADN-WVVYDGETAD--------RPLYSVRKHVSLLNSKS--LAHVTSLRGSGAKGSKNA  515
            L DN W VY+GE  +        +P++ VRK+ S++  K   LA+V     SG   S+  
Sbjct  95   LVDNHWQVYEGEMGNNNINSSSKKPMFCVRKNTSIMRRKPSVLAYV-----SGGMLSERG  149

Query  516  RVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
              + IEGSY +RSC + D  +R VAEIK+K
Sbjct  150  HTYTIEGSYVHRSCKILDTTKRVVAEIKKK  179



>gb|KJB19104.1| hypothetical protein B456_003G085200 [Gossypium raimondii]
Length=221

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 96/149 (64%), Gaps = 16/149 (11%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRR-KR  362
            T LTVW+KSLL +C+GFTV D  GNLVYRVDNY     + E+VLMD  GNS+ T+RR K 
Sbjct  41   TSLTVWRKSLLISCNGFTVIDSNGNLVYRVDNYMGGRTK-ELVLMDGKGNSILTMRRCKN  99

Query  363  LSLADNWVVYDGE-----TADRPLYSVRKHVSLLN---SKSLAHVTSLRGSGAKGSKNAR  518
            L L D WV+Y GE     T+++P++ V+K +++L+   S  LA+V          S    
Sbjct  100  LRLVDTWVIYGGEVGDHCTSEKPIFYVKKCINILHTNKSNVLAYVYR------PPSDKRY  153

Query  519  VFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
             + IEGSY++RSC + +  +R VAEIKRK
Sbjct  154  AYTIEGSYSHRSCKVVNEKKRVVAEIKRK  182



>ref|XP_007209037.1| hypothetical protein PRUPE_ppa014961mg [Prunus persica]
 gb|EMJ10236.1| hypothetical protein PRUPE_ppa014961mg [Prunus persica]
Length=217

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 98/158 (62%), Gaps = 18/158 (11%)
 Frame = +3

Query  165  LSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLF  344
            L++    T LTVW+KSLL +C GFTV D  G+LVYRVDNY    +  E+VLMDASG S+ 
Sbjct  28   LNTVGACTTLTVWRKSLLISCKGFTVIDSNGDLVYRVDNYV--GHPEEVVLMDASGKSVL  85

Query  345  TIRRKRLSLADNWVVYDGETAD---------RPLYSVRKHVSLLNSKS--LAHVTSLRGS  491
            T+RR++L+L D+W V++GE  D          P + VRK++++LN+    LA+V      
Sbjct  86   TMRRRKLTLVDSWFVHEGEVGDYCRTRTSKSSPTFCVRKNMNMLNANPNILAYVY----R  141

Query  492  GAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
             A G K    + IEGSY +RSC + D     VAEIKRK
Sbjct  142  EAWGHKR-YAYLIEGSYTHRSCKVLDEYSNVVAEIKRK  178



>gb|EAY97485.1| hypothetical protein OsI_19414 [Oryza sativa Indica Group]
Length=215

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 111/190 (58%), Gaps = 31/190 (16%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHPN A   P  + +E+             +   LTVW++SLLFN  GFTVFD KGN
Sbjct  1    MTKVHPNVAVVAPAVVEEEK------------GEAVSLTVWRRSLLFNGKGFTVFDGKGN  48

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETADRPL-----YS  425
            LV+RV++Y   S R E+VLMDA G +L TIRRK+LS AD W++YDG+ A         ++
Sbjct  49   LVFRVESYAGGSPR-EVVLMDADGRALLTIRRKKLSFADEWLIYDGDAASPAAPAPKRFT  107

Query  426  VRKHVSLLNSKSLAHVTSLRGSGAKGS--------KNARVFEIEGSYANRSCVMYDNV--  575
             R+HVSL  +KSLAH++  R S +  +          A  +++EGSYA R   ++ +   
Sbjct  108  ARRHVSLRPTKSLAHLSPARASSSAAAGGGSATAPSGACRYDVEGSYAARCLDVFASASA  167

Query  576  ---RRRVAEI  596
               RRRVA +
Sbjct  168  GEQRRRVAAV  177



>ref|XP_006654556.1| PREDICTED: protein LURP-one-related 8-like [Oryza brachyantha]
Length=226

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 93/149 (62%), Gaps = 16/149 (11%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR---  362
            LTVW+KSLLFNC GFTVFD  G+LVYRVD+ Y + +RAE+VLMDA+G  + T+RRK+   
Sbjct  40   LTVWRKSLLFNCRGFTVFDASGDLVYRVDS-YAADSRAEVVLMDAAGVPVLTVRRKKAIS  98

Query  363  -LSL-ADNWVVYDG-ETADRPLYSVRKHVSLL----NSKSLAHVTSLRGSGAKGSKNARV  521
             L L  D W+VY G ET   PLY+V++    +    N K++AHV                
Sbjct  99   HLGLGGDQWLVYPGEETRLPPLYAVKRTTQYVRGGGNGKTMAHVAPC----GVRGGAGGG  154

Query  522  FEIEGSYANRSCVMYDNVRRRV-AEIKRK  605
            +E+EGSY  R C +YD  RR V AE++ K
Sbjct  155  YEVEGSYLRRHCTVYDQQRRAVGAEVQPK  183



>gb|ABK26200.1| unknown [Picea sitchensis]
Length=208

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 107/177 (60%), Gaps = 15/177 (8%)
 Frame = +3

Query  87   KVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLV  266
            K+HP+        + D++L   +          T LTVW+KSL+F+C+GFTVFD  GNLV
Sbjct  4    KIHPHEPELSRRVVVDDKLSNSSV---------TALTVWRKSLVFSCNGFTVFDSSGNLV  54

Query  267  YRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LSLADNWVVYDGETAD--RPLYSVRKH  437
            +RVDN Y S  + EIVLMDA+G +L TIRRK  LSL + W  + GE  D  +PL+ VR+ 
Sbjct  55   FRVDN-YASDLKDEIVLMDAAGMALLTIRRKSWLSLQNQWKGFLGEFRDGKKPLFVVRRV  113

Query  438  VSLL-NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
             SLL  +K+LA V     +  KG K    + +EG YA RS  + +++ + VAE+K K
Sbjct  114  TSLLIPTKTLAEVYMCSSAKRKG-KPQFDYRVEGYYAKRSFTILNSLNKVVAEVKPK  169



>gb|AFK42040.1| unknown [Lotus japonicus]
Length=236

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 93/156 (60%), Gaps = 18/156 (12%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDG-FTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIR--R  356
            T LTVW+KSL+ +C G FTV D  GNLVYRVD+Y    +  E+ LMDASGNSL T+R  R
Sbjct  44   TSLTVWRKSLVISCKGGFTVIDSHGNLVYRVDDYILHPD--EVTLMDASGNSLLTMRHRR  101

Query  357  KRLSLADNWVVYDGETAD-------------RPLYSVRKHVSLLNSKSLAHVTSLRGSGA  497
            ++L L D+W VY+GET                P+  VRK V++LN  S       R +  
Sbjct  102  EKLGLVDSWFVYEGETGKLHIKRSKLGNLRKSPVCCVRKRVNILNGNSGVQACVYRVAPD  161

Query  498  KGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
               K   +F +EGSYA+R+C + D  ++ VAEIKRK
Sbjct  162  SDDKGHAMFTVEGSYADRTCKVLDEYKKTVAEIKRK  197



>ref|XP_004146535.1| PREDICTED: protein LURP-one-related 17 [Cucumis sativus]
 gb|KGN53359.1| hypothetical protein Csa_4G050160 [Cucumis sativus]
Length=217

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 102/175 (58%), Gaps = 24/175 (14%)
 Frame = +3

Query  120  TALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSN  299
            + L  EEL +  C    SP     LTVW+KSLL +C+GFTV D  GN+VYRVDNY  +  
Sbjct  15   SQLPPEEL-KETCAVSGSP---VSLTVWRKSLLLSCNGFTVIDRNGNIVYRVDNY--TGR  68

Query  300  RAEIVLMDASGNSLFTI-RRKRLSLADNWVVYDGETA-------DRPLYSVRKHVSLL--  449
              E++LMD  G S+ T+ R K+L L +NW VY+GE         ++P+  V+K++++L  
Sbjct  69   PEEMILMDGLGKSVLTMCRSKKLGLGENWCVYEGEVEGKTKGRKNKPICRVKKNINILHV  128

Query  450  --NSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRR-VAEIKRK  605
              N K LAHV   R      SK    + +EGSY  RSC + D   RR VAE++RK
Sbjct  129  DPNRKVLAHVYDYR-----ISKKKYAYSVEGSYGERSCKVLDGASRRVVAEVRRK  178



>ref|XP_008451999.1| PREDICTED: protein LURP-one-related 17 [Cucumis melo]
Length=216

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 94/154 (61%), Gaps = 20/154 (13%)
 Frame = +3

Query  183  PTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRK  359
            P  LTVW+KSLL  C+GFTV D  GN+VYRVDNY  +    E++LMD  G S+ T+ R K
Sbjct  31   PVSLTVWRKSLLLTCNGFTVIDRNGNIVYRVDNY--TGRPEEMILMDGLGKSVLTMCRSK  88

Query  360  RLSLADNWVVYDGETA-------DRPLYSVRKHVSLL----NSKSLAHVTSLRGSGAKGS  506
            +L L +NW VY+GE         ++P+  V+K++++L    N+K LA+V   R      S
Sbjct  89   KLGLGENWCVYEGEVEGKTRGRKNKPICRVKKNINILHVDPNAKVLAYVYDYR-----IS  143

Query  507  KNARVFEIEGSYANRSCVMYDNVRRR-VAEIKRK  605
            K    + +EGSY  RSC + D   RR VAE+KRK
Sbjct  144  KKKYAYSVEGSYGERSCKVLDAASRRVVAEVKRK  177



>ref|NP_001055871.1| Os05g0484800 [Oryza sativa Japonica Group]
 gb|AAT01396.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17785.1| Os05g0484800 [Oryza sativa Japonica Group]
 dbj|BAG92719.1| unnamed protein product [Oryza sativa Japonica Group]
Length=234

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 97/152 (64%), Gaps = 15/152 (10%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-  362
             VLTVW+KSLLFNC GFTVFD  G+LVYRVD+ Y + +RAE+VLMDA+G  + T+RRK+ 
Sbjct  43   VVLTVWRKSLLFNCRGFTVFDASGDLVYRVDS-YAADSRAEVVLMDAAGVPVLTVRRKKA  101

Query  363  ----LSL-ADNWVVYDG-ETADRPLYSVRKHVSLLNS----KSLAHVTSLRGSGAKGSKN  512
                L L  D W+V+ G ET   PLY+V++    +      K++AHV       A G+  
Sbjct  102  IGSQLGLGGDQWLVHPGEETRLPPLYAVKRTPQYVRGGGSVKTMAHVAPC--GVALGAGG  159

Query  513  ARVFEIEGSYANRSCVMYDNVRRR-VAEIKRK  605
               +EIEGSY  RSC +YD  RR  VAE++ K
Sbjct  160  GGGYEIEGSYLRRSCAVYDARRRAVVAEVQAK  191



>ref|XP_008362689.1| PREDICTED: protein LURP-one-related 17-like [Malus domestica]
Length=227

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 94/153 (61%), Gaps = 17/153 (11%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKR  362
            T LTVW+KSLL +C GFTV D  G+LVYRVDNY    +  E++LMD SG S+ T+ RRK+
Sbjct  40   TSLTVWRKSLLISCKGFTVIDSNGDLVYRVDNYI--GHPEEVILMDGSGKSVLTMRRRKK  97

Query  363  LSLADNWVVYDGETA------------DRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGS  506
            LSL D W V++GET              RP + VRK+++++N+   + +  +        
Sbjct  98   LSLVDGWFVHEGETGGCCTKRATAASKSRPTFYVRKNMNMINTNPSSLLAYVYRETCGHK  157

Query  507  KNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            ++A V  IEGSY +RSC + D  R  VAEIK+K
Sbjct  158  RHAYV--IEGSYTHRSCKVSDESRNVVAEIKKK  188



>ref|XP_002298007.2| hypothetical protein POPTR_0001s09960g [Populus trichocarpa]
 gb|EEE82812.2| hypothetical protein POPTR_0001s09960g [Populus trichocarpa]
Length=217

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 100/158 (63%), Gaps = 22/158 (14%)
 Frame = +3

Query  165  LSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLF  344
            +S+  + T+LTVW+KSLL +C+GFTV +  G+LVYRVDNY D     E++LMD SG S+ 
Sbjct  32   ISTDGKCTLLTVWRKSLLISCNGFTVINSCGDLVYRVDNYIDRPE--ELILMDGSGKSIL  89

Query  345  TI-RRKRLSL-ADNWVVYDGETADR---------PLYSVRKHVSLLNSKSLAHVTSLRGS  491
            T+ RRK+L +  D+W+VY+GE  +          P++ VRK+    N  +LA+V   RGS
Sbjct  90   TMRRRKKLGVRIDSWLVYEGEVGNHCARTKLSKNPIWCVRKNT---NHNALAYV--FRGS  144

Query  492  GAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
              K       F IEGSY +RSC + D  R+ +AEIKRK
Sbjct  145  SDKRPS----FVIEGSYTHRSCKVLDGSRKVLAEIKRK  178



>ref|XP_011022756.1| PREDICTED: protein LURP-one-related 17-like [Populus euphratica]
Length=206

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 96/153 (63%), Gaps = 21/153 (14%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKR  362
            T LTVW+KSLL +C+GFTV +  G+LVYRVDNY D  +  E++LMD SG S+ T+ RRK+
Sbjct  23   TSLTVWRKSLLISCNGFTVINSCGDLVYRVDNYIDRPD--ELILMDGSGKSILTMRRRKK  80

Query  363  LS-LADNWVVYDGETAD---------RPLYSVRKHVSLL--NSKSLAHVTSLRGSGAKGS  506
            L  L  NW VY+GE  +         +P++ VRK++++L  N   LA+V   RGS  K  
Sbjct  81   LGVLVHNWFVYEGEVGNYCAANKLSKKPIWCVRKNINILQTNHNVLAYV--FRGSADKRH  138

Query  507  KNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                 F IEGSY  RSC +    R+ +AEIKRK
Sbjct  139  S----FVIEGSYTRRSCKVLGGSRKVLAEIKRK  167



>ref|XP_002509870.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51257.1| conserved hypothetical protein [Ricinus communis]
Length=227

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 94/158 (59%), Gaps = 23/158 (15%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRR---  356
            T LTVW+KSL+ NC+GFTV +  G+L YRVD+Y    +  E++LMD SG S+ T+ R   
Sbjct  36   TSLTVWRKSLIINCNGFTVINSHGDLAYRVDSYMVRPH--ELILMDGSGKSVLTVHRRKM  93

Query  357  ---KRLSLADNWVVYDGETA----------DRPLYSVRKHVSLL--NSKSLAHVTSLRGS  491
               ++L L DNW V  GE             +P++SV+KH+S+L  N   LAHV   RGS
Sbjct  94   KFLQKLGLGDNWEVCAGEVGRYCSTTTELTKKPIWSVKKHISILRGNDNVLAHV--YRGS  151

Query  492  GAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
              +  +N   + IEGSY  RSC + D  R  VAEIKRK
Sbjct  152  CIE-KRNNYSYVIEGSYRQRSCKIMDESRNVVAEIKRK  188



>ref|XP_011026970.1| PREDICTED: protein LURP-one-related 17-like [Populus euphratica]
Length=233

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 99/158 (63%), Gaps = 22/158 (14%)
 Frame = +3

Query  165  LSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLF  344
            +S+  + T LTVW+KSLL +C+GFTV +  G+LVYRVDNY D     E++LMD SG S+ 
Sbjct  48   ISTAGKCTSLTVWRKSLLISCNGFTVINSCGDLVYRVDNYIDRPE--ELILMDGSGKSIL  105

Query  345  TI-RRKRLSL-ADNWVVYDGETAD---------RPLYSVRKHVSLLNSKSLAHVTSLRGS  491
            T+ RRK+L +  D+W+VY+GE  +          P++ VRK+    N  +LA+V   RGS
Sbjct  106  TMRRRKKLGVRIDSWLVYEGEVGNPCARTKLSKNPIWCVRKNT---NHNALAYV--FRGS  160

Query  492  GAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
              K       F IEGSY +RSC + D  R+ +AEIKRK
Sbjct  161  SDKRPS----FVIEGSYTHRSCKVLDGSRKVLAEIKRK  194



>ref|XP_009343860.1| PREDICTED: protein LURP-one-related 17 [Pyrus x bretschneideri]
Length=225

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 93/151 (62%), Gaps = 17/151 (11%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKRLS  368
            LTVW+KSLL +C GFTV D  G+LVYRVDNY    +  E++LMD SG S+ T+ RRK+LS
Sbjct  40   LTVWRKSLLISCKGFTVIDSNGDLVYRVDNYV--GHPEEVILMDGSGKSVLTMRRRKKLS  97

Query  369  LADNWVVYDGETA------------DRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKN  512
            L D W V++G+T              RP + VRK++++LN+   + +  +        ++
Sbjct  98   LVDGWFVHEGDTGGCCTKRATAASKSRPTFYVRKNMNMLNTNPSSLLAYVYRETCGHKRH  157

Query  513  ARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            A V  IEGSY +RSC + D  R  VAEIK+K
Sbjct  158  AYV--IEGSYTHRSCKVSDESRNVVAEIKKK  186



>ref|XP_002304522.1| hypothetical protein POPTR_0003s13300g [Populus trichocarpa]
 gb|EEE79501.1| hypothetical protein POPTR_0003s13300g [Populus trichocarpa]
Length=220

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 92/151 (61%), Gaps = 17/151 (11%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKR  362
            T LTVW+KSLL +C+GFTV +  G+LVYRVDNY D  +  E+VLMD SG S+ T+ RRK+
Sbjct  37   TSLTVWRKSLLISCNGFTVINSCGDLVYRVDNYIDRPD--ELVLMDGSGKSILTMRRRKK  94

Query  363  LS-LADNWVVYDGETAD---------RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKN  512
            L  L  NW VY+GE  +         +P++ VRK++++L +         RGS  K    
Sbjct  95   LGVLVHNWFVYEGEVGNYCATNKLSKKPIWCVRKNINILQTSHNVLAYVFRGSTDK----  150

Query  513  ARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
               F IEGSY  RSC +    R+ +AEIKRK
Sbjct  151  RHSFVIEGSYTRRSCKVIGGSRKVLAEIKRK  181



>ref|XP_002450165.1| hypothetical protein SORBIDRAFT_05g001390 [Sorghum bicolor]
 gb|EES09153.1| hypothetical protein SORBIDRAFT_05g001390 [Sorghum bicolor]
Length=233

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 97/155 (63%), Gaps = 14/155 (9%)
 Frame = +3

Query  183  PTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYD-SSNRAEIVLMDASGNSLFTIRRK  359
            PTVLTVW+KSLLFNCDGFTV+D +G+L +RVD Y   S  R ++VLMDA G  L T+RRK
Sbjct  25   PTVLTVWRKSLLFNCDGFTVYDARGDLAFRVDCYASRSRTRRDVVLMDAGGKPLLTVRRK  84

Query  360  -RLS-LADN-WVVYDGETADR--------PLYSVRKHVSLLNSKSLAHVTSLRGSGAKGS  506
             RL+ LAD  WV+YDG+            PL SVR+H +    K+LA V + R +    +
Sbjct  85   TRLAGLADRCWVIYDGDADADKSAAATPTPLLSVRRHATSGGCKTLARVDAARLALPLPA  144

Query  507  KNARVFEIEGSYANRSCVMYDNVRRR--VAEIKRK  605
              A  + +EGSY  R+C + D  R    VAE++RK
Sbjct  145  AAAPSYVVEGSYGQRACAVRDAARGGAVVAEVQRK  179



>ref|XP_006646432.1| PREDICTED: protein LURP-one-related 8-like [Oryza brachyantha]
Length=143

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 76/122 (62%), Gaps = 13/122 (11%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN A A  T +   E    A          T LTVW+KSLLFNC GFTVFD KGN
Sbjct  1    MAKVHPNVAPA--TGVVGGERGEEAAA--------TTLTVWRKSLLFNCKGFTVFDAKGN  50

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LSL-ADNWVVYDGETADRPLYSVRK  434
            L YRVD+ YDS +  E+VLMDA+G   FT+RRKR LSL  + W+V+ GE ADR    V +
Sbjct  51   LAYRVDS-YDSESGDEVVLMDAAGTPAFTVRRKRQLSLQGEQWLVFAGEAADRAARDVFR  109

Query  435  HV  440
             V
Sbjct  110  LV  111



>ref|XP_008657131.1| PREDICTED: protein LURP-one-related 8-like [Zea mays]
 gb|AFW84767.1| hypothetical protein ZEAMMB73_750978 [Zea mays]
Length=206

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 101/182 (55%), Gaps = 29/182 (16%)
 Frame = +3

Query  81   MTKVHPNA-ASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            M KVHP+   + +P + A+E+             + T LTVW+KSLLFNC G+TVFD +G
Sbjct  1    MAKVHPDRHPNVLPPSPAEEK-----------EEEATSLTVWRKSLLFNCRGYTVFDGRG  49

Query  258  NLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL----ADNWVVYDGETADRP-LY  422
            +L YRVD+Y D+   A  VLMD +G   FT+ R+   L        ++Y GE   RP +Y
Sbjct  50   DLAYRVDSYDDAGADAGAVLMDPAGRPAFTVARRSRLLGLLSGQQRLIYAGEDTRRPAVY  109

Query  423  SVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRR-RVAEIK  599
            +V +       K+ A VT    +GA        +E+EGSYA R CV+YD  RR  VAE++
Sbjct  110  AVVRR----RGKATARVTPCAAAGA-------AYEVEGSYARRRCVVYDAERRVVVAEVR  158

Query  600  RK  605
             K
Sbjct  159  PK  160



>ref|XP_007215974.1| hypothetical protein PRUPE_ppa011580mg [Prunus persica]
 gb|EMJ17173.1| hypothetical protein PRUPE_ppa011580mg [Prunus persica]
Length=205

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 92/145 (63%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            Q T+LTV K  L F  DGFTV+D KG LV+RVD+Y  D  +R+E+VLMDA G  L T+RR
Sbjct  15   QETLLTVCKTCLFFPGDGFTVYDCKGQLVFRVDSYGPDPRDRSEVVLMDAHGRCLLTVRR  74

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  ++GE  D  +P++SVR+  S++   S+    ++   G  G +    ++I
Sbjct  75   KRPSLHQRWEGFEGERTDGQKPIFSVRRS-SIIGRSSM----TVEVYGDPGEE----YQI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R C +++  +  VAEI+RK
Sbjct  126  EGSFAQRCCTIFNAEKESVAEIRRK  150



>ref|XP_010112615.1| Protein LURP-one-related 17 [Morus notabilis]
 gb|EXC34340.1| Protein LURP-one-related 17 [Morus notabilis]
Length=249

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 95/162 (59%), Gaps = 28/162 (17%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRR-KR  362
            T LTVW+KSL+ +C+GFTV D  GNL+YRVDNY       EI+LMD SG+S+ T+RR K+
Sbjct  55   TSLTVWRKSLVMSCNGFTVIDSHGNLIYRVDNYIGRPE--EIILMDGSGSSVLTMRRHKK  112

Query  363  LSLADNWVVYDGETADR-------------------PLYSVRKHVSLL-NSKSLAHVTSL  482
            L L D+W+VY+GE  D                    P++ +RK+++LL N+KS       
Sbjct  113  LGLVDSWLVYEGEIGDHLQYCKLNTSGSSRSSRSKRPIFCIRKNINLLINAKSNVLAYVY  172

Query  483  RGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRV-AEIKRK  605
            R +  K       + IEGSY +RSC + D   ++V AE +RK
Sbjct  173  RDTSDKSC----AYVIEGSYTHRSCKVLDGCTKKVLAETRRK  210



>gb|KJB24294.1| hypothetical protein B456_004G137400 [Gossypium raimondii]
Length=214

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 98/173 (57%), Gaps = 15/173 (9%)
 Frame = +3

Query  111  AIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYD  290
            ++  ++ DE   +P           T +TVW+KSL+  C GFTV D  GNLVYRVD Y  
Sbjct  10   SLSRSVHDEHQEQPELVETRGGNLCTSVTVWRKSLIVTCKGFTVIDSNGNLVYRVDTYV-  68

Query  291  SSNRAEIVLMDASGNSLFTIRRK-RLSLADNWVVYDGE-----TADRPLYSVRKHVSLLN  452
                 E+VLMD SG  + T+RR   L L   W++Y GE     T+++P++ V+K +++LN
Sbjct  69   GGRPMELVLMDGSGKPILTMRRSTNLRLVGTWLIYGGEVGEFCTSEKPVFYVKKSINILN  128

Query  453  SKS--LAHVTSLRGSGAKGSKNARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            + S  LA+V        + S     + IEGSY++RSC + D  +R VAEI+ K
Sbjct  129  ANSNVLAYVYR------RSSDKRYAYVIEGSYSHRSCKVLDETKRVVAEIRPK  175



>ref|XP_009780097.1| PREDICTED: protein LURP-one-related 17 isoform X2 [Nicotiana 
sylvestris]
Length=235

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 94/158 (59%), Gaps = 27/158 (17%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKRLS  368
            LTVW+KSL+F+C GFTV    G+LVYRVDNY  S  R +I LMD SG  + TI R K+L 
Sbjct  46   LTVWRKSLIFSCKGFTVIGSDGSLVYRVDNY--SGRRGQITLMDGSGKPILTICRHKKLR  103

Query  369  LAD-NWVVYDGETAD---------------RPLYSVRKHVSLLNS--KSLAHVTSLRGSG  494
            L D NW +Y+GE  D               +P++SV+K + +L+S    LAHV   +G  
Sbjct  104  LVDNNWFIYEGEVGDDNYNSSSSKSSSSRKKPIFSVKKQMKILHSNVNVLAHVY-YQGI-  161

Query  495  AKGSKNARVFEIEGSYANRSCVMYD-NVRRRVAEIKRK  605
               SK    + IEGSYANRSC + D   R  VAEI++K
Sbjct  162  ---SKKRYSYIIEGSYANRSCKVLDAESRNVVAEIRKK  196



>ref|XP_002450164.1| hypothetical protein SORBIDRAFT_05g001380 [Sorghum bicolor]
 gb|EES09152.1| hypothetical protein SORBIDRAFT_05g001380 [Sorghum bicolor]
Length=250

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 107/205 (52%), Gaps = 37/205 (18%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPA-CHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKG  257
            M +  PNA    P A A     R A  H      +P VLTVW+KSLL +C GFTVFD  G
Sbjct  1    MARARPNAIVPEPAAAATTTSSRGAEHHHQDDQERPAVLTVWRKSLLLSCSGFTVFDASG  60

Query  258  NLVYRVDNYYDSSNRA---------EIVLMDASGNSLFTIRRK----RLSLA-DNWVVYD  395
             L +RVD  YDS+ R          ++VLMD SG  L T+RR+     L LA D+W+++D
Sbjct  61   ALAFRVD-CYDSARRGLRRRPWRTTDVVLMDVSGTPLLTVRRRSRLTSLGLAPDHWLIFD  119

Query  396  GETA----------DRPLYSVRKH----VSLLNSKS-LAHVTSLRGSGAKGSKNARVFEI  530
            G+ A           +P  SVR+     +   N K+ LA+VT L+ SG +       + +
Sbjct  120  GDAAAGCRAEHKPKPKPFLSVRRARPALLGAFNGKAPLAYVTPLQASGGE------AYVV  173

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGSY  R+C + D     VAE++RK
Sbjct  174  EGSYGARACAVRDARGDAVAEVRRK  198



>ref|XP_008228691.1| PREDICTED: protein LURP-one-related 5-like [Prunus mume]
Length=205

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 88/145 (61%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            Q T+LTV K  L F  DGFTV+D KG LV+RVD+Y  D  +R+E+VLMDA G  L T+RR
Sbjct  15   QETLLTVSKTCLFFPGDGFTVYDCKGQLVFRVDSYGPDPRDRSEVVLMDAHGRCLLTVRR  74

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  ++GE  D  +P++SVR+   +  S     V      G  G +    ++I
Sbjct  75   KRPSLHQRWEGFEGERTDGQKPIFSVRRSSIIGRSSVTVEVY-----GDPGEE----YQI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R C +++  +  VAEI+RK
Sbjct  126  EGSFAQRCCTIFNAEKESVAEIRRK  150



>ref|XP_004300823.1| PREDICTED: protein LURP-one-related 17 [Fragaria vesca subsp. 
vesca]
Length=234

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 97/173 (56%), Gaps = 32/173 (18%)
 Frame = +3

Query  144  PRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMD  323
            P  AC  +S        TVW+KSL+ +C GFTV D  G+LVYRVDNY    +  E+ LMD
Sbjct  37   PSGACTSIS-------FTVWRKSLVISCKGFTVIDSNGDLVYRVDNYV--GHPREVTLMD  87

Query  324  ASGNSLFTIRR-KRLSLADNWVVYDGETADR--------------PLYSVRKHVSLLNSK  458
             SG S+ T+RR K+ SL ++W VY+GE  D               P++ V+K+ +LLN+K
Sbjct  88   GSGKSVLTMRRNKKFSLVESWFVYEGEVGDFCCTERTIRAAAKSWPVFCVKKNQNLLNAK  147

Query  459  S---LAHVTSLRGSGAKGSKNARVFEIEGSYANRSC-VMYDNVRRRVAEIKRK  605
                +AHV         GS     + IEGSY +RSC V+ +  R  VAEIKRK
Sbjct  148  YPSIIAHVY----REVSGSHRRCAYVIEGSYTHRSCKVLEEFSRNVVAEIKRK  196



>ref|XP_012073172.1| PREDICTED: protein LURP-one-related 5 [Jatropha curcas]
 gb|KDP37081.1| hypothetical protein JCGZ_06137 [Jatropha curcas]
Length=206

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 93/142 (65%), Gaps = 12/142 (8%)
 Frame = +3

Query  189  VLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRL  365
            +LTV K SL F  DGFTV+D KG LV+RVD+Y  D+ +  E+VLMDA G  L T+R+KR 
Sbjct  18   LLTVLKTSLFFANDGFTVYDCKGELVFRVDSYGPDTRDTGEVVLMDAHGRCLLTVRKKRP  77

Query  366  SLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGS  539
            SL + W  Y GE +D  +P++SVR+  S++   S+A    +   G  G +    ++IEGS
Sbjct  78   SLHNRWEGYLGERSDGQKPIFSVRRS-SMIGRCSVA----VEVYGNPGEE----YQIEGS  128

Query  540  YANRSCVMYDNVRRRVAEIKRK  605
            +ANR C +++ V+  VAEI+RK
Sbjct  129  FANRCCTIFNTVKESVAEIRRK  150



>ref|XP_002442750.1| hypothetical protein SORBIDRAFT_08g002210 [Sorghum bicolor]
 gb|AAO16700.1| hypothetical protein-like protein [Sorghum bicolor]
 gb|EES16588.1| hypothetical protein SORBIDRAFT_08g002210 [Sorghum bicolor]
Length=240

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 113/199 (57%), Gaps = 37/199 (19%)
 Frame = +3

Query  84   TKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNL  263
            TKVHPNAA     A A              PP PTVLTVW++SLLFNCDGFTVFD  G+L
Sbjct  4    TKVHPNAADPEQHAAAVTV----DVTPDPPPPPPTVLTVWRRSLLFNCDGFTVFDANGDL  59

Query  264  VYRVDNYYDSSN--RAEIVLMDASGNSLFTIRRKRL--SLADNWVVYDG-----------  398
             +RVD+ YD+S   RAE+VLMDA+G  L T+RRKR    L D+WV+YDG           
Sbjct  60   AFRVDS-YDASGRRRAEVVLMDATGTPLLTVRRKRRLGVLVDHWVIYDGDAADAEAAEPS  118

Query  399  ETADRPLYSV------RKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSCV  560
             T+ +PL SV          S   +K+LA+VT L+ S +        + +EGSY  R+CV
Sbjct  119  ATSSKPLLSVRRRHRRASSSSSSRAKALAYVTPLQVSSSS-------YVVEGSYGRRACV  171

Query  561  MYDNVRRR----VAEIKRK  605
            + +    R    VAE++RK
Sbjct  172  VREPDHARGDAVVAEVRRK  190



>ref|XP_002298251.1| hypothetical protein POPTR_0001s19270g [Populus trichocarpa]
 gb|EEE83056.1| hypothetical protein POPTR_0001s19270g [Populus trichocarpa]
Length=201

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 94/145 (65%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            +  +LTV K SL F  DGFTV+D KG LV+RV++Y  D+ ++ EIVLMDA G  L T+RR
Sbjct  15   EEKLLTVLKTSLFFANDGFTVYDCKGELVFRVESYGPDTRDQGEIVLMDAHGRCLLTVRR  74

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  Y GE  D  RP++SVR+  S++   S+    ++   G  G++    ++I
Sbjct  75   KRPSLHQRWEGYIGEGTDGNRPIFSVRRS-SIIGRCSV----TVEVYGKPGAE----YQI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+ANRSC +++  +  +AEI+RK
Sbjct  126  EGSFANRSCTIFNAEKESMAEIRRK  150



>gb|KDP25372.1| hypothetical protein JCGZ_20528 [Jatropha curcas]
Length=197

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 86/150 (57%), Gaps = 38/150 (25%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKR  362
            T LTVW+KSLL NC+GFTV +  G+LVYRVDNY    +  E+VLMDASG S+ T+ R+K+
Sbjct  37   TSLTVWRKSLLVNCNGFTVINSNGDLVYRVDNYIVRPH--ELVLMDASGKSILTMHRKKK  94

Query  363  LSLADNWVVYDGET---------ADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNA  515
            L L D+W+VY+GE          + +P++SV+KH ++L +                    
Sbjct  95   LGLGDSWLVYEGEVGKCCSTTRISKKPIWSVKKHSNILQA--------------------  134

Query  516  RVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
                   SY  RSC + D  R  VAEIKRK
Sbjct  135  ------SSYTQRSCKVVDESRTTVAEIKRK  158



>emb|CDO98155.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 85/144 (59%), Gaps = 11/144 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRK  359
            + T  TV K SL F  DGFTV+D KG LV+RVD Y   S+++E+VLMDASG  L T+RRK
Sbjct  16   EETHFTVLKTSLFFAGDGFTVYDCKGQLVFRVDTYGPDSDKSELVLMDASGKCLLTVRRK  75

Query  360  RLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIE  533
            R SL   W  + GE     +P++SVR+  S +  +S   V     SG +       + IE
Sbjct  76   RPSLHQRWEGFLGERVEGQKPIFSVRR--SSMIGRSGLTVDMYNNSGEE-------YHIE  126

Query  534  GSYANRSCVMYDNVRRRVAEIKRK  605
            GSYA R C  ++  +  VAEI+RK
Sbjct  127  GSYAQRCCTFFNAEKESVAEIRRK  150



>gb|EYU40057.1| hypothetical protein MIMGU_mgv1a020987mg [Erythranthe guttata]
Length=226

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 96/149 (64%), Gaps = 16/149 (11%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKRLS  368
            LTVW+KSL+F+C GFTV    G+LVYRVDNY    +R  IVLMD SG  +FT+ R K+LS
Sbjct  43   LTVWRKSLIFSCKGFTVIGSDGSLVYRVDNYTGRPHR--IVLMDGSGEPIFTVCRPKKLS  100

Query  369  LADN-WVVYDGE---------TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNAR  518
            + +N W++Y+G+         +  +P++ VRK++S++   +   V +   +G   S+   
Sbjct  101  IVNNYWLIYEGDEVGKDGINSSFKKPIFCVRKNLSIMKF-TRPSVIAYVYNGV--SEKKC  157

Query  519  VFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            V+ IEGSY +RSC ++D  R+ V EIK+K
Sbjct  158  VYVIEGSYEHRSCTVFDESRKIVFEIKKK  186



>ref|XP_002517637.1| GTP binding protein, putative [Ricinus communis]
 gb|EEF44801.1| GTP binding protein, putative [Ricinus communis]
Length=206

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 92/142 (65%), Gaps = 13/142 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNR--AEIVLMDASGNSLFTIRRKRL  365
            LTV K SL F  DGFTV+D +G LV+RVD+Y    NR  AE+VLMDA+G  L T+R+KR 
Sbjct  19   LTVLKTSLFFANDGFTVYDCRGELVFRVDSYGGPDNRETAEVVLMDANGRCLLTVRKKRP  78

Query  366  SLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGS  539
            SL   W  Y GE ++  +P++SVR+  S++   S+A    +   G  G +    ++IEGS
Sbjct  79   SLHHRWEGYLGERSEGQKPVFSVRRS-SIIGRCSVA----VEVYGNPGEE----YQIEGS  129

Query  540  YANRSCVMYDNVRRRVAEIKRK  605
            +ANRSC  ++ V+  VAEI+RK
Sbjct  130  FANRSCTFFNAVKESVAEIRRK  151



>ref|XP_009619478.1| PREDICTED: protein LURP-one-related 17 isoform X2 [Nicotiana 
tomentosiformis]
Length=236

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 102/183 (56%), Gaps = 33/183 (18%)
 Frame = +3

Query  132  DEELPRPACHCLSSPPQPTV----LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSN  299
            D++L   +C  L++    +     LTVW+KSL+F+C GFTV    G+LVYRVDNY  S  
Sbjct  23   DQDLKNNSCRELATTTSTSTSCISLTVWRKSLIFSCKGFTVIGSDGSLVYRVDNY--SGG  80

Query  300  RAEIVLMDASGNSLFTI-RRKRLSLAD-NWVVYDGETAD---------------RPLYSV  428
            R +I LMD SG  + TI R K+L L D NW +Y+GE  D               +P++ V
Sbjct  81   RNQITLMDGSGKPILTICRHKKLRLVDNNWFIYEGEVGDDHYHSSSSKSSSSRKKPIFCV  140

Query  429  RKHVSLLNS--KSLAHVTSLRGSGAKGSKNARV-FEIEGSYANRSCVMYD-NVRRRVAEI  596
            +K + +L+S    LAHV        +G    R  + IEGSYANRSC + D   R  VAEI
Sbjct  141  KKQMKILHSNINVLAHVY------YQGMSEKRYSYIIEGSYANRSCKVLDAESRNVVAEI  194

Query  597  KRK  605
            ++K
Sbjct  195  RKK  197



>ref|XP_009780096.1| PREDICTED: protein LURP-one-related 17 isoform X1 [Nicotiana 
sylvestris]
Length=236

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 94/159 (59%), Gaps = 28/159 (18%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI--RRKRL  365
            LTVW+KSL+F+C GFTV    G+LVYRVDNY  S  R +I LMD SG  + TI   +++L
Sbjct  46   LTVWRKSLIFSCKGFTVIGSDGSLVYRVDNY--SGRRGQITLMDGSGKPILTICRHKQKL  103

Query  366  SLAD-NWVVYDGETAD---------------RPLYSVRKHVSLLNS--KSLAHVTSLRGS  491
             L D NW +Y+GE  D               +P++SV+K + +L+S    LAHV   +G 
Sbjct  104  RLVDNNWFIYEGEVGDDNYNSSSSKSSSSRKKPIFSVKKQMKILHSNVNVLAHVY-YQGI  162

Query  492  GAKGSKNARVFEIEGSYANRSCVMYD-NVRRRVAEIKRK  605
                SK    + IEGSYANRSC + D   R  VAEI++K
Sbjct  163  ----SKKRYSYIIEGSYANRSCKVLDAESRNVVAEIRKK  197



>ref|XP_006385313.1| hypothetical protein POPTR_0003s02700g [Populus trichocarpa]
 gb|ABK95691.1| unknown [Populus trichocarpa]
 gb|ERP63110.1| hypothetical protein POPTR_0003s02700g [Populus trichocarpa]
Length=205

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 89/141 (63%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV+K  L F  DGFTV+D KG LV+RVD+Y  DS ++ E+VLMDA G  L T+RRKR S
Sbjct  19   LTVFKTCLFFANDGFTVYDCKGELVFRVDSYGPDSRDKGELVLMDAHGRCLLTVRRKRPS  78

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  Y GE  D   P++SVR+  S++   ++    ++   G  G +    ++IEGS+
Sbjct  79   LHQRWEGYIGEGTDGSNPIFSVRR-TSMIGRCTV----TVEVCGNPGEE----YQIEGSF  129

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            A RSC + + V+  VAEI+RK
Sbjct  130  ATRSCTILNTVKEAVAEIRRK  150



>ref|XP_006465324.1| PREDICTED: protein LURP-one-related 12-like [Citrus sinensis]
Length=209

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 91/145 (63%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            Q T LTV+K SL F  DGFTV++ +G LV+RVD+Y  D+ ++ E+VLMDA G  L T+RR
Sbjct  18   QETHLTVFKTSLFFQNDGFTVYNCRGELVFRVDSYGPDTRDKVELVLMDAHGKCLLTVRR  77

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL + W  Y GE  D  +P++SVR+  S +  +S   V      G +       ++I
Sbjct  78   KRPSLHNRWEGYSGERTDGQKPIFSVRR--SSIIGRSSVTVEMYENPGEE-------YQI  128

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EG++  RSC +++ ++  VAEI+RK
Sbjct  129  EGNFWQRSCTIFNAMKESVAEIRRK  153



>ref|XP_002266582.1| PREDICTED: protein LURP-one-related 12 [Vitis vinifera]
 emb|CBI36329.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV+K SL F  DGFTV+D KG LV+RVD+Y  D+ ++ E++LMDASG  L T+RRKR S
Sbjct  19   LTVFKTSLFFTGDGFTVYDPKGTLVFRVDSYEPDARDKGELILMDASGRCLLTVRRKRPS  78

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE  D  +P++SV++   +  S     + S  G           ++IEGS+
Sbjct  79   LHQRWEGFLGEGIDGKKPIFSVKRSSIIGRSGVTVEMYSNPGED---------YQIEGSF  129

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            ++R C +++  +  VAEI+RK
Sbjct  130  SHRCCTIFNAAKESVAEIRRK  150



>emb|CAN65825.1| hypothetical protein VITISV_034997 [Vitis vinifera]
Length=207

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV+K SL F  DGFTV+D KG LV+RVD+Y  D+ ++ E++LMDASG  L T+RRKR S
Sbjct  19   LTVFKTSLFFTGDGFTVYDPKGTLVFRVDSYEPDARDKGELILMDASGRCLLTVRRKRPS  78

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE  D  +P++SV++   +  S     + S  G           ++IEGS+
Sbjct  79   LHQRWEGFLGEGIDGKKPIFSVKRSSIIGRSGVTVEMYSNPGED---------YQIEGSF  129

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            ++R C +++  +  VAEI+RK
Sbjct  130  SHRCCTIFNATKESVAEIRRK  150



>ref|XP_011012351.1| PREDICTED: protein LURP-one-related 5-like [Populus euphratica]
Length=201

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 89/145 (61%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            +  +LTV K  L F  DGFTV+D KG LV+RV++Y  D+ ++ EIVLMDA G  L T+RR
Sbjct  15   EEKLLTVLKTCLFFANDGFTVYDCKGELVFRVESYGPDTRDQGEIVLMDAHGRCLLTVRR  74

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  Y GE  D  RP++SVR+  S +  +    V      GA+       ++I
Sbjct  75   KRPSLHQRWEGYIGEGTDGNRPIFSVRR--SSIMGRCSVTVEVYGNPGAE-------YQI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+ANRSC +++  +  +AEI+RK
Sbjct  126  EGSFANRSCNIFNAEKESMAEIRRK  150



>gb|KJB39665.1| hypothetical protein B456_007G024700 [Gossypium raimondii]
Length=216

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 91/151 (60%), Gaps = 19/151 (13%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRR-KRLS  368
            LTVW+KSL+ +C+GFTV +  GN+VYRV+ Y     + E+VLMD  G S+ T+RR K L 
Sbjct  33   LTVWRKSLVMSCNGFTVINSDGNVVYRVETYIGQRPK-ELVLMDGVGKSILTMRRNKNLR  91

Query  369  LADNWVVYDGETA----------DRPLYSVRKHVSLL--NSKSLAHVTSLRGSGAKGSKN  512
              D W +Y GE            ++P++ V+K +++L  N   LA+V   R +  K    
Sbjct  92   FLDTWFIYGGEIGAHCISTKRSEEQPIFYVKKCINILHNNPNVLAYVYRGRSTDEK----  147

Query  513  ARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
              V+ IEGSY++RSC + +  ++ VAEIKRK
Sbjct  148  -YVYMIEGSYSHRSCKVVNEAKKVVAEIKRK  177



>ref|XP_010063468.1| PREDICTED: protein LURP-one-related 5 [Eucalyptus grandis]
 gb|KCW70705.1| hypothetical protein EUGRSUZ_F03873 [Eucalyptus grandis]
Length=212

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 85/145 (59%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F  DGF  +D KG LV+RVD+Y  D+ +  E+VLMDA G  L T+RR
Sbjct  15   EETHLTVMKTSLFFAGDGFAAYDSKGELVFRVDSYGPDARDTGEVVLMDAHGRCLLTVRR  74

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  + G+  D  +P++SVR+   + N+     V      G+ G +    + I
Sbjct  75   KRPSLHQRWEGFHGDGTDGQKPIFSVRRSSIIGNTGVTVEVY-----GSPGEE----YHI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A RSC ++   R  VAEI+RK
Sbjct  126  EGSFAQRSCTIFSVDREPVAEIRRK  150



>ref|XP_011081412.1| PREDICTED: protein LURP-one-related 5-like [Sesamum indicum]
Length=305

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (60%), Gaps = 11/144 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYD-SSNRAEIVLMDASGNSLFTIRR  356
            Q T LTV K SL F  DGFT +D KG+LV+RVD+Y     +  E+VLMDA G  + T+RR
Sbjct  23   QQTHLTVSKTSLFFVGDGFTAYDSKGSLVFRVDSYGPYGGDTGELVLMDAVGRCILTVRR  82

Query  357  KRLSLADNWVVYDGE-TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIE  533
            KR SL   W  + GE TA +PL+SVR+  S +  +S   V   R  G +       ++IE
Sbjct  83   KRPSLHQRWEGFAGERTAQKPLFSVRR--SSMIGRSSMTVEVYRNGGEE-------YQIE  133

Query  534  GSYANRSCVMYDNVRRRVAEIKRK  605
            GS+  R C +Y+  R  VAEI+RK
Sbjct  134  GSFGCRKCTIYNAEREAVAEIRRK  157



>ref|XP_011073427.1| PREDICTED: protein LURP-one-related 5-like [Sesamum indicum]
Length=229

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 86/145 (59%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F  DGFT +D KG LV+RVD+Y  D+ +  E+VLMDASG  + T+RR
Sbjct  29   EETHLTVLKTSLFFAGDGFTAYDPKGELVFRVDSYGPDAGDSGELVLMDASGRCILTVRR  88

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  + GE  +  +PL+SVR+   +  S     V S  G           ++I
Sbjct  89   KRPSLHQRWEGFVGEGTEGKKPLFSVRRSSIIGRSSMTVEVYSNPG---------EEYQI  139

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R+C +++  +  VAEI+RK
Sbjct  140  EGSFACRNCTIFNTEKEAVAEIRRK  164



>ref|XP_009619477.1| PREDICTED: protein LURP-one-related 17 isoform X1 [Nicotiana 
tomentosiformis]
Length=237

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 102/184 (55%), Gaps = 34/184 (18%)
 Frame = +3

Query  132  DEELPRPACHCLSSPPQPTV----LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSN  299
            D++L   +C  L++    +     LTVW+KSL+F+C GFTV    G+LVYRVDNY  S  
Sbjct  23   DQDLKNNSCRELATTTSTSTSCISLTVWRKSLIFSCKGFTVIGSDGSLVYRVDNY--SGG  80

Query  300  RAEIVLMDASGNSLFTI--RRKRLSLAD-NWVVYDGETAD---------------RPLYS  425
            R +I LMD SG  + TI   +++L L D NW +Y+GE  D               +P++ 
Sbjct  81   RNQITLMDGSGKPILTICRHKQKLRLVDNNWFIYEGEVGDDHYHSSSSKSSSSRKKPIFC  140

Query  426  VRKHVSLLNS--KSLAHVTSLRGSGAKGSKNARV-FEIEGSYANRSCVMYD-NVRRRVAE  593
            V+K + +L+S    LAHV        +G    R  + IEGSYANRSC + D   R  VAE
Sbjct  141  VKKQMKILHSNINVLAHVY------YQGMSEKRYSYIIEGSYANRSCKVLDAESRNVVAE  194

Query  594  IKRK  605
            I++K
Sbjct  195  IRKK  198



>ref|XP_011044842.1| PREDICTED: protein LURP-one-related 5 [Populus euphratica]
Length=205

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 88/141 (62%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV+K  L F  DGFTV+D KG LV+RVD+Y  DS ++ E VLMDA G  L T+RRKR S
Sbjct  19   LTVFKTCLFFANDGFTVYDCKGELVFRVDSYGPDSRDKGEHVLMDAHGRCLLTVRRKRPS  78

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  Y GE  D   P++SVR+  S++   ++    ++   G  G +    ++IEGS+
Sbjct  79   LHQRWEGYKGEGTDGSNPIFSVRR-TSMIGRCTV----TVEVCGNPGEE----YQIEGSF  129

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            A RSC + + ++  VAEI+RK
Sbjct  130  ATRSCTILNTLKEAVAEIRRK  150



>ref|XP_011659522.1| PREDICTED: protein LURP-one-related 12 [Cucumis sativus]
 gb|KGN45264.1| hypothetical protein Csa_7G432460 [Cucumis sativus]
Length=206

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 86/141 (61%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL F  DG+TV+D KG L++RVD+Y  D+ ++ EIVLMDA G  L T+RRKR S
Sbjct  20   LTVMKTSLFFAGDGYTVYDCKGELLFRVDSYGPDARDKDEIVLMDAQGKCLLTVRRKRPS  79

Query  369  LADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE     +P+++VR+  S +  +S   V  L+ SG +       + IEG +
Sbjct  80   LHHRWEGFLGERTEGQKPIFNVRR--SSIIGRSSMTVEVLKDSGDE-------YHIEGCF  130

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
             NR C ++D  +  VAEIKRK
Sbjct  131  GNRHCTIFDAAKEAVAEIKRK  151



>ref|XP_009365431.1| PREDICTED: protein LURP-one-related 12-like [Pyrus x bretschneideri]
Length=211

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 86/145 (59%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            Q T LTV K S+ F  DGFTV+D KG +V+RVD+Y  D+ + +E+VLMD  G  L T+RR
Sbjct  15   QDTHLTVSKTSIFFPGDGFTVYDCKGQMVFRVDSYAPDAHDSSELVLMDPQGRCLLTVRR  74

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  + GE  D  +P++SVR+   +  S     V      G  G +    + I
Sbjct  75   KRPSLHQRWEGFVGERTDGQKPIFSVRRSSIIGRSNVTVEVF-----GDPGEE----YHI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R C +++  + RVAEI+RK
Sbjct  126  EGSFAQRCCTIFNAEKERVAEIRRK  150



>ref|XP_010691138.1| PREDICTED: protein LURP-one-related 12 [Beta vulgaris subsp. 
vulgaris]
Length=216

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 92/149 (62%), Gaps = 13/149 (9%)
 Frame = +3

Query  171  SPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFT  347
            +  + T LTV K SL F  DGFTV+D  G LV+RVD+Y  D  ++ EIVLMDASG  L T
Sbjct  9    TSEKETHLTVCKTSLFFTGDGFTVYDCNGQLVFRVDSYGPDWRDQDEIVLMDASGRCLLT  68

Query  348  IRRKRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARV  521
            +RRKR SL + W  Y GE  +  +P++SV++  S +  +S  +V + + +G         
Sbjct  69   VRRKRPSLHNRWEGYLGERTEGLKPIFSVKR--SSIIGRSGVNVETYQNAGED-------  119

Query  522  FEIEGSYANRSCVMYDNVRRRV-AEIKRK  605
            ++I+GS+A R C +YD   R V AEI+RK
Sbjct  120  YQIDGSFAQRCCTIYDTTTREVMAEIRRK  148



>ref|XP_006655185.1| PREDICTED: protein LURP-one-related 8-like [Oryza brachyantha]
Length=139

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 72/109 (66%), Gaps = 11/109 (10%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            MTKVHP  A+    A A EE    A            LTVW++SLLFN  GFTVFD  GN
Sbjct  1    MTKVHPGVAAGAAAAAAVEEGKGEAVS----------LTVWRRSLLFNGKGFTVFDGAGN  50

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSLADNWVVYDGETA  407
            LV+RV++Y   S+R E+VLMDA G +L TIRRK+LSLAD W++YDG+ A
Sbjct  51   LVFRVESYAGGSSR-EVVLMDADGRALLTIRRKKLSLADEWLIYDGDAA  98



>ref|XP_008461125.1| PREDICTED: protein LURP-one-related 12-like [Cucumis melo]
Length=206

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 85/141 (60%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL F  DG+TV+D KG LV+RVD+Y  D+  + EIVLMDA G  L T+RRKR S
Sbjct  20   LTVMKTSLFFAGDGYTVYDCKGELVFRVDSYGPDAREKDEIVLMDAQGKCLLTVRRKRPS  79

Query  369  LADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  Y GE     +P++++R+  S +  +S   V  L+ SG +       + IEG +
Sbjct  80   LHHRWEGYLGERTEGQKPIFNMRR--SSIIGRSSMTVEVLKDSGDE-------YHIEGCF  130

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
             NR C ++D  +  +AEIKRK
Sbjct  131  GNRHCTIFDAAKEPMAEIKRK  151



>gb|KDO48547.1| hypothetical protein CISIN_1g027996mg [Citrus sinensis]
Length=209

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 89/145 (61%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            Q T LTV+K SL F  DGFTV++ +G LV+RVD+Y  D+ ++ E VLMDA G  L T+RR
Sbjct  18   QETHLTVFKTSLFFQNDGFTVYNCRGELVFRVDSYGPDTRDKDEHVLMDAHGKCLLTVRR  77

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  Y GE  D  +P++SVR+  S +  +S   V      G +       ++I
Sbjct  78   KRPSLHHRWEGYSGERTDGQKPIFSVRR--SSIIGRSSVTVEMYENPGEE-------YQI  128

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EG++  RSC +++ ++  VAEI+RK
Sbjct  129  EGNFWQRSCTIFNAMKESVAEIRRK  153



>ref|XP_004245562.1| PREDICTED: protein LURP-one-related 8-like [Solanum lycopersicum]
Length=231

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 88/152 (58%), Gaps = 22/152 (14%)
 Frame = +3

Query  198  VWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKRLSLA  374
            VW+KSL+F+C GFTV    GNLVYRVDNY  S  R + +LMDASG  + TI R K+L + 
Sbjct  47   VWRKSLIFSCKGFTVIGSDGNLVYRVDNY--SGRRDQTILMDASGKPILTICRHKKLRIV  104

Query  375  D-NWVVYDGETA-----------DRPLYSVRKHVSLLNS--KSLAHVTSLRGSGAKGSKN  512
            D NW +Y+GE              +P++ V+K + +L+S    LAHV          S  
Sbjct  105  DNNWFIYEGEVLGDHDYKASSLRKKPIFCVKKQMKILHSNINVLAHVY----YHGTSSNK  160

Query  513  ARVFEIEGSYANRSCVMYD-NVRRRVAEIKRK  605
               + IEGSYANR+C + D   R  VAEI++K
Sbjct  161  TYSYIIEGSYANRTCKVLDAKSRNVVAEIRKK  192



>ref|XP_010535140.1| PREDICTED: protein LURP-one-related 12 [Tarenaya hassleriana]
Length=204

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL F+ DGF V+D  G L++RVD+Y  +   + EIVLMDA+G  L T+RRKR +
Sbjct  17   LTVCKTSLFFSGDGFAVYDCNGELIFRVDSYGPEPREKDEIVLMDATGKCLLTVRRKRPT  76

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE +D  +P++SVR+  S +  +    V    G G +       + I+G +
Sbjct  77   LHQRWEGFLGERSDGQKPMFSVRR--SSIIGRCTMTVEIYDGPGEE-------YVIDGDF  127

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + R+CVMYD  +R VAEIKRK
Sbjct  128  SQRNCVMYDTEKRPVAEIKRK  148



>ref|NP_001236323.1| uncharacterized protein LOC100527456 [Glycine max]
 gb|ACU16548.1| unknown [Glycine max]
Length=219

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 86/141 (61%), Gaps = 10/141 (7%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV+K SL F  DGFTV+D KG LV+RVD+Y  D+ +R E+VLMD +G  L T+RRKR S
Sbjct  27   LTVFKTSLFFAGDGFTVYDCKGQLVFRVDSYGPDTRDRDELVLMDPNGRCLLTVRRKRPS  86

Query  369  LADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE    D+P++SVR+   +  S++   V      G +       ++I+G +
Sbjct  87   LHQRWEGFKGERMDGDKPIFSVRRASIIGRSRASLTVEMYDNPGEE-------YQIDGCF  139

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + R C +++  +  VAEI+RK
Sbjct  140  SQRCCTVFNVTKESVAEIRRK  160



>gb|AFK37784.1| unknown [Lotus japonicus]
Length=211

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 86/145 (59%), Gaps = 10/145 (7%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSS-NRAEIVLMDASGNSLFTIRR  356
            Q T LTV K SL F  DGFTV+D KG LV+R D Y  S+ ++ E+VLMD  G+SL T+RR
Sbjct  15   QETQLTVLKTSLFFAGDGFTVYDCKGQLVFRFDCYGPSTRDKDELVLMDPQGHSLLTLRR  74

Query  357  KRLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            K+ SL   W  + GE    D+P++SV++   +  S++   V      G +       + I
Sbjct  75   KKPSLHQRWEGFRGERTDGDKPMFSVKRSSIIGRSRTTLTVEVYDNPGVE-------YLI  127

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EG +  R C +Y++ R+ VAEI+RK
Sbjct  128  EGCFPQRCCKIYNSTRKLVAEIRRK  152



>gb|AFK38610.1| unknown [Lotus japonicus]
Length=227

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL F  DGFTV+D KG LV+RVD+Y  DSS+  E+VLMD +G  L T+RRKR S
Sbjct  33   LTVLKTSLFFAGDGFTVYDCKGELVFRVDSYGPDSSDTDELVLMDPNGRCLLTVRRKRPS  92

Query  369  LADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE    D+P++SV++  S++   S+  V      G +       ++IEG +
Sbjct  93   LHQRWEGFKGERSDGDKPIFSVKR-ASIIGRSSVT-VEVYNSPGEE-------YQIEGCF  143

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC  ++ ++  VAEI RK
Sbjct  144  SQRSCTFFNMMKESVAEIHRK  164



>ref|XP_006427287.1| hypothetical protein CICLE_v10026490mg [Citrus clementina]
 gb|ESR40527.1| hypothetical protein CICLE_v10026490mg [Citrus clementina]
Length=209

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 88/145 (61%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            Q T LTV+K SL F  DGFTV++ +G LV+RVD+Y  D+ ++ E VLMDA G  L T+RR
Sbjct  18   QETHLTVFKTSLFFQNDGFTVYNCRGELVFRVDSYGPDTRDKDEHVLMDAHGKCLLTVRR  77

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  Y GE  D  +P++SVR+  S +  +S   V      G +       + I
Sbjct  78   KRPSLHHRWEGYSGERTDGQKPIFSVRR--SSIIGRSSVTVEMYENPGEE-------YRI  128

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EG++  RSC +++ ++  VA+I+RK
Sbjct  129  EGNFGQRSCTIFNAMKESVADIRRK  153



>gb|KHN22440.1| Protein LURP-one-related 12 [Glycine soja]
Length=223

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 85/141 (60%), Gaps = 10/141 (7%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV+K SL F  DGFTV+D KG LV+RVD+Y  D+ +R E+VLMD +G  L T+RRKR S
Sbjct  31   LTVFKTSLFFAGDGFTVYDCKGQLVFRVDSYGPDTRDRDELVLMDPNGRCLLTVRRKRPS  90

Query  369  LADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE    D+P++SVR    +  S++   V      G +       ++I+G +
Sbjct  91   LHQRWEGFKGERMDGDKPIFSVRGASIIGRSRASLTVEMYDNPGEE-------YQIDGCF  143

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + R C +++  +  VAEI+RK
Sbjct  144  SQRCCTVFNVTKESVAEIRRK  164



>ref|XP_008346624.1| PREDICTED: protein LURP-one-related 12-like [Malus domestica]
Length=208

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 85/145 (59%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            Q T LTV K S+ F  DGFTV+D KG +V+RVD+Y  D+ + +E+VLMD  G  L T+RR
Sbjct  15   QDTHLTVSKTSIFFPGDGFTVYDCKGQMVFRVDSYAPDAHDSSELVLMDPQGRCLLTVRR  74

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  + GE  D  +P++SVR+   +  S     V      G  G +    + I
Sbjct  75   KRPSLHQRWEGFVGERTDGQKPIFSVRRSSIIGRSNVTVEVF-----GDPGEE----YHI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R C +++  +  VAEI+RK
Sbjct  126  EGSFAQRCCTIFNAEKEPVAEIRRK  150



>ref|XP_004235956.1| PREDICTED: protein LURP-one-related 5 [Solanum lycopersicum]
Length=211

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 84/145 (58%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F  DGFT +D KG LV+RVD Y  DS +  E+VLMDA+G  L T+RR
Sbjct  15   EETSLTVRKTSLFFTGDGFTAYDCKGQLVFRVDTYGPDSRDLGELVLMDATGRCLLTVRR  74

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL + W  Y GE  +  +P++SVR+   +  S     V          S     ++I
Sbjct  75   KRPSLHNRWEGYLGEREEGKKPIFSVRRSSIIGRSNVTVEVY---------SNPTEEYQI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R+C  ++  +  VAEI+RK
Sbjct  126  EGSFAQRNCTFFNADKVSVAEIRRK  150



>ref|XP_006343921.1| PREDICTED: protein LURP-one-related 17-like isoform X2 [Solanum 
tuberosum]
Length=234

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 89/156 (57%), Gaps = 26/156 (17%)
 Frame = +3

Query  198  VWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI-RRKRLSLA  374
            VW+KSL+F+C GFTV    GNLVYRVDNY  S  R + +LMDASG  + TI R K+L + 
Sbjct  46   VWRKSLIFSCKGFTVIGSDGNLVYRVDNY--SGRRDQTILMDASGKPILTICRHKKLRIV  103

Query  375  D-NWVVYDGE---------------TADRPLYSVRKHVSLLNS--KSLAHVTSLRGSGAK  500
            D NW +Y+GE               +  +P++ V+K + +L+S    LAHV         
Sbjct  104  DNNWFIYEGEVLGDHDYNTNNKRSSSRKKPIFCVKKQMKILHSNINVLAHVY----YHGT  159

Query  501  GSKNARVFEIEGSYANRSCVMYD-NVRRRVAEIKRK  605
             S     + IEGSYANR+C + D   R  VAEI++K
Sbjct  160  SSDKTYSYIIEGSYANRTCKVLDAKSRNVVAEIRKK  195



>ref|XP_007150755.1| hypothetical protein PHAVU_005G178100g [Phaseolus vulgaris]
 gb|ESW22749.1| hypothetical protein PHAVU_005G178100g [Phaseolus vulgaris]
Length=217

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 85/141 (60%), Gaps = 10/141 (7%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL F  DGFTV+D KG LV+RVD+Y  D+ +R E+VLMD +G  L T+RRKR S
Sbjct  25   LTVLKTSLFFAGDGFTVYDCKGELVFRVDSYGPDTRDRDELVLMDPNGRCLLTVRRKRPS  84

Query  369  LADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE    D+P++SV++   +  +++   V      G +       ++IEG +
Sbjct  85   LHQRWEGFKGERMDGDKPIFSVKRASIIGRARASLTVEMYDSPGEE-------YQIEGCF  137

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + R C +++  +  VAEI+RK
Sbjct  138  SQRCCTVFNVTKESVAEIRRK  158



>ref|XP_009604016.1| PREDICTED: protein LURP-one-related 5-like isoform X2 [Nicotiana 
tomentosiformis]
Length=202

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 83/145 (57%), Gaps = 11/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F  DGFT +D KG LV+RVD Y  DS ++ E+VLMDASG  + T+RR
Sbjct  17   EETNLTVLKTSLFFTGDGFTAYDCKGQLVFRVDTYGPDSRDQGELVLMDASGRCILTVRR  76

Query  357  KRLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  Y GE     +P++SVR+   +  S     V +        +     ++I
Sbjct  77   KRPSLHHRWEGYIGERMEGQKPIFSVRRSSLIGRSSVTVEVYN--------NNPVEEYQI  128

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R+C  ++  +  V EI+RK
Sbjct  129  EGSFAQRNCKFFNADKESVVEIRRK  153



>ref|XP_009604015.1| PREDICTED: protein LURP-one-related 5-like isoform X1 [Nicotiana 
tomentosiformis]
Length=208

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 83/145 (57%), Gaps = 11/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F  DGFT +D KG LV+RVD Y  DS ++ E+VLMDASG  + T+RR
Sbjct  17   EETNLTVLKTSLFFTGDGFTAYDCKGQLVFRVDTYGPDSRDQGELVLMDASGRCILTVRR  76

Query  357  KRLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  Y GE     +P++SVR+   +  S     V +        +     ++I
Sbjct  77   KRPSLHHRWEGYIGERMEGQKPIFSVRRSSLIGRSSVTVEVYN--------NNPVEEYQI  128

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R+C  ++  +  V EI+RK
Sbjct  129  EGSFAQRNCKFFNADKESVVEIRRK  153



>ref|XP_010465573.1| PREDICTED: protein LURP-one-related 12-like [Camelina sativa]
Length=220

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 87/141 (62%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D  G++++RVD+Y  D+ +  EIVLMDA+G  L T++RKR +
Sbjct  33   LTVCKTSLFYTGDGFAAYDCHGDIIFRVDSYGPDTRDNDEIVLMDATGKCLLTVKRKRPT  92

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE +D  +P++SVR+  S +  +    +    G+G +       + I+G +
Sbjct  93   LHQRWEGFLGERSDGQKPIFSVRR--SSIIGRCTMEIDVFDGTGEE-------YIIDGDF  143

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +R VAEIKRK
Sbjct  144  SQRSCLIYDTEKRTVAEIKRK  164



>ref|XP_009767463.1| PREDICTED: protein LURP-one-related 5-like [Nicotiana sylvestris]
Length=218

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 84/145 (58%), Gaps = 11/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T  TV K SL F+ DGF  +D KG LV+RVD Y  DSSN+ E+VLMDASG  LFT+RR
Sbjct  17   EETNFTVLKTSLFFSSDGFNAYDSKGQLVFRVDTYGPDSSNQGELVLMDASGRCLFTVRR  76

Query  357  KRLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  Y  E     +P++SV +  S +  +S+  V     +  +       ++I
Sbjct  77   KRPSLHHRWDGYLAERMEGQKPIFSVLR--SSMIGRSIVTVEVYNNNPVEE------YQI  128

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+  RSC  ++  +  VAEI RK
Sbjct  129  EGSFEQRSCTFFNAEKECVAEIGRK  153



>ref|XP_009777813.1| PREDICTED: protein LURP-one-related 12 [Nicotiana sylvestris]
Length=213

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 83/145 (57%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F  DGFT +D KG LV+RVD Y  DS +  E+VLMDA+G  L T+RR
Sbjct  15   EETNLTVLKTSLFFTGDGFTAYDCKGELVFRVDTYGPDSRDLGELVLMDATGRCLLTVRR  74

Query  357  KRLSLADNWVVYDG--ETADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL + W  + G  E   +P++SVR+   +  S     V          S     ++I
Sbjct  75   KRPSLHNRWEGFLGEREEGQKPIFSVRRSSIIGRSSVTVEVY---------SNPMEEYQI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R+C  ++  +  VAEI+RK
Sbjct  126  EGSFAQRNCTFFNADKVSVAEIRRK  150



>ref|XP_006298512.1| hypothetical protein CARUB_v10014588mg [Capsella rubella]
 gb|EOA31410.1| hypothetical protein CARUB_v10014588mg [Capsella rubella]
Length=220

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 87/141 (62%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D  G++++RVD+Y  D+ +  EIVLMDA+G  L T++RKR +
Sbjct  33   LTVCKTSLFYTGDGFAAYDCNGDIIFRVDSYGPDTRDNDEIVLMDATGKCLLTVKRKRPT  92

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE ++  +P++SVR+  S +  +    V    GSG +       + I+G +
Sbjct  93   LHQRWEGFLGERSEGQKPIFSVRR--SSIIGRCTMEVDVFDGSGEE-------YIIDGDF  143

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +R VAEIKRK
Sbjct  144  SQRSCLIYDTEKRTVAEIKRK  164



>ref|XP_010553543.1| PREDICTED: protein LURP-one-related 17 [Tarenaya hassleriana]
Length=219

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 98/174 (56%), Gaps = 27/174 (16%)
 Frame = +3

Query  153  ACHCLSSPPQP-----------TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSN  299
            + H    PP P           T LTVW+KSLL +C+GFTV D KG+LVYRVDN Y  + 
Sbjct  11   SVHEEYQPPHPEAREIVDGGACTTLTVWRKSLLVSCEGFTVIDWKGDLVYRVDN-YARTR  69

Query  300  RAEIVLMDASGNSLFTIRR-KRLSLADNWVVYDGETAD---------RPLYSVRKHVSLL  449
              E++LMD  GNS+  +RR K+ ++ D W +YD +  +         RP++ V+K+V   
Sbjct  70   PEELLLMDKDGNSVLFMRRLKKFTMVDRWGIYDAKDTEDTNAIKPPKRPIWCVKKNV---  126

Query  450  NSKSLAHVTSLRGSGAKGSKNAR-VFEIEGSYANRSC-VMYDNVRRRVAEIKRK  605
            N+K L + + +      G  + +  + I+GSY  RSC V++ +  R V+EIK K
Sbjct  127  NAKILGNSSDILAYVYYGPFDKKHAYVIKGSYGCRSCKVVHGSSNRTVSEIKTK  180



>gb|ABK25939.1| unknown [Picea sitchensis]
Length=241

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 89/148 (60%), Gaps = 10/148 (7%)
 Frame = +3

Query  183  PTVLTVWKKSLLFNCD-GFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRK  359
            PTVLTVWKKSLLF+ D GFTVFD  G+LV+R+D   D+ N   ++LMDA G  L T+RRK
Sbjct  27   PTVLTVWKKSLLFSGDGGFTVFDSNGDLVFRMDIVNDTHN---LLLMDAHGKPLLTLRRK  83

Query  360  RLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARV---F  524
              SL + W  + G+     +PL++VR+   L  S S   V  +  +       + V   +
Sbjct  84   LPSLHNRWEGFLGDKLEGQKPLFTVRRSSILPTSSSSVEVFMMSSTTYFSLMTSTVCADY  143

Query  525  EIEGSYANRSCVMYDNVRRRV-AEIKRK  605
            ++EGS++ R C +Y    RR+ AE+KRK
Sbjct  144  QVEGSFSQRCCTIYSAASRRIAAEVKRK  171



>ref|XP_010487421.1| PREDICTED: protein LURP-one-related 12 [Camelina sativa]
Length=220

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 87/141 (62%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D  G++++RVD+Y  D+ +  EIVLMDA+G  L T++RKR +
Sbjct  33   LTVCKTSLFYTGDGFAAYDCHGDIIFRVDSYGPDTRDNDEIVLMDATGKCLLTVKRKRPT  92

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE +D  +P++SVR+  S +  +    +    G+G +       + I+G +
Sbjct  93   LHQRWEGFLGERSDGQKPIFSVRR--SSIIGRCTMEIDVYDGTGEE-------YIIDGDF  143

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +R VAEIKRK
Sbjct  144  SQRSCLIYDTEKRTVAEIKRK  164



>gb|KJB56382.1| hypothetical protein B456_009G128500 [Gossypium raimondii]
Length=206

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 84/141 (60%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL F  DGFTV+D KG LV+RVD+Y  D  ++AE+VLMDA G  L T+R+KR S
Sbjct  19   LTVLKTSLFFANDGFTVYDCKGQLVFRVDSYGPDPRDKAEVVLMDAHGRCLLTVRKKRPS  78

Query  369  LADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE     +P++SV++  S +  +    V      G +       ++IEG++
Sbjct  79   LHHRWEGFLGERTEGQKPIFSVKR--SSIIGRCGMTVEVFNNPGLE-------YQIEGNF  129

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
              RSC +++  +  VAEIKRK
Sbjct  130  GQRSCTIFNAAKESVAEIKRK  150



>ref|XP_010055794.1| PREDICTED: protein LURP-one-related 17 [Eucalyptus grandis]
 gb|KCW72326.1| hypothetical protein EUGRSUZ_E00784 [Eucalyptus grandis]
Length=244

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 94/155 (61%), Gaps = 23/155 (15%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL  371
             TVW+KSLL +C+GFTV D +G++VYRVD+Y       E++LMD +G S+ T+RR +  L
Sbjct  57   FTVWRKSLLTDCNGFTVIDSRGDIVYRVDSY--GGRPREVILMDRAGKSVLTLRRLKKLL  114

Query  372  A--DNWVVYDGETAD--------------RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKG  503
            A  D+W+VY+GE  D              +P+  VR+ V +L + S A     R + AK 
Sbjct  115  ARLDDWLVYEGEAGDDDGPSYKSGKRSRKKPICCVRRRVGVLRAASGAIAYVCRATPAK-  173

Query  504  SKNARVFEIEGSYANRSC-VMYDNVRRRVAEIKRK  605
               AR + IEGSYANRSC V+  + R  VAEIKRK
Sbjct  174  ---AREYVIEGSYANRSCKVLEASSRDVVAEIKRK  205



>ref|XP_011467084.1| PREDICTED: protein LURP-one-related 12 [Fragaria vesca subsp. 
vesca]
Length=212

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 85/145 (59%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F  DGF+V++    LV+RVD+Y  D  +R E+VLMDA+G  L T+RR
Sbjct  14   EETFLTVSKTSLFFAGDGFSVYNRNAQLVFRVDSYGPDPHDRTELVLMDATGRCLLTVRR  73

Query  357  KRLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  Y GE     +P++SVR+  S +  +S   V   R    +       ++I
Sbjct  74   KRPSLHHRWEGYVGERMEGQKPIFSVRR--SSIMGRSSVTVEVFRDPPEE-------YQI  124

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R+C +Y+  +  VAEI RK
Sbjct  125  EGSFAQRNCTIYNADKEPVAEIHRK  149



>ref|XP_009610444.1| PREDICTED: protein LURP-one-related 12-like [Nicotiana tomentosiformis]
Length=213

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 83/145 (57%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K S+ F  DGFT +D KG LV+RVD Y  DS +  E+VLMDA+G  L T+RR
Sbjct  15   EETNLTVRKTSIFFTGDGFTAYDCKGELVFRVDTYGPDSRDLGELVLMDATGRCLLTVRR  74

Query  357  KRLSLADNWVVYDG--ETADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL + W  + G  E   +P++SVR+   +  S     V          S     ++I
Sbjct  75   KRPSLHNRWEGFLGEREEGQKPIFSVRRSSIIGRSSVTVEVY---------SNPTEEYQI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+A R+C  ++  +  VAEI+RK
Sbjct  126  EGSFAQRNCTFFNADKVSVAEIRRK  150



>ref|XP_002885109.1| hypothetical protein ARALYDRAFT_897880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61368.1| hypothetical protein ARALYDRAFT_897880 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 87/141 (62%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D  G++++RVD+Y  D+ +  EIVLMDA+G  L T++RKR +
Sbjct  33   LTVCKTSLFYTGDGFAAYDCHGDIIFRVDSYGPDTRDNDEIVLMDATGKCLLTVKRKRPT  92

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE ++  +P++SVR+  S +  +    V    G+G +       + I+G +
Sbjct  93   LHQRWEGFLGERSEGQKPIFSVRR--SSIIGRCTMEVEVYDGTGEE-------YIIDGDF  143

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +R VAEIKRK
Sbjct  144  SQRSCLIYDTEKRTVAEIKRK  164



>ref|XP_006343920.1| PREDICTED: protein LURP-one-related 17-like isoform X1 [Solanum 
tuberosum]
Length=235

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 89/157 (57%), Gaps = 27/157 (17%)
 Frame = +3

Query  198  VWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTI--RRKRLSL  371
            VW+KSL+F+C GFTV    GNLVYRVDNY  S  R + +LMDASG  + TI   +++L +
Sbjct  46   VWRKSLIFSCKGFTVIGSDGNLVYRVDNY--SGRRDQTILMDASGKPILTICRHKQKLRI  103

Query  372  AD-NWVVYDGE---------------TADRPLYSVRKHVSLLNS--KSLAHVTSLRGSGA  497
             D NW +Y+GE               +  +P++ V+K + +L+S    LAHV        
Sbjct  104  VDNNWFIYEGEVLGDHDYNTNNKRSSSRKKPIFCVKKQMKILHSNINVLAHVY----YHG  159

Query  498  KGSKNARVFEIEGSYANRSCVMYD-NVRRRVAEIKRK  605
              S     + IEGSYANR+C + D   R  VAEI++K
Sbjct  160  TSSDKTYSYIIEGSYANRTCKVLDAKSRNVVAEIRKK  196



>gb|EMS46289.1| Protein LURP-one-related 8 [Triticum urartu]
Length=182

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 71/109 (65%), Gaps = 15/109 (14%)
 Frame = +3

Query  81   MTKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGN  260
            M KVHPN A  +P+               ++  +P  LTVW+KSLLFNC GFTVFD  GN
Sbjct  1    MAKVHPNLA--VPSLGMAA----------AAAAEPVTLTVWRKSLLFNCRGFTVFDASGN  48

Query  261  LVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-LSL-ADNWVVYDGE  401
            LVYRVD  Y S +RAE+VLMDA+G  + T+RRK+ +SL  D W+V+ GE
Sbjct  49   LVYRVD-IYASDSRAEVVLMDAAGRPVLTVRRKKAISLMGDQWLVFPGE  96



>ref|XP_010503481.1| PREDICTED: protein LURP-one-related 12-like [Camelina sativa]
Length=220

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 86/141 (61%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D  G++ +RVD+Y  D+ +  EIVLMDA+G  L T++RKR +
Sbjct  33   LTVCKTSLFYTGDGFAAYDCNGDITFRVDSYGPDTRDNDEIVLMDATGKCLLTVKRKRPT  92

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE +D  +P++SVR+  S +  +    +    G+G +       + I+G +
Sbjct  93   LHQRWEGFLGERSDGQKPIFSVRR--SSIIGRCTMEIDVYDGTGEE-------YIIDGDF  143

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +R VAEIKRK
Sbjct  144  SQRSCLIYDTEKRTVAEIKRK  164



>ref|NP_001240988.1| uncharacterized protein LOC100787085 [Glycine max]
 gb|ACU19294.1| unknown [Glycine max]
Length=219

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 83/141 (59%), Gaps = 10/141 (7%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL F  DGF+V+D KG LV+RVD+Y  D+ +  E+VLMD +G  L T+RRKR S
Sbjct  27   LTVLKTSLFFAGDGFSVYDCKGQLVFRVDSYGPDTRDIDELVLMDPNGRCLLTVRRKRPS  86

Query  369  LADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE    D+P++SVR+   +  S++   V      G +       ++IEG +
Sbjct  87   LHQRWEGFKGERMDGDKPIFSVRRASIIGRSRASLTVEMYDNPGEE-------YQIEGCF  139

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + R C +++  +  VAEI RK
Sbjct  140  SQRCCTVFNVTKESVAEISRK  160



>gb|EYU23418.1| hypothetical protein MIMGU_mgv1a022920mg [Erythranthe guttata]
Length=203

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 83/148 (56%), Gaps = 23/148 (16%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR--L  365
            LTVW+KSLL +C+GFTV    G+L YRVDNY    N   +VLMD SGN +FTIRR++  L
Sbjct  30   LTVWRKSLLLSCNGFTVIGSNGSLAYRVDNYSGRPN--PVVLMDGSGNPIFTIRRRQRGL  87

Query  366  SLADN--WVVYDGETA----DRPLYS--VRKHVSLLNSKSLAHVTSLRGSGAKGSKNARV  521
             L +N  W++Y+GE      +   YS  VR H        LAHV S              
Sbjct  88   RLMNNYYWLIYEGEVTKYCKNNNNYSRIVRSHEK---RNVLAHVYS--------DNRQHK  136

Query  522  FEIEGSYANRSCVMYDNVRRRVAEIKRK  605
            + +EGSY  RSC ++D  R  V EIKRK
Sbjct  137  YVVEGSYTTRSCKIFDESRNVVGEIKRK  164



>ref|XP_010441323.1| PREDICTED: protein LURP-one-related 17-like [Camelina sativa]
Length=222

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 103/183 (56%), Gaps = 19/183 (10%)
 Frame = +3

Query  84   TKVHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNL  263
            + VH   A + P +        P   C       T LTVW+KSLL +C+GFTV D  G+L
Sbjct  11   SSVHGEDAPSSPESKVTVSKAEPEGAC-------TTLTVWRKSLLVSCEGFTVIDSNGDL  63

Query  264  VYRVDNYYDSSNRAEIVLMDASGNSLFTIRR-KRLSLADNWVVYD-----GETA--DRPL  419
            +YRVDN Y  +   E++LMD  GNSL  I+R K+++L ++W +Y+     GET     P+
Sbjct  64   IYRVDN-YARTRPGELILMDKDGNSLLLIQRTKKIALVNSWGIYEAKDTNGETKIPKCPI  122

Query  420  YSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYANRSC-VMYDNVRRRVAEI  596
            + +RK++ +    +   + +   SG+   KN+ +  I+GSY  +SC +++  + + V EI
Sbjct  123  WYMRKNLKMNILSNKYDILAYVFSGSFDKKNSYI--IKGSYKRKSCKIVHVPLNKTVVEI  180

Query  597  KRK  605
            KRK
Sbjct  181  KRK  183



>ref|XP_004506948.1| PREDICTED: protein LURP-one-related 12-like [Cicer arietinum]
Length=210

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 86/145 (59%), Gaps = 10/145 (7%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F  DGF V+D KG LV+R D+Y  ++ ++ E+VLM++ G SL T+RR
Sbjct  15   EETQLTVLKTSLFFTGDGFVVYDSKGQLVFRFDSYGPNTRDKEELVLMNSHGRSLLTLRR  74

Query  357  KRLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            K+ SL   W  + GE    D+PL++V++   +  S++   V     SG +       + I
Sbjct  75   KKPSLHQRWEGFKGERIDGDKPLFNVKRSSIIGRSRTTVTVEVYDDSGVE-------YLI  127

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EG +  R C +++  ++ VAEI+RK
Sbjct  128  EGCFPQRICKIFNTTKQLVAEIRRK  152



>ref|XP_006284493.1| hypothetical protein CARUB_v10005685mg [Capsella rubella]
 gb|EOA17391.1| hypothetical protein CARUB_v10005685mg [Capsella rubella]
Length=224

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 97/151 (64%), Gaps = 15/151 (10%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRR-KR  362
            T LTVW+KSLL  C+GFTV D  G+L+YRVDNY   +   EI+LMD  GNSL  + R K+
Sbjct  39   TTLTVWRKSLLVTCEGFTVIDSNGDLIYRVDNYA-RTRPEEIILMDKDGNSLLLMHRTKK  97

Query  363  LSLADNWVVYD-----GET--ADRPLYSVRKH--VSLLNSKSLAHVTSLRGSGAKGSKNA  515
            ++L D+W +Y+     GET     P++ +RK+  +++LN+   ++V +   SG+   KN+
Sbjct  98   ITLVDSWGIYEAKDTNGETKIPKCPIWYMRKNLKMNILNTNK-SNVLAYVFSGSFDKKNS  156

Query  516  RVFEIEGSYANRSC-VMYDNVRRRVAEIKRK  605
             +  I+GSY  +SC +++  + + V EIKRK
Sbjct  157  YI--IKGSYKCKSCKIVHVPMNKTVVEIKRK  185



>ref|XP_010436109.1| PREDICTED: protein LURP-one-related 17 [Camelina sativa]
Length=221

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 109/185 (59%), Gaps = 27/185 (15%)
 Frame = +3

Query  90   VHPNAASAIPTALADEELPRPACHCLSSPPQPTVLTVWKKSLLFNCDGFTVFDDKGNLVY  269
            VH   A + P +        P   C       T LTVW+KSLL +C+GFTV D  G+L+Y
Sbjct  12   VHGEDAPSSPESKVTVSAAEPEGAC-------TTLTVWRKSLLVSCEGFTVIDSNGDLIY  64

Query  270  RVDNYYDSSNRAEIVLMDASGNSLFTIRR-KRLSLADNWVVYD-----GETA--DRPLYS  425
            RVDN Y  +   E++LMD  GNSL  ++R K+++L ++W +Y+     GET     P++ 
Sbjct  65   RVDN-YARTRPGELILMDKDGNSLLLMQRTKKIALVNSWGIYEAKDTNGETKIPKCPIWY  123

Query  426  VRKHV--SLLNSKS--LAHVTSLRGSGAKGSKNARVFEIEGSYANRSC-VMYDNVRRRVA  590
            +RK++  ++L++KS  LA+V     SG+   KN+ +  ++GSY  +SC +++  + + V 
Sbjct  124  MRKNLKMNILSNKSDILAYVF----SGSFDKKNSYI--VKGSYKCKSCKIVHVPLNKTVV  177

Query  591  EIKRK  605
            EIKRK
Sbjct  178  EIKRK  182



>gb|EPS59500.1| hypothetical protein M569_15304, partial [Genlisea aurea]
Length=176

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 77/144 (53%), Gaps = 13/144 (9%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRK  359
            Q T+LTV K S+ F  DGF  +D  G LV+RVD+Y    +  EIVLMDA G S+ T+RRK
Sbjct  5    QETILTVRKTSVFFPGDGFAAYDSAGELVFRVDSY--GPDSGEIVLMDADGGSILTVRRK  62

Query  360  RLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIE  533
            R SL   W  + G+ A+   PL+SVR+   L  S     V   RG           + IE
Sbjct  63   RPSLHGRWEGFAGDGAEGKSPLFSVRRSSILGRSTVTVEVYGDRG---------EEYRIE  113

Query  534  GSYANRSCVMYDNVRRRVAEIKRK  605
            GS+  R C +       VAEI+RK
Sbjct  114  GSFPCRQCSILGADTEAVAEIRRK  137



>ref|XP_010537995.1| PREDICTED: protein LURP-one-related 5 [Tarenaya hassleriana]
Length=209

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 83/147 (56%), Gaps = 13/147 (9%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY--DSSNRAEIVLMDASGNSLFTIR  353
            Q   LTV K SL F  DGFT +D KG+LV+RVD+Y   DS    E+VLMD+ G  L T+R
Sbjct  15   QEKNLTVRKTSLFFAGDGFTAYDRKGSLVFRVDSYGGPDSRENDEVVLMDSRGRCLLTLR  74

Query  354  RKRLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFE  527
            +KR SL   W  Y GE     +P++SVR+   +    +   V         GS    +++
Sbjct  75   KKRPSLRRRWEGYMGERSNGQKPIFSVRRSSVIGRCGATVEVY--------GSDRCGMYQ  126

Query  528  IEGSYANRSCVMYDNV-RRRVAEIKRK  605
            IEG +  RSC + + + RR VAEI+RK
Sbjct  127  IEGDFCQRSCAVVETLTRRTVAEIRRK  153



>gb|KDO48546.1| hypothetical protein CISIN_1g027996mg [Citrus sinensis]
Length=215

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 89/151 (59%), Gaps = 18/151 (12%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            Q T LTV+K SL F  DGFTV++ +G LV+RVD+Y  D+ ++ E VLMDA G  L T+RR
Sbjct  18   QETHLTVFKTSLFFQNDGFTVYNCRGELVFRVDSYGPDTRDKDEHVLMDAHGKCLLTVRR  77

Query  357  K------RLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKN  512
            K      R SL   W  Y GE  D  +P++SVR+  S +  +S   V      G +    
Sbjct  78   KVQFQLMRPSLHHRWEGYSGERTDGQKPIFSVRR--SSIIGRSSVTVEMYENPGEE----  131

Query  513  ARVFEIEGSYANRSCVMYDNVRRRVAEIKRK  605
               ++IEG++  RSC +++ ++  VAEI+RK
Sbjct  132  ---YQIEGNFWQRSCTIFNAMKESVAEIRRK  159



>ref|XP_003597904.1| hypothetical protein MTR_2g103840 [Medicago truncatula]
 gb|AES68155.1| LURP-one-like protein [Medicago truncatula]
 gb|AFK47292.1| unknown [Medicago truncatula]
Length=223

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 10/140 (7%)
 Frame = +3

Query  195  TVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLSL  371
            TV K SL F+ DGFTV+D  G LV+RVD+Y  DS +  E+VLMD  G  L T+RRKR SL
Sbjct  32   TVLKTSLFFSGDGFTVYDSHGQLVFRVDSYGPDSRDLDELVLMDPDGRCLLTVRRKRPSL  91

Query  372  ADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYA  545
               W  + GE    D+P +SV++   +  +++   V      G +       + IEG ++
Sbjct  92   HQRWEGFKGERRDGDKPTFSVKRSSMIGRARTGVTVEVYDNPGEE-------YHIEGCFS  144

Query  546  NRSCVMYDNVRRRVAEIKRK  605
             R C +++ ++  VAEI RK
Sbjct  145  QRCCTVFNGMKENVAEIHRK  164



>emb|CDX75845.1| BnaC03g39280D [Brassica napus]
Length=213

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 85/141 (60%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D  G++++RVD+Y  D+ +  E VLMD +G  L T++RKR +
Sbjct  26   LTVCKTSLFYTGDGFAAYDCHGDIIFRVDSYGPDTRDNDEFVLMDVAGKCLLTVKRKRPT  85

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE +D  +P++SVR+  S +  +    V    G+G +       + I+G +
Sbjct  86   LHQRWEGFLGERSDGQKPIFSVRR--SSIIGRCTMEVEVYDGTGEE-------YTIDGDF  136

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +R VAEIKRK
Sbjct  137  SQRSCLIYDTNKRTVAEIKRK  157



>ref|XP_009135456.1| PREDICTED: protein LURP-one-related 12 [Brassica rapa]
Length=213

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 85/141 (60%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D  G++++RVD+Y  D+ +  E VLMD +G  L T++RKR +
Sbjct  26   LTVCKTSLFYTGDGFAAYDCHGDIIFRVDSYGPDTRDNDEFVLMDVAGKCLLTVKRKRPT  85

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE +D  +P++SVR+  S +  +    V    G+G +       + I+G +
Sbjct  86   LHQRWEGFLGERSDGQKPIFSVRR--SSIIGRCTMEVEVYDGTGEE-------YTIDGDF  136

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +R VAEIKRK
Sbjct  137  SQRSCLIYDTNKRTVAEIKRK  157



>ref|XP_003531715.1| PREDICTED: protein LURP-one-related 12-like [Glycine max]
 gb|KHN37986.1| Protein LURP-one-related 12 [Glycine soja]
Length=219

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 84/145 (58%), Gaps = 10/145 (7%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYD-SSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F+ DGF V+D KGNLV+R D+Y   + ++ E+VLMD  G SL T+RR
Sbjct  15   EETKLTVLKTSLFFSGDGFAVYDSKGNLVFRFDSYGPLARDKDELVLMDPHGRSLLTLRR  74

Query  357  KRLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            K+ SL   W  + GE    D+P++SV++   +  S++   V      G +       + I
Sbjct  75   KKPSLHQRWEGFKGERKDGDKPVFSVKRSSIIGRSRTSVAVEVYDSPGVE-------YLI  127

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EG +  R C +++  +  VAEI+RK
Sbjct  128  EGCFPQRCCKVFNAAKELVAEIRRK  152



>ref|XP_003577127.1| PREDICTED: protein LURP-one-related 8-like [Brachypodium distachyon]
Length=233

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 93/159 (58%), Gaps = 24/159 (15%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDK-GNLVYRVDNYYDSSNRA---EIVLMDASGNSLFTIR  353
            TVLTVW+KSLLFNCDGFTV+D   G+L +RVD+Y  SS R+   ++VLMDA+G  L T+R
Sbjct  28   TVLTVWRKSLLFNCDGFTVYDSATGDLAFRVDSYGSSSGRSRREDVVLMDAAGKPLLTVR  87

Query  354  RK-RLSLADNWVVYDGE--------TADRPLYSVRKHV--SLLNSKSLAHVTSLRGSGAK  500
            RK RL    +WV+Y+G+         + +PL SVR H      + K++AHVT L      
Sbjct  88   RKARLLGPAHWVIYEGDAAAAGSGSGSAKPLLSVRCHGRRGGASDKAVAHVTRLAAGAEA  147

Query  501  GSKNARVFEIEGSYANRSCVMYDN----VRRRVAEIKRK  605
            G      + +EGSY  RS  +           VAE++RK
Sbjct  148  GD-----YVVEGSYGRRSLAVRGGSGTTAGAVVAEVRRK  181



>gb|KFK38935.1| hypothetical protein AALP_AA3G179300 [Arabis alpina]
Length=218

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRR  356
            Q   LTV K SL +  DGFT +D  G++++RVD+Y  D+ +  E VLM+A+G  L T++R
Sbjct  27   QDKPLTVCKTSLFYTGDGFTAYDCNGDIIFRVDSYGPDTRDNDEFVLMNATGKCLLTVKR  86

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR +L   W  + GE ++  +P++SVR+  S +  +    V     +G +       + I
Sbjct  87   KRPTLHQRWEGFLGERSEGQKPIFSVRR--SSIIGRCTMEVEVYDEAGEE-------YII  137

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EG ++ RSCV+YD  +R VAEIKRK
Sbjct  138  EGDFSQRSCVIYDTEKRTVAEIKRK  162



>ref|XP_008228690.1| PREDICTED: protein LURP-one-related 12-like [Prunus mume]
Length=211

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 86/145 (59%), Gaps = 12/145 (8%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNY-YDSSNRAEIVLMDASGNSLFTIRR  356
            Q T LTV K S+ F  DGF V+  KG +V RVD+Y  D+ +  E+VLMD +G  L T+RR
Sbjct  15   QETHLTVSKTSVFFAGDGFIVYGCKGEVVLRVDSYAQDARDSCELVLMDPNGRCLLTVRR  74

Query  357  KRLSLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            KR SL   W  + GE  D  + ++SVR+  S +  +S   V  L   G +       ++I
Sbjct  75   KRPSLHQRWEGFVGERKDGQKHIFSVRR--SSMIGRSTVTVEVLGDPGEE-------YQI  125

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EGS+  RSC ++D+ ++ VAEIKRK
Sbjct  126  EGSFLQRSCTIFDSEKKLVAEIKRK  150



>ref|XP_010447690.1| PREDICTED: protein LURP-one-related 17-like [Camelina sativa]
Length=221

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 102/153 (67%), Gaps = 20/153 (13%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRR-KR  362
            T+LTVW+KSLL +C+GFTV D  G+L+YRVDN Y  +   E++LMD  GNSL  ++R K+
Sbjct  37   TILTVWRKSLLVSCEGFTVIDSNGDLIYRVDN-YARTRPGELILMDKDGNSLLLMQRTKK  95

Query  363  LSLADNWVVYD-----GET--ADRPLYSVRKHV--SLLNSKS--LAHVTSLRGSGAKGSK  509
            ++L ++W +Y+     GET     P++ +RK++  ++L++KS  LA+V     SG+   K
Sbjct  96   IALVNSWGIYEANDTNGETKIPKCPIWYMRKNLKMNILSNKSDILAYVF----SGSFDKK  151

Query  510  NARVFEIEGSYANRSC-VMYDNVRRRVAEIKRK  605
            N  +  ++GSY  +SC +++  +++ V EIKRK
Sbjct  152  NYYI--VKGSYKCKSCKIVHVPLKKTVVEIKRK  182



>gb|AAM63469.1| unknown [Arabidopsis thaliana]
Length=206

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 87/141 (62%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D +G++++RVD+Y  D+ +  EIVLMDA+G  L T++RKR +
Sbjct  19   LTVCKTSLFYTGDGFAAYDCRGDIIFRVDSYGPDTRDNDEIVLMDATGKCLLTVKRKRPT  78

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE ++  +P++SVR+  S +  +    V    G+G +       + I+G +
Sbjct  79   LHQRWEGFLGERSEGQKPIFSVRR--SSIIGRCTMEVEVYDGTGEE-------YIIDGDF  129

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +  VAEIKRK
Sbjct  130  SQRSCLIYDTKKCTVAEIKRK  150



>ref|NP_566526.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LVZ8.1|LOR12_ARATH RecName: Full=Protein LURP-one-related 12 [Arabidopsis thaliana]
 dbj|BAB02312.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36224.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14161.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75729.1| uncharacterized protein AT3G15810 [Arabidopsis thaliana]
Length=220

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 87/141 (62%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D +G++++RVD+Y  D+ +  EIVLMDA+G  L T++RKR +
Sbjct  33   LTVCKTSLFYTGDGFAAYDCRGDIIFRVDSYGPDTRDNDEIVLMDATGKCLLTVKRKRPT  92

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE ++  +P++SVR+  S +  +    V    G+G +       + I+G +
Sbjct  93   LHQRWEGFLGERSEGQKPIFSVRR--SSIIGRCTMEVEVYDGTGEE-------YIIDGDF  143

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +  VAEIKRK
Sbjct  144  SQRSCLIYDTKKCTVAEIKRK  164



>emb|CDY58464.1| BnaA03g57510D [Brassica napus]
Length=213

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 85/141 (60%), Gaps = 12/141 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY-DSSNRAEIVLMDASGNSLFTIRRKRLS  368
            LTV K SL +  DGF  +D  G++++RVD+Y  D+ +  E VLMD +G  L T++RKR +
Sbjct  26   LTVCKTSLFYTGDGFAAYDCHGDIIFRVDSYGPDTRDNDEFVLMDVAGKCLLTVKRKRPT  85

Query  369  LADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSY  542
            L   W  + GE +D  +P++SVR+  S +  +    V    G+G +       + I+G +
Sbjct  86   LHQRWEGFLGERSDGQKPIFSVRR--SSIIGRCTMDVELYDGTGEE-------YTIDGDF  136

Query  543  ANRSCVMYDNVRRRVAEIKRK  605
            + RSC++YD  +R VAEIKRK
Sbjct  137  SQRSCLIYDTNKRTVAEIKRK  157



>ref|XP_010539503.1| PREDICTED: protein LURP-one-related 5-like [Tarenaya hassleriana]
Length=208

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 86/143 (60%), Gaps = 13/143 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYY--DSSNRAEIVLMDASGNSLFTIRRKRL  365
            LTV K S+ F  DGFTV+D KG+LV+RVD+Y   D+ +  E+VLMDA G  L T+R+KR 
Sbjct  19   LTVRKTSMFFAGDGFTVYDCKGSLVFRVDSYGGPDTRDNDEVVLMDAHGRCLLTLRKKRP  78

Query  366  SLADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGS  539
            SL   W  Y GE +D  +P++SVR+   +    +   V         G+     + IEGS
Sbjct  79   SLRRRWEGYMGERSDGQKPIFSVRRSSVIGRCGATVEVY--------GNGRCEEYLIEGS  130

Query  540  YANRSCVMYD-NVRRRVAEIKRK  605
            +  R+C + + + RR++AEI+RK
Sbjct  131  FRQRTCTVVEADTRRKMAEIRRK  153



>gb|EEE64150.1| hypothetical protein OsJ_18982 [Oryza sativa Japonica Group]
Length=236

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 12/106 (11%)
 Frame = +3

Query  186  TVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKR-  362
             VLTVW+KSLLFNC GFTVFD  G+LVYRVD+ Y + +RAE+VLMDA+G  + T+RRK+ 
Sbjct  43   VVLTVWRKSLLFNCRGFTVFDASGDLVYRVDS-YAADSRAEVVLMDAAGVPVLTVRRKKA  101

Query  363  ----LSL-ADNWVVYDG-ETADRPLYSVRKHVSLLNS----KSLAH  470
                L L  D W+V+ G ET   PLY+V++    +      K++AH
Sbjct  102  IGSQLGLGGDQWLVHPGEETRLPPLYAVKRTPQYVRGGGSVKTMAH  147



>gb|ACU20466.1| unknown [Glycine max]
Length=219

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 84/145 (58%), Gaps = 10/145 (7%)
 Frame = +3

Query  180  QPTVLTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYD-SSNRAEIVLMDASGNSLFTIRR  356
            + T LTV K SL F+ DGF V+D KGNLV+R D+Y   + ++ E+VLMD  G SL T+RR
Sbjct  15   EETKLTVLKTSLFFSGDGFAVYDSKGNLVFRFDSYGPLARDKDELVLMDPHGRSLLTLRR  74

Query  357  KRLSLADNWVVYDGE--TADRPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEI  530
            K+ SL   W  + GE    D+P++SV++   +  S++   V      G +       + I
Sbjct  75   KKPSLHQRWEGFKGERKDGDKPVFSVKRSSIIGRSRTSVAVEVYDSPGVE-------YLI  127

Query  531  EGSYANRSCVMYDNVRRRVAEIKRK  605
            EG +  R C +++  +  VAEI+RK
Sbjct  128  EGCFPQRCCKVFNAAKGLVAEIRRK  152



>emb|CDY30113.1| BnaC05g37490D [Brassica napus]
Length=219

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 85/140 (61%), Gaps = 13/140 (9%)
 Frame = +3

Query  192  LTVWKKSLLFNCDGFTVFDDKGNLVYRVDNYYDSSNRAEIVLMDASGNSLFTIRRKRLSL  371
            LTV K SL    DGFT +D  G++++RVD+Y    +  E+VLMDA+G  L T++RKR +L
Sbjct  35   LTVCKTSLFHTGDGFTAYDCNGDIIFRVDSY--GRDNDELVLMDATGKCLLTVKRKRPTL  92

Query  372  ADNWVVYDGETAD--RPLYSVRKHVSLLNSKSLAHVTSLRGSGAKGSKNARVFEIEGSYA  545
               W  + GE ++  +P++SVR+  S +  +    V    GSG +       + I+G ++
Sbjct  93   HQRWEGFLGERSEGQKPIFSVRR--SSIIGRCTMEVEVYDGSGEE-------YTIDGDFS  143

Query  546  NRSCVMYDNVRRRVAEIKRK  605
             RSC++YD  +R VAEIKRK
Sbjct  144  LRSCLIYDTEKRTVAEIKRK  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 847400547540