BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1870

Length=905
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAD29679.1|AF133209_1  CLC-Nt2 protein                               372   3e-119   Nicotiana tabacum [American tobacco]
ref|XP_009761471.1|  PREDICTED: chloride channel protein CLC-b-like     372   4e-119   Nicotiana sylvestris
ref|XP_009596046.1|  PREDICTED: chloride channel protein CLC-b-like     371   1e-118   Nicotiana tomentosiformis
emb|CDP16685.1|  unnamed protein product                                360   1e-114   Coffea canephora [robusta coffee]
ref|XP_006357190.1|  PREDICTED: chloride channel protein CLC-b-like     351   6e-111   Solanum tuberosum [potatoes]
ref|XP_010660593.1|  PREDICTED: uncharacterized protein LOC100260...    350   8e-111   Vitis vinifera
ref|XP_004233300.1|  PREDICTED: chloride channel protein CLC-b          350   1e-110   Solanum lycopersicum
ref|NP_001268190.1|  uncharacterized protein LOC100260066               348   1e-109   Vitis vinifera
ref|XP_011097296.1|  PREDICTED: chloride channel protein CLC-b-like     347   1e-109   Sesamum indicum [beniseed]
ref|XP_010029007.1|  PREDICTED: chloride channel protein CLC-b          347   2e-109   Eucalyptus grandis [rose gum]
ref|XP_006338691.1|  PREDICTED: chloride channel protein CLC-a-like     345   8e-109   Solanum tuberosum [potatoes]
gb|KDO43321.1|  hypothetical protein CISIN_1g0039662mg                  332   1e-107   Citrus sinensis [apfelsine]
ref|XP_007031847.1|  Chloride channel B isoform 1                       335   1e-106   
ref|XP_002509531.1|  chloride channel clc, putative                     338   3e-106   Ricinus communis
ref|XP_004231786.1|  PREDICTED: chloride channel protein CLC-a-like     336   2e-105   Solanum lycopersicum
ref|XP_002300101.1|  Chloride channel protein CLC-a                     336   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_011098867.1|  PREDICTED: chloride channel protein CLC-a-like     336   4e-105   Sesamum indicum [beniseed]
gb|KDO43317.1|  hypothetical protein CISIN_1g0039662mg                  330   5e-105   Citrus sinensis [apfelsine]
ref|XP_007031848.1|  Chloride channel B isoform 2                       335   6e-105   
gb|KHG13135.1|  Chloride channel CLC-b -like protein                    332   2e-104   Gossypium arboreum [tree cotton]
ref|XP_006447085.1|  hypothetical protein CICLE_v10014341mg             328   3e-104   
ref|XP_011003929.1|  PREDICTED: chloride channel protein CLC-b          333   4e-104   Populus euphratica
gb|KJB76409.1|  hypothetical protein B456_012G087500                    332   7e-104   Gossypium raimondii
gb|KJB76407.1|  hypothetical protein B456_012G087500                    332   8e-104   Gossypium raimondii
ref|XP_006447084.1|  hypothetical protein CICLE_v10014341mg             329   1e-102   Citrus clementina [clementine]
ref|XP_008441347.1|  PREDICTED: chloride channel protein CLC-b-like     328   5e-102   Cucumis melo [Oriental melon]
ref|NP_001267676.1|  chloride channel protein CLC-b-like                327   9e-102   Cucumis sativus [cucumbers]
ref|XP_012070534.1|  PREDICTED: chloride channel protein CLC-b          325   3e-101   Jatropha curcas
ref|XP_010111585.1|  Chloride channel protein CLC-b                     325   8e-101   Morus notabilis
gb|KEH22046.1|  ClC chloride channel family protein                     324   1e-100   Medicago truncatula
ref|XP_008341308.1|  PREDICTED: chloride channel protein CLC-b          308   2e-100   
gb|EYU34803.1|  hypothetical protein MIMGU_mgv1a001623mg                323   3e-100   Erythranthe guttata [common monkey flower]
gb|KHN24330.1|  Chloride channel protein CLC-b                          322   7e-100   Glycine soja [wild soybean]
gb|KHN10806.1|  Chloride channel protein CLC-b                          322   7e-100   Glycine soja [wild soybean]
ref|XP_008231135.1|  PREDICTED: chloride channel protein CLC-b          322   7e-100   Prunus mume [ume]
gb|KHF97413.1|  Chloride channel CLC-b -like protein                    320   9e-100   Gossypium arboreum [tree cotton]
gb|KHN01525.1|  Chloride channel protein CLC-b                          322   9e-100   Glycine soja [wild soybean]
ref|XP_006604142.1|  PREDICTED: chloride channel protein CLC-b-li...    321   1e-99    Glycine max [soybeans]
ref|XP_003553925.1|  PREDICTED: chloride channel protein CLC-b-li...    322   1e-99    Glycine max [soybeans]
gb|KJB11653.1|  hypothetical protein B456_001G270200                    321   2e-99    Gossypium raimondii
ref|XP_010670516.1|  PREDICTED: chloride channel protein CLC-b-like     321   2e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007217037.1|  hypothetical protein PRUPE_ppa001619mg             320   3e-99    Prunus persica
ref|XP_007151531.1|  hypothetical protein PHAVU_004G054600g             320   3e-99    Phaseolus vulgaris [French bean]
gb|EYU45399.1|  hypothetical protein MIMGU_mgv1a001597mg                320   3e-99    Erythranthe guttata [common monkey flower]
ref|XP_007161742.1|  hypothetical protein PHAVU_001G094700g             320   6e-99    Phaseolus vulgaris [French bean]
ref|NP_001236494.1|  chloride channel                                   319   8e-99    
ref|XP_010556277.1|  PREDICTED: chloride channel protein CLC-b          316   9e-99    
ref|XP_010678326.1|  PREDICTED: chloride channel protein CLC-b-li...    312   2e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004303984.1|  PREDICTED: chloride channel protein CLC-b-like     315   3e-97    Fragaria vesca subsp. vesca
ref|XP_010678325.1|  PREDICTED: chloride channel protein CLC-b-li...    314   1e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009371657.1|  PREDICTED: chloride channel protein CLC-b-like     312   5e-96    
ref|XP_006395477.1|  hypothetical protein EUTSA_v10003679mg             311   8e-96    Eutrema salsugineum [saltwater cress]
ref|XP_010502678.1|  PREDICTED: chloride channel protein CLC-b-li...    309   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006290621.1|  hypothetical protein CARUB_v10016713mg             309   4e-95    Capsella rubella
ref|XP_010502677.1|  PREDICTED: chloride channel protein CLC-b-li...    309   6e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010425455.1|  PREDICTED: chloride channel protein CLC-b-li...    308   7e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010425454.1|  PREDICTED: chloride channel protein CLC-b-li...    308   2e-94    Camelina sativa [gold-of-pleasure]
gb|KFK33637.1|  hypothetical protein AALP_AA5G039600                    307   3e-94    Arabis alpina [alpine rockcress]
gb|KEH25445.1|  ClC chloride channel family protein                     303   3e-94    Medicago truncatula
ref|XP_010528167.1|  PREDICTED: chloride channel protein CLC-b-like     306   6e-94    Tarenaya hassleriana [spider flower]
ref|NP_189353.1|  chloride channel protein CLC-b                        306   8e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KEH25446.1|  ClC chloride channel family protein                     304   9e-94    Medicago truncatula
ref|XP_010514406.1|  PREDICTED: chloride channel protein CLC-b          305   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_008379124.1|  PREDICTED: chloride channel protein CLC-b is...    305   1e-93    
gb|AES75065.2|  ClC chloride channel family protein                     305   2e-93    Medicago truncatula
ref|XP_003618847.1|  Chloride channel protein CLC-a                     305   2e-93    
ref|XP_009151988.1|  PREDICTED: chloride channel protein CLC-b          305   2e-93    Brassica rapa
emb|CDY28488.1|  BnaC02g36720D                                          304   3e-93    Brassica napus [oilseed rape]
ref|XP_009129444.1|  PREDICTED: chloride channel protein CLC-b-like     304   4e-93    Brassica rapa
ref|XP_002875360.1|  CLC-B                                              304   5e-93    
emb|CDY13685.1|  BnaA06g32380D                                          303   6e-93    Brassica napus [oilseed rape]
emb|CDX83663.1|  BnaC07g24030D                                          303   6e-93    
ref|XP_010248967.1|  PREDICTED: chloride channel protein CLC-b          302   2e-92    Nelumbo nucifera [Indian lotus]
emb|CDY34173.1|  BnaA02g28670D                                          299   2e-91    Brassica napus [oilseed rape]
ref|XP_009392485.1|  PREDICTED: chloride channel protein CLC-a-like     300   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010905204.1|  PREDICTED: chloride channel protein CLC-b-like     298   8e-91    
ref|NP_001031990.1|  chloride channel protein CLC-a                     293   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929772.1|  PREDICTED: chloride channel protein CLC-b-like     296   6e-90    
ref|XP_004513192.1|  PREDICTED: chloride channel protein CLC-b-like     295   1e-89    Cicer arietinum [garbanzo]
emb|CDY11722.1|  BnaC06g13300D                                          294   3e-89    Brassica napus [oilseed rape]
gb|ADD09860.1|  chloride channel A                                      294   3e-89    Eutrema halophilum
emb|CDX67478.1|  BnaA07g15180D                                          293   3e-89    
gb|AAB17007.1|  voltage-gated chloride channel                          293   6e-89    Arabidopsis thaliana [mouse-ear cress]
emb|CAA96057.1|  CLC-a chloride channel protein                         293   7e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_198905.1|  chloride channel protein CLC-a                        293   7e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AAL24139.1|  putative anion channel protein                          293   8e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125164.1|  PREDICTED: chloride channel protein CLC-a-like     292   8e-89    Brassica rapa
ref|XP_008806046.1|  PREDICTED: chloride channel protein CLC-a-like     293   9e-89    
ref|XP_002868624.1|  ATCLC-A                                            292   1e-88    
ref|XP_009140242.1|  PREDICTED: chloride channel protein CLC-a          292   1e-88    Brassica rapa
ref|XP_006405416.1|  hypothetical protein EUTSA_v10027650mg             292   1e-88    Eutrema salsugineum [saltwater cress]
ref|XP_010450591.1|  PREDICTED: chloride channel protein CLC-a          292   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010441254.1|  PREDICTED: chloride channel protein CLC-a          292   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006285462.1|  hypothetical protein CARUB_v10006880mg             292   2e-88    Capsella rubella
ref|XP_010436030.1|  PREDICTED: chloride channel protein CLC-a-like     291   3e-88    Camelina sativa [gold-of-pleasure]
gb|KJB76408.1|  hypothetical protein B456_012G087500                    292   4e-88    Gossypium raimondii
emb|CDY15925.1|  BnaA04g11860D                                          290   5e-88    Brassica napus [oilseed rape]
ref|XP_008788897.1|  PREDICTED: chloride channel protein CLC-b-like     290   1e-87    
gb|KFK33054.1|  hypothetical protein AALP_AA6G324100                    286   1e-86    Arabis alpina [alpine rockcress]
emb|CDX99630.1|  BnaC04g33870D                                          286   2e-86    
emb|CAN82189.1|  hypothetical protein VITISV_031114                     282   6e-85    Vitis vinifera
ref|XP_007031850.1|  Chloride channel B isoform 4                       283   8e-85    
gb|EMT27070.1|  Chloride channel protein CLC-b                          274   8e-84    
gb|EMT23598.1|  hypothetical protein F775_52599                         273   2e-82    
dbj|BAJ88201.1|  predicted protein                                      272   5e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92499.1|  predicted protein                                      272   5e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96369.1|  predicted protein                                      272   5e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91019.1|  predicted protein                                      271   1e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006664534.1|  PREDICTED: chloride channel protein CLC-a-like     265   4e-78    Oryza brachyantha
ref|XP_003576525.1|  PREDICTED: chloride channel protein CLC-a-like     264   4e-78    Brachypodium distachyon [annual false brome]
ref|XP_002438781.1|  hypothetical protein SORBIDRAFT_10g026090          264   7e-78    Sorghum bicolor [broomcorn]
ref|XP_004962545.1|  PREDICTED: chloride channel protein CLC-a-li...    263   2e-77    Setaria italica
ref|XP_008658999.1|  PREDICTED: chloride channel protein isoform X1     262   3e-77    Zea mays [maize]
gb|ABA98017.1|  Chloride channel protein CLC-a, putative, expressed     258   4e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EEC69202.1|  hypothetical protein OsI_38195                          258   5e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_008379123.1|  PREDICTED: chloride channel protein CLC-b is...    261   7e-77    
gb|EEE53145.1|  hypothetical protein OsJ_35963                          258   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066692.1|  Os12g0438600                                       258   3e-76    
gb|ERN10006.1|  hypothetical protein AMTR_s00013p00233550               253   8e-75    Amborella trichopoda
ref|XP_006848425.2|  PREDICTED: chloride channel protein CLC-a          253   9e-74    
ref|XP_007161741.1|  hypothetical protein PHAVU_001G094700g             236   5e-68    Phaseolus vulgaris [French bean]
ref|XP_004962544.1|  PREDICTED: chloride channel protein CLC-a-li...    218   5e-61    
ref|NP_001183936.1|  chloride channel protein                           217   1e-60    Zea mays [maize]
gb|EMS65031.1|  Chloride channel protein CLC-b                          212   1e-60    Triticum urartu
ref|XP_003581281.1|  PREDICTED: chloride channel protein CLC-c-like     214   1e-59    Brachypodium distachyon [annual false brome]
ref|XP_006652320.1|  PREDICTED: chloride channel protein CLC-c-like     213   2e-59    Oryza brachyantha
ref|XP_010674330.1|  PREDICTED: chloride channel protein CLC-c-like     212   5e-59    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010905340.1|  PREDICTED: putative chloride channel-like pr...    209   1e-58    Elaeis guineensis
ref|XP_010240516.1|  PREDICTED: putative chloride channel-like pr...    209   3e-58    
ref|XP_010905336.1|  PREDICTED: putative chloride channel-like pr...    209   5e-58    Elaeis guineensis
ref|NP_001169702.1|  uncharacterized protein LOC100383583               201   6e-58    
ref|XP_009418228.1|  PREDICTED: putative chloride channel-like pr...    209   6e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392132.1|  PREDICTED: putative chloride channel-like pr...    209   6e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008801913.1|  PREDICTED: putative chloride channel-like pr...    209   9e-58    Phoenix dactylifera
ref|XP_003580671.2|  PREDICTED: putative chloride channel-like pr...    209   1e-57    Brachypodium distachyon [annual false brome]
gb|EEE60792.1|  hypothetical protein OsJ_14377                          208   1e-57    Oryza sativa Japonica Group [Japonica rice]
gb|EAY94258.1|  hypothetical protein OsI_16029                          208   1e-57    Oryza sativa Indica Group [Indian rice]
ref|XP_009405902.1|  PREDICTED: chloride channel protein CLC-c-like     208   2e-57    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAB97267.1|  chloride channel                                       208   2e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010057598.1|  PREDICTED: putative chloride channel-like pr...    208   2e-57    Eucalyptus grandis [rose gum]
ref|XP_010057599.1|  PREDICTED: putative chloride channel-like pr...    207   2e-57    Eucalyptus grandis [rose gum]
gb|ADW93911.1|  chloride channel 1                                      207   4e-57    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004975700.1|  PREDICTED: chloride channel protein CLC-c-li...    207   6e-57    
ref|XP_004975698.1|  PREDICTED: chloride channel protein CLC-c-li...    207   7e-57    
ref|XP_006381102.1|  chloride channel-like family protein               206   8e-57    
ref|XP_006453099.1|  hypothetical protein CICLE_v10007502mg             206   1e-56    
ref|NP_001170245.1|  uncharacterized protein LOC100384199               200   1e-56    
gb|KDO73468.1|  hypothetical protein CISIN_1g003801mg                   204   3e-56    Citrus sinensis [apfelsine]
gb|EMS56130.1|  Putative chloride channel-like protein CLC-g            205   3e-56    Triticum urartu
ref|XP_009393492.1|  PREDICTED: chloride channel protein CLC-c          204   3e-56    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT23162.1|  Putative chloride channel-like protein CLC-g            206   8e-56    
gb|KHN47107.1|  Putative chloride channel-like protein CLC-g            203   8e-56    Glycine soja [wild soybean]
ref|XP_003542650.1|  PREDICTED: putative chloride channel-like pr...    203   8e-56    Glycine max [soybeans]
ref|XP_003573678.1|  PREDICTED: putative chloride channel-like pr...    203   8e-56    Brachypodium distachyon [annual false brome]
emb|CBI27719.3|  unnamed protein product                                203   9e-56    Vitis vinifera
ref|XP_002453459.1|  hypothetical protein SORBIDRAFT_04g006250          203   9e-56    Sorghum bicolor [broomcorn]
ref|XP_003592890.1|  Chloride channel protein CLC-c                     203   1e-55    Medicago truncatula
ref|XP_002447895.1|  hypothetical protein SORBIDRAFT_06g017570          203   1e-55    Sorghum bicolor [broomcorn]
ref|NP_001268085.1|  uncharacterized protein LOC100259734               202   1e-55    Vitis vinifera
ref|XP_006852872.1|  PREDICTED: putative chloride channel-like pr...    202   1e-55    Amborella trichopoda
ref|XP_011626413.1|  PREDICTED: putative chloride channel-like pr...    202   1e-55    
ref|XP_009401373.1|  PREDICTED: putative chloride channel-like pr...    202   2e-55    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG07842.1|  Chloride channel CLC-c -like protein                    202   2e-55    Gossypium arboreum [tree cotton]
ref|XP_009618449.1|  PREDICTED: chloride channel protein CLC-c-like     202   2e-55    Nicotiana tomentosiformis
ref|XP_008786445.1|  PREDICTED: chloride channel protein CLC-c-like     202   2e-55    Phoenix dactylifera
ref|XP_011084085.1|  PREDICTED: putative chloride channel-like pr...    202   3e-55    Sesamum indicum [beniseed]
ref|XP_009791971.1|  PREDICTED: chloride channel protein CLC-c-like     201   3e-55    Nicotiana sylvestris
ref|XP_009411882.1|  PREDICTED: chloride channel protein CLC-c-like     201   3e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011084086.1|  PREDICTED: putative chloride channel-like pr...    200   3e-55    
ref|XP_009358559.1|  PREDICTED: putative chloride channel-like pr...    201   4e-55    Pyrus x bretschneideri [bai li]
ref|XP_010930514.1|  PREDICTED: chloride channel protein CLC-c-like     201   4e-55    Elaeis guineensis
gb|AAQ56538.1|  putative chloride channel                               201   4e-55    Oryza sativa Japonica Group [Japonica rice]
gb|KJB40519.1|  hypothetical protein B456_007G067500                    201   5e-55    Gossypium raimondii
ref|XP_008242835.1|  PREDICTED: putative chloride channel-like pr...    201   5e-55    Prunus mume [ume]
ref|XP_010928311.1|  PREDICTED: putative chloride channel-like pr...    201   6e-55    Elaeis guineensis
ref|XP_004979167.1|  PREDICTED: putative chloride channel-like pr...    201   6e-55    Setaria italica
ref|XP_008368156.1|  PREDICTED: chloride channel protein CLC-c-like     201   7e-55    
ref|XP_010241599.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...    201   7e-55    
gb|AFW70592.1|  hypothetical protein ZEAMMB73_317914                    199   7e-55    
ref|XP_010241600.1|  PREDICTED: putative chloride channel-like pr...    200   8e-55    Nelumbo nucifera [Indian lotus]
ref|XP_011020210.1|  PREDICTED: putative chloride channel-like pr...    200   9e-55    Populus euphratica
ref|XP_004508447.1|  PREDICTED: putative chloride channel-like pr...    200   9e-55    Cicer arietinum [garbanzo]
ref|XP_004287270.1|  PREDICTED: putative chloride channel-like pr...    200   1e-54    Fragaria vesca subsp. vesca
ref|XP_009599120.1|  PREDICTED: chloride channel protein CLC-c-like     200   1e-54    Nicotiana tomentosiformis
ref|XP_004287269.1|  PREDICTED: putative chloride channel-like pr...    200   1e-54    Fragaria vesca subsp. vesca
ref|XP_002530769.1|  chloride channel clc, putative                     200   1e-54    Ricinus communis
ref|XP_009768532.1|  PREDICTED: chloride channel protein CLC-c-like     200   1e-54    Nicotiana sylvestris
ref|XP_008644088.1|  PREDICTED: uncharacterized protein LOC100383...    199   2e-54    
ref|XP_008336976.1|  PREDICTED: putative chloride channel-like pr...    199   2e-54    
ref|NP_001275140.1|  chloride channel protein CLC-c-like                199   2e-54    Solanum tuberosum [potatoes]
ref|XP_010099780.1|  Chloride channel protein CLC-c                     199   2e-54    Morus notabilis
gb|ACF78606.1|  unknown                                                 196   2e-54    Zea mays [maize]
ref|XP_009363967.1|  PREDICTED: putative chloride channel-like pr...    199   3e-54    Pyrus x bretschneideri [bai li]
gb|AFW58337.1|  hypothetical protein ZEAMMB73_926410                    199   3e-54    
ref|XP_007155066.1|  hypothetical protein PHAVU_003G170300g             199   3e-54    Phaseolus vulgaris [French bean]
ref|XP_008788814.1|  PREDICTED: putative chloride channel-like pr...    199   4e-54    Phoenix dactylifera
ref|XP_004248849.1|  PREDICTED: chloride channel protein CLC-c-like     198   4e-54    Solanum lycopersicum
ref|XP_010250239.1|  PREDICTED: putative chloride channel-like pr...    198   5e-54    Nelumbo nucifera [Indian lotus]
ref|XP_008793993.1|  PREDICTED: putative chloride channel-like pr...    198   5e-54    Phoenix dactylifera
ref|XP_002447212.1|  hypothetical protein SORBIDRAFT_06g030530          198   6e-54    Sorghum bicolor [broomcorn]
ref|XP_011017857.1|  PREDICTED: putative chloride channel-like pr...    197   7e-54    Populus euphratica
ref|XP_002454002.1|  hypothetical protein SORBIDRAFT_04g022890          197   8e-54    Sorghum bicolor [broomcorn]
ref|XP_008354360.1|  PREDICTED: putative chloride channel-like pr...    197   9e-54    
ref|XP_006359489.1|  PREDICTED: putative chloride channel-like pr...    197   9e-54    Solanum tuberosum [potatoes]
ref|XP_007152471.1|  hypothetical protein PHAVU_004G133400g             197   1e-53    Phaseolus vulgaris [French bean]
ref|XP_003609433.1|  hypothetical protein MTR_4g115640                  197   1e-53    Medicago truncatula
ref|XP_010529978.1|  PREDICTED: chloride channel protein CLC-c          197   1e-53    Tarenaya hassleriana [spider flower]
ref|XP_008806106.1|  PREDICTED: chloride channel protein CLC-c-like     197   1e-53    
ref|XP_007204268.1|  hypothetical protein PRUPE_ppa001699mg             197   1e-53    Prunus persica
ref|XP_004242745.2|  PREDICTED: putative chloride channel-like pr...    197   2e-53    Solanum lycopersicum
ref|XP_006389435.1|  chloride channel-like family protein               197   2e-53    Populus trichocarpa [western balsam poplar]
ref|XP_010274995.1|  PREDICTED: chloride channel protein CLC-c          196   2e-53    Nelumbo nucifera [Indian lotus]
gb|KHG08138.1|  Chloride channel CLC-c -like protein                    196   2e-53    Gossypium arboreum [tree cotton]
gb|EPS68170.1|  hypothetical protein M569_06601                         196   2e-53    Genlisea aurea
gb|KJB46914.1|  hypothetical protein B456_008G001200                    196   2e-53    Gossypium raimondii
ref|XP_002527858.1|  chloride channel clc, putative                     196   2e-53    
ref|XP_008379004.1|  PREDICTED: chloride channel protein CLC-c          194   3e-53    
ref|XP_011078419.1|  PREDICTED: putative chloride channel-like pr...    196   3e-53    Sesamum indicum [beniseed]
ref|NP_001047143.2|  Os02g0558100                                       195   4e-53    
ref|XP_003575152.1|  PREDICTED: chloride channel protein CLC-c-like     196   4e-53    Brachypodium distachyon [annual false brome]
ref|XP_010025693.1|  PREDICTED: chloride channel protein CLC-c-like     196   4e-53    Eucalyptus grandis [rose gum]
ref|NP_001105216.1|  LOC542114                                          196   4e-53    Zea mays [maize]
ref|XP_010927804.1|  PREDICTED: chloride channel protein CLC-c-like     195   5e-53    
gb|EMS56861.1|  Putative chloride channel-like protein CLC-g            194   6e-53    Triticum urartu
ref|NP_001130407.2|  chloride channel G                                 196   6e-53    
gb|ADD09861.1|  chloride channel C                                      195   6e-53    Eutrema halophilum
ref|XP_006402220.1|  hypothetical protein EUTSA_v10012744mg             195   7e-53    Eutrema salsugineum [saltwater cress]
gb|KJB64678.1|  hypothetical protein B456_010G060300                    195   7e-53    Gossypium raimondii
dbj|BAB97268.1|  chloride channel                                       194   8e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644266.1|  PREDICTED: LOC542114 isoform X1                    195   8e-53    Zea mays [maize]
ref|XP_009777969.1|  PREDICTED: putative chloride channel-like pr...    194   9e-53    Nicotiana sylvestris
ref|XP_009777968.1|  PREDICTED: putative chloride channel-like pr...    194   9e-53    Nicotiana sylvestris
dbj|BAD16425.1|  chloride channel                                       194   9e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009586705.1|  PREDICTED: putative chloride channel-like pr...    194   9e-53    Nicotiana tomentosiformis
tpg|DAA35720.1|  TPA: chloride channel G                                194   1e-52    
ref|XP_006836849.1|  PREDICTED: chloride channel protein CLC-c          194   1e-52    Amborella trichopoda
ref|XP_007048601.1|  Chloride channel C                                 194   1e-52    
tpg|DAA35721.1|  TPA: hypothetical protein ZEAMMB73_781870              194   1e-52    
ref|XP_009586704.1|  PREDICTED: putative chloride channel-like pr...    194   1e-52    Nicotiana tomentosiformis
tpg|DAA35719.1|  TPA: hypothetical protein ZEAMMB73_781870              194   1e-52    
gb|KDO42565.1|  hypothetical protein CISIN_1g003885mg                   193   1e-52    Citrus sinensis [apfelsine]
ref|XP_008667038.1|  PREDICTED: chloride channel G isoform X1           194   1e-52    Zea mays [maize]
ref|XP_010657886.1|  PREDICTED: uncharacterized protein LOC100245...    193   1e-52    Vitis vinifera
ref|XP_006431488.1|  hypothetical protein CICLE_v10000336mg             193   1e-52    
emb|CDO97645.1|  unnamed protein product                                194   2e-52    Coffea canephora [robusta coffee]
gb|KEH26640.1|  chloride channel ClC1 protein                           192   2e-52    Medicago truncatula
ref|XP_004512645.1|  PREDICTED: chloride channel protein CLC-c-li...    192   2e-52    
gb|EYU35026.1|  hypothetical protein MIMGU_mgv1a001577mg                194   2e-52    Erythranthe guttata [common monkey flower]
ref|XP_006652911.1|  PREDICTED: putative chloride channel-like pr...    194   2e-52    Oryza brachyantha
ref|XP_006647383.1|  PREDICTED: chloride channel protein CLC-c-like     193   2e-52    Oryza brachyantha
ref|XP_006431490.1|  hypothetical protein CICLE_v10000336mg             193   3e-52    Citrus clementina [clementine]
ref|XP_004499372.1|  PREDICTED: chloride channel protein CLC-c-like     193   3e-52    Cicer arietinum [garbanzo]
gb|KHN24457.1|  Chloride channel protein CLC-c                          192   3e-52    Glycine soja [wild soybean]
gb|KDO42564.1|  hypothetical protein CISIN_1g003885mg                   193   3e-52    Citrus sinensis [apfelsine]
ref|XP_008361634.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    193   3e-52    
ref|XP_004952777.1|  PREDICTED: chloride channel protein CLC-c-like     194   3e-52    Setaria italica
ref|NP_001267998.1|  uncharacterized protein LOC100255837               192   4e-52    Vitis vinifera
emb|CAN62616.1|  hypothetical protein VITISV_036165                     193   4e-52    Vitis vinifera
emb|CBI29647.3|  unnamed protein product                                192   4e-52    Vitis vinifera
ref|XP_010656505.1|  PREDICTED: uncharacterized protein LOC100255...    192   5e-52    Vitis vinifera
ref|XP_003619757.1|  Chloride channel protein CLC-c                     192   5e-52    
ref|XP_004512644.1|  PREDICTED: chloride channel protein CLC-c-li...    192   5e-52    Cicer arietinum [garbanzo]
gb|AES75975.2|  chloride channel ClC1 protein                           192   5e-52    Medicago truncatula
ref|XP_006470993.1|  PREDICTED: chloride channel protein CLC-c-li...    191   5e-52    Citrus sinensis [apfelsine]
ref|XP_010657885.1|  PREDICTED: uncharacterized protein LOC100245...    192   5e-52    Vitis vinifera
ref|XP_011016274.1|  PREDICTED: chloride channel protein CLC-c-like     192   5e-52    Populus euphratica
ref|XP_006587398.1|  PREDICTED: chloride channel protein CLC-c-li...    191   5e-52    Glycine max [soybeans]
ref|XP_004512643.1|  PREDICTED: chloride channel protein CLC-c-li...    192   5e-52    Cicer arietinum [garbanzo]
ref|XP_004977021.1|  PREDICTED: putative chloride channel-like pr...    192   6e-52    Setaria italica
emb|CDY21447.1|  BnaC03g27500D                                          192   6e-52    Brassica napus [oilseed rape]
ref|NP_001268053.1|  uncharacterized protein LOC100245380               192   6e-52    Vitis vinifera
gb|KEH32756.1|  chloride channel ClC1 protein                           192   6e-52    Medicago truncatula
ref|XP_009134029.1|  PREDICTED: chloride channel protein CLC-c          192   6e-52    Brassica rapa
ref|XP_010687879.1|  PREDICTED: putative chloride channel-like pr...    192   6e-52    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687880.1|  PREDICTED: putative chloride channel-like pr...    191   7e-52    Beta vulgaris subsp. vulgaris [field beet]
gb|AIY56605.1|  CLC                                                     192   8e-52    Arachis hypogaea [goober]
ref|XP_011028391.1|  PREDICTED: chloride channel protein CLC-c-like     192   9e-52    Populus euphratica
ref|XP_004288642.1|  PREDICTED: chloride channel protein CLC-c          192   9e-52    Fragaria vesca subsp. vesca
ref|XP_011087632.1|  PREDICTED: chloride channel protein CLC-c          192   9e-52    
ref|XP_006385193.1|  Chloride channel protein CLC-c                     191   1e-51    
ref|XP_010050093.1|  PREDICTED: putative chloride channel-like pr...    191   1e-51    
gb|EYU34964.1|  hypothetical protein MIMGU_mgv1a001646mg                191   1e-51    
ref|XP_003533268.2|  PREDICTED: chloride channel protein CLC-c-li...    191   1e-51    
gb|KHM99790.1|  Chloride channel protein CLC-c                          191   1e-51    
ref|XP_006470992.1|  PREDICTED: chloride channel protein CLC-c-li...    191   1e-51    
ref|XP_006587397.1|  PREDICTED: chloride channel protein CLC-c-li...    191   1e-51    
ref|XP_007013577.1|  Voltage-gated chloride channel family protei...    191   1e-51    
ref|XP_009403198.1|  PREDICTED: putative chloride channel-like pr...    192   1e-51    
ref|XP_010030223.1|  PREDICTED: chloride channel protein CLC-c-li...    191   1e-51    
ref|XP_010541946.1|  PREDICTED: putative chloride channel-like pr...    191   1e-51    
emb|CDX91539.1|  BnaC02g16210D                                          191   1e-51    
ref|XP_006385076.1|  Chloride channel protein CLC-c                     191   1e-51    
ref|XP_009127371.1|  PREDICTED: chloride channel protein CLC-c          191   2e-51    
ref|XP_010030224.1|  PREDICTED: chloride channel protein CLC-c-li...    191   2e-51    
ref|XP_008227672.1|  PREDICTED: chloride channel protein CLC-c-like     191   2e-51    
ref|XP_011003711.1|  PREDICTED: chloride channel protein CLC-c-like     191   2e-51    
gb|EMT06377.1|  Putative chloride channel-like protein CLC-g            191   2e-51    
ref|XP_006349289.1|  PREDICTED: chloride channel protein CLC-c-like     191   2e-51    
ref|XP_004230422.1|  PREDICTED: chloride channel protein CLC-c          191   2e-51    
ref|XP_008452224.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    190   3e-51    
gb|AFJ15539.1|  chloride channel c                                      190   3e-51    
ref|XP_011650578.1|  PREDICTED: chloride channel protein CLC-c is...    190   3e-51    
ref|XP_011047852.1|  PREDICTED: chloride channel protein CLC-c-like     190   3e-51    
ref|XP_007214607.1|  hypothetical protein PRUPE_ppa001700mg             190   3e-51    
emb|CDX83179.1|  BnaA03g23270D                                          190   3e-51    
ref|XP_004133730.1|  PREDICTED: chloride channel protein CLC-c is...    190   4e-51    
ref|XP_007013578.1|  Voltage-gated chloride channel family protei...    189   6e-51    
ref|XP_009403721.1|  PREDICTED: chloride channel protein CLC-c-like     189   6e-51    
ref|NP_198313.2|  putative chloride channel-like protein CLC-g          189   6e-51    
ref|XP_010999722.1|  PREDICTED: chloride channel protein CLC-c-like     189   7e-51    
ref|XP_009355373.1|  PREDICTED: chloride channel protein CLC-c-like     189   9e-51    
ref|XP_010909770.1|  PREDICTED: chloride channel protein CLC-c-like     189   9e-51    
ref|XP_006599665.1|  PREDICTED: chloride channel protein CLC-c-li...    188   1e-50    
ref|XP_006599664.1|  PREDICTED: chloride channel protein CLC-c-li...    188   1e-50    
ref|XP_006599656.1|  PREDICTED: chloride channel protein CLC-c-li...    188   1e-50    
ref|XP_006283171.1|  hypothetical protein CARUB_v10004204mg             188   1e-50    
emb|CAJ86158.1|  H0413E07.11                                            188   2e-50    
emb|CAD41919.2|  OSJNBa0033G05.20                                       188   2e-50    
gb|ABB86548.1|  chloride channel-like protein Osclc                     188   2e-50    
emb|CDP10469.1|  unnamed protein product                                188   2e-50    
gb|KHG01487.1|  Putative chloride channel-like protein CLC-g            187   2e-50    
gb|EEE61792.1|  hypothetical protein OsJ_16396                          188   3e-50    
ref|XP_008801915.1|  PREDICTED: putative chloride channel-like pr...    187   3e-50    
ref|XP_009392134.1|  PREDICTED: putative chloride channel-like pr...    187   3e-50    
ref|XP_012066731.1|  PREDICTED: chloride channel protein CLC-c-li...    187   3e-50    
ref|XP_002865761.1|  CLC-C                                              187   4e-50    
ref|XP_012066730.1|  PREDICTED: chloride channel protein CLC-c-li...    187   4e-50    
ref|XP_009392135.1|  PREDICTED: putative chloride channel-like pr...    187   4e-50    
dbj|BAJ92873.1|  predicted protein                                      187   4e-50    
gb|EMS50378.1|  Chloride channel protein CLC-c                          187   4e-50    
ref|XP_009339814.1|  PREDICTED: chloride channel protein CLC-c-like     187   5e-50    
ref|NP_199800.1|  chloride channel protein CLC-c                        186   8e-50    
emb|CDY12393.1|  BnaC08g08120D                                          186   1e-49    
ref|XP_006280044.1|  hypothetical protein CARUB_v10025921mg             185   1e-49    
gb|KJB53990.1|  hypothetical protein B456_009G015100                    185   2e-49    
ref|XP_010441249.1|  PREDICTED: chloride channel protein CLC-c-like     185   2e-49    
emb|CDY47559.1|  BnaA08g07280D                                          185   2e-49    
gb|KFK30515.1|  hypothetical protein AALP_AA7G272300                    185   2e-49    
ref|XP_004970759.1|  PREDICTED: chloride channel protein CLC-c-like     185   2e-49    
ref|XP_010682061.1|  PREDICTED: chloride channel protein CLC-c-like     184   3e-49    
ref|XP_010442463.1|  PREDICTED: chloride channel protein CLC-c          184   3e-49    
gb|KCW74788.1|  hypothetical protein EUGRSUZ_E03522                     184   4e-49    
ref|XP_010482284.1|  PREDICTED: chloride channel protein CLC-c-like     184   4e-49    
ref|XP_010435388.1|  PREDICTED: putative chloride channel-like pr...    184   5e-49    
ref|XP_004975699.1|  PREDICTED: chloride channel protein CLC-c-li...    184   5e-49    
ref|XP_004975701.1|  PREDICTED: chloride channel protein CLC-c-li...    184   7e-49    
ref|XP_008457165.1|  PREDICTED: putative chloride channel-like pr...    183   9e-49    
ref|XP_009108066.1|  PREDICTED: putative chloride channel-like pr...    183   9e-49    
ref|XP_002870407.1|  hypothetical protein ARALYDRAFT_493576             183   1e-48    
dbj|BAD82092.1|  putative chloride channel                              182   1e-48    
gb|EEC71893.1|  hypothetical protein OsI_04638                          182   2e-48    
ref|XP_010096974.1|  Putative chloride channel-like protein CLC-g       182   2e-48    
gb|EEE55755.1|  hypothetical protein OsJ_04269                          182   3e-48    
ref|XP_004486231.1|  PREDICTED: chloride channel protein CLC-c-like     182   3e-48    
ref|NP_001267618.1|  putative chloride channel-like protein CLC-g...    181   3e-48    
ref|XP_008674757.1|  PREDICTED: chloride channel protein CLC-c          181   5e-48    
ref|XP_011626414.1|  PREDICTED: putative chloride channel-like pr...    181   5e-48    
tpg|DAA56573.1|  TPA: chloride channel protein                          181   5e-48    
ref|XP_003567326.1|  PREDICTED: chloride channel protein CLC-c-like     181   6e-48    
ref|XP_010450335.1|  PREDICTED: putative chloride channel-like pr...    180   1e-47    
ref|XP_006388253.1|  hypothetical protein POPTR_0261s002201g            175   2e-47    
ref|XP_010241601.1|  PREDICTED: putative chloride channel-like pr...    179   2e-47    
gb|KCW82961.1|  hypothetical protein EUGRSUZ_C04346                     178   2e-47    
ref|XP_008218680.1|  PREDICTED: chloride channel protein CLC-c          179   2e-47    
ref|XP_006395982.1|  hypothetical protein EUTSA_v10003685mg             179   3e-47    
gb|KCW82974.1|  hypothetical protein EUGRSUZ_C04362                     178   3e-47    
ref|XP_012064872.1|  PREDICTED: chloride channel protein CLC-c-like     179   4e-47    
gb|KJB40520.1|  hypothetical protein B456_007G067500                    178   4e-47    
ref|XP_002456727.1|  hypothetical protein SORBIDRAFT_03g041480          179   4e-47    
ref|XP_008788815.1|  PREDICTED: putative chloride channel-like pr...    177   1e-46    
ref|XP_012081174.1|  PREDICTED: putative chloride channel-like pr...    175   5e-46    
ref|XP_007225226.1|  hypothetical protein PRUPE_ppa001898mg             174   8e-46    
ref|XP_011017858.1|  PREDICTED: putative chloride channel-like pr...    174   9e-46    
gb|KHG02940.1|  Putative chloride channel-like protein CLC-g            174   1e-45    
gb|ADF30876.1|  chloride channel protein                                174   1e-45    
ref|XP_002325287.2|  hypothetical protein POPTR_0019s00230g             173   1e-45    
ref|XP_006370817.1|  hypothetical protein POPTR_0019s00230g             173   2e-45    
gb|EEC78120.1|  hypothetical protein OsI_17660                          167   2e-45    
gb|EMT28663.1|  Chloride channel protein CLC-c                          172   5e-45    
ref|XP_002974253.1|  hypothetical protein SELMODRAFT_100906             165   3e-42    
gb|ADF78069.1|  chloride channel protein                                163   9e-42    
ref|XP_002985623.1|  hypothetical protein SELMODRAFT_181899             163   1e-41    
ref|XP_008385147.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...    162   2e-41    
ref|XP_009401374.1|  PREDICTED: putative chloride channel-like pr...    162   3e-41    
gb|EPS73799.1|  hypothetical protein M569_00956                         162   4e-41    
emb|CDM85188.1|  unnamed protein product                                160   1e-40    
ref|XP_008441632.1|  PREDICTED: chloride channel protein CLC-b-like     145   4e-38    
gb|EMT27046.1|  Chloride channel protein CLC-c                          152   8e-38    
ref|XP_002974894.1|  hypothetical protein SELMODRAFT_442632             149   1e-36    
ref|XP_002988905.1|  hypothetical protein SELMODRAFT_427560             149   2e-36    
ref|XP_001756485.1|  predicted protein                                  149   2e-36    
gb|EMS67360.1|  Chloride channel protein CLC-c                          145   3e-35    
ref|XP_009403199.1|  PREDICTED: putative chloride channel-like pr...    144   6e-35    
ref|NP_001050977.1|  Os03g0695700                                       137   1e-34    
ref|XP_010546809.1|  PREDICTED: chloride channel protein CLC-d is...    142   5e-34    
ref|XP_010546808.1|  PREDICTED: chloride channel protein CLC-d is...    142   6e-34    
ref|XP_009395587.1|  PREDICTED: chloride channel protein CLC-d is...    141   9e-34    
ref|XP_009395588.1|  PREDICTED: chloride channel protein CLC-d is...    141   9e-34    
ref|XP_009395586.1|  PREDICTED: chloride channel protein CLC-d is...    141   1e-33    
dbj|BAJ33844.1|  unnamed protein product                                138   2e-33    
ref|XP_002464046.1|  hypothetical protein SORBIDRAFT_01g011250          134   7e-33    
gb|ABF98344.1|  Chloride channel protein CLC-d, putative, expressed     136   7e-33    
gb|KFK26403.1|  hypothetical protein AALP_AA8G244100                    137   1e-32    
gb|KFK26402.1|  hypothetical protein AALP_AA8G244100                    137   2e-32    
gb|KDP40151.1|  hypothetical protein JCGZ_02149                         137   2e-32    
ref|XP_012069593.1|  PREDICTED: chloride channel protein CLC-d is...    137   2e-32    
ref|XP_012069592.1|  PREDICTED: chloride channel protein CLC-d is...    137   2e-32    
gb|EYU45642.1|  hypothetical protein MIMGU_mgv1a0022071mg               130   2e-32    
tpg|DAA50799.1|  TPA: hypothetical protein ZEAMMB73_784473              133   2e-32    
gb|EYU45643.1|  hypothetical protein MIMGU_mgv1a0022071mg               130   2e-32    
ref|XP_006394870.1|  hypothetical protein EUTSA_v10003643mg             137   3e-32    
ref|XP_006394869.1|  hypothetical protein EUTSA_v10003643mg             137   3e-32    
ref|XP_002872208.1|  CLC-D                                              137   3e-32    
ref|XP_006394868.1|  hypothetical protein EUTSA_v10003643mg             137   3e-32    
ref|XP_007157150.1|  hypothetical protein PHAVU_002G0470001g            133   3e-32    
tpg|DAA50798.1|  TPA: hypothetical protein ZEAMMB73_784473              132   4e-32    
tpg|DAA50797.1|  TPA: hypothetical protein ZEAMMB73_784473              132   4e-32    
ref|XP_007157149.1|  hypothetical protein PHAVU_002G0470001g            133   4e-32    
ref|XP_006290072.1|  hypothetical protein CARUB_v10003710mg             136   5e-32    
ref|XP_010493890.1|  PREDICTED: chloride channel protein CLC-d-like     136   5e-32    
emb|CAA96065.1|  CLC-d chloride channel protein                         136   5e-32    
ref|XP_010454978.1|  PREDICTED: chloride channel protein CLC-d is...    136   5e-32    
ref|XP_010454977.1|  PREDICTED: chloride channel protein CLC-d is...    136   5e-32    
ref|NP_197996.1|  chloride channel protein CLC-d                        136   5e-32    
gb|AAC26247.2|  Arabidopsis thaliana CLC-d chloride channel prote...    136   6e-32    
ref|XP_010024357.1|  PREDICTED: chloride channel protein CLC-d          130   7e-32    
gb|EEE59743.1|  hypothetical protein OsJ_12209                          135   8e-32    
emb|CDY52633.1|  BnaC07g49590D                                          135   1e-31    
gb|AAO19370.1|  putative CLC-d chloride channel protein                 135   1e-31    
ref|XP_001782456.1|  predicted protein                                  135   1e-31    
gb|EEC75998.1|  hypothetical protein OsI_13133                          135   1e-31    
ref|XP_010421497.1|  PREDICTED: chloride channel protein CLC-d-li...    135   1e-31    
ref|XP_010421498.1|  PREDICTED: chloride channel protein CLC-d-li...    135   1e-31    
gb|KCW60808.1|  hypothetical protein EUGRSUZ_H03545                     129   1e-31    
dbj|BAJ97961.1|  predicted protein                                      134   2e-31    
ref|XP_002963642.1|  hypothetical protein SELMODRAFT_80232              134   2e-31    
ref|XP_002974732.1|  hypothetical protein SELMODRAFT_101801             134   3e-31    
ref|XP_006489358.1|  PREDICTED: chloride channel protein CLC-d-li...    134   3e-31    
ref|XP_004982102.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    134   3e-31    
ref|XP_006419888.1|  hypothetical protein CICLE_v10004375mg             134   3e-31    
gb|AGZ89689.2|  chloride channel protein CLC-d                          134   3e-31    
ref|XP_009151133.1|  PREDICTED: chloride channel protein CLC-d is...    134   4e-31    
gb|KDO74671.1|  hypothetical protein CISIN_1g003732mg                   134   4e-31    
ref|XP_011021556.1|  PREDICTED: chloride channel protein CLC-d is...    133   5e-31    
ref|XP_009151132.1|  PREDICTED: chloride channel protein CLC-d is...    133   5e-31    
ref|XP_006650436.1|  PREDICTED: chloride channel protein CLC-d-like     133   5e-31    
ref|XP_011021557.1|  PREDICTED: chloride channel protein CLC-d is...    133   6e-31    
ref|XP_006590398.1|  PREDICTED: chloride channel protein CLC-d-li...    132   6e-31    
gb|AES93651.2|  chloride channel protein ClC-D protein, putative        131   8e-31    
ref|XP_008380308.1|  PREDICTED: chloride channel protein CLC-d-li...    127   8e-31    
gb|KEH27345.1|  chloride channel protein ClC-D protein, putative        131   9e-31    
ref|XP_002315783.2|  hypothetical protein POPTR_0010s10040g             132   1e-30    
ref|XP_010255989.1|  PREDICTED: chloride channel protein CLC-d is...    132   1e-30    
ref|XP_004511351.1|  PREDICTED: chloride channel protein CLC-d-li...    132   1e-30    
ref|XP_003539246.1|  PREDICTED: chloride channel protein CLC-d-li...    132   1e-30    
ref|XP_004511350.1|  PREDICTED: chloride channel protein CLC-d-li...    132   1e-30    
gb|KHN35186.1|  Chloride channel protein CLC-d                          132   1e-30    
ref|XP_006590397.1|  PREDICTED: chloride channel protein CLC-d-li...    132   2e-30    
ref|XP_002595670.1|  hypothetical protein BRAFLDRAFT_200772             131   2e-30    
ref|XP_003610692.1|  Chloride channel protein CLC-d                     131   2e-30    
ref|XP_010255990.1|  PREDICTED: chloride channel protein CLC-d is...    131   2e-30    
ref|XP_003610694.1|  Chloride channel protein CLC-d                     131   2e-30    
gb|KEH27344.1|  chloride channel protein ClC-D protein, putative        131   2e-30    
ref|XP_010255988.1|  PREDICTED: chloride channel protein CLC-d is...    131   2e-30    
ref|XP_003610693.1|  Chloride channel protein CLC-d                     131   3e-30    
ref|XP_010649611.1|  PREDICTED: uncharacterized protein LOC100261...    131   3e-30    
ref|XP_006573887.1|  PREDICTED: chloride channel protein CLC-d-li...    131   3e-30    
ref|XP_006573885.1|  PREDICTED: chloride channel protein CLC-d-li...    131   3e-30    
ref|XP_002517213.1|  chloride channel clc, putative                     131   3e-30    
ref|XP_006573886.1|  PREDICTED: chloride channel protein CLC-d-li...    131   3e-30    
ref|XP_003517583.1|  PREDICTED: chloride channel protein CLC-d-li...    131   3e-30    
ref|NP_001267905.1|  uncharacterized protein LOC100261408               130   3e-30    
ref|XP_008665233.1|  PREDICTED: chloride channel protein CLC-d is...    130   4e-30    
ref|XP_008665231.1|  PREDICTED: chloride channel protein CLC-d is...    130   4e-30    
gb|AGR03817.1|  chloride channel d-like protein                         130   4e-30    
gb|ADW93910.1|  chloride channel 1                                      130   5e-30    
ref|XP_003561001.1|  PREDICTED: chloride channel protein CLC-d is...    130   5e-30    
ref|XP_010231301.1|  PREDICTED: chloride channel protein CLC-d is...    130   6e-30    
gb|ENN77853.1|  hypothetical protein YQE_05531                          130   6e-30    
dbj|BAK05536.1|  predicted protein                                      130   8e-30    
ref|XP_011071571.1|  PREDICTED: chloride channel protein CLC-d is...    130   8e-30    
ref|XP_010524818.1|  PREDICTED: chloride channel protein CLC-d is...    129   9e-30    
ref|XP_011071568.1|  PREDICTED: chloride channel protein CLC-d is...    129   9e-30    
ref|XP_010524816.1|  PREDICTED: chloride channel protein CLC-d is...    129   9e-30    
ref|XP_011071569.1|  PREDICTED: chloride channel protein CLC-d is...    129   1e-29    
ref|XP_011071570.1|  PREDICTED: chloride channel protein CLC-d is...    129   1e-29    
ref|XP_008358025.1|  PREDICTED: chloride channel protein CLC-d-li...    127   1e-29    
ref|XP_011621417.1|  PREDICTED: chloride channel protein CLC-d is...    129   1e-29    
ref|XP_009366954.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    128   2e-29    
ref|XP_008380307.1|  PREDICTED: chloride channel protein CLC-d-li...    124   2e-29    
gb|ERN00844.1|  hypothetical protein AMTR_s00103p00080940               129   2e-29    
ref|XP_011621418.1|  PREDICTED: chloride channel protein CLC-d is...    129   2e-29    
gb|EPS62511.1|  hypothetical protein M569_12278                         128   2e-29    
gb|EMT29473.1|  Chloride channel protein CLC-d                          129   2e-29    
gb|ADP02177.1|  putative chloride channel protein CLC-d                 129   2e-29    
gb|KGN48017.1|  hypothetical protein Csa_6G425060                       128   3e-29    
gb|KJB12549.1|  hypothetical protein B456_002G024000                    128   3e-29    
gb|KJB12550.1|  hypothetical protein B456_002G024000                    128   3e-29    
ref|XP_011657577.1|  PREDICTED: chloride channel protein CLC-d          128   3e-29    
ref|XP_007034700.1|  Chloride channel clc, putative isoform 1           127   4e-29    



>gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum]
Length=786

 Score =   372 bits (956),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 198/231 (86%), Positives = 209/231 (90%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSVGDCFN SIY+IILELKGLPFLDANPEPWMRNIT GELADVK PVVTLCG+EKVGRI
Sbjct  556  AKSVGDCFNLSIYEIILELKGLPFLDANPEPWMRNITAGELADVKPPVVTLCGVEKVGRI  615

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VE LKNTTYNGFPVVDE  V        ATELHG+VLRTHLLLVLKKK+F+HERRRTEEW
Sbjct  616  VEALKNTTYNGFPVVDEGVVPPVGLPVGATELHGLVLRTHLLLVLKKKWFLHERRRTEEW  675

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+W+DLAER GKIEDV VT DEMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  676  EVREKFTWIDLAERGGKIEDVLVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLFRQ  735

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNIL+VFPHL KSK   KG+
Sbjct  736  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILSVFPHLEKSKSGKKGN  786



>ref|XP_009761471.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana sylvestris]
Length=786

 Score =   372 bits (956),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 198/231 (86%), Positives = 209/231 (90%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSVGDCFN SIY+IILELKGLPFLDANPEPWMRNIT GELADVK PVVTLCG+EKVGRI
Sbjct  556  AKSVGDCFNLSIYEIILELKGLPFLDANPEPWMRNITAGELADVKPPVVTLCGVEKVGRI  615

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VE LKNTTYNGFPVVDE  V        ATELHG+VLRTHLLLVLKKK+F+HERRRTEEW
Sbjct  616  VEALKNTTYNGFPVVDEGVVPPVGLPVGATELHGLVLRTHLLLVLKKKWFLHERRRTEEW  675

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+W+DLAER GKIEDV VT DEMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  676  EVREKFTWIDLAERGGKIEDVLVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLFRQ  735

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNIL+VFPHL KSK   KG+
Sbjct  736  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILSVFPHLEKSKSGKKGN  786



>ref|XP_009596046.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana tomentosiformis]
Length=786

 Score =   371 bits (952),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 197/231 (85%), Positives = 210/231 (91%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSVGDCFN SIY+IILELKGLPFLDANPEPWMRNIT GELADVK PVVTLCG+EKVGRI
Sbjct  556  AKSVGDCFNLSIYEIILELKGLPFLDANPEPWMRNITAGELADVKPPVVTLCGVEKVGRI  615

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTTYNGFPVVDE  V        ATELHG+VLRTHLLLVLKKK+F++ERRRTEEW
Sbjct  616  VDVLKNTTYNGFPVVDEGVVPPVGLPVGATELHGLVLRTHLLLVLKKKWFLNERRRTEEW  675

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+W+DLAER GKIEDV VT DEMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  676  EVREKFTWIDLAERGGKIEDVVVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLFRQ  735

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNIL+VFPHL KSK   KG+
Sbjct  736  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILSVFPHLEKSKSGKKGN  786



>emb|CDP16685.1| unnamed protein product [Coffea canephora]
Length=786

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 191/231 (83%), Positives = 208/231 (90%), Gaps = 9/231 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGDCFNPSIY+IILELKGLPFLDANPEPWMRNITVGELADVK PVVTL GIEKVG I
Sbjct  557  AKTVGDCFNPSIYEIILELKGLPFLDANPEPWMRNITVGELADVKPPVVTLHGIEKVGYI  616

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVL+NTT+NGFPVVDE        +  ATEL G+VLR HLLLVLK+K+F+ ERRRTEEW
Sbjct  617  VEVLRNTTHNGFPVVDEGVMAPVGTQTGATELVGLVLRAHLLLVLKRKWFLQERRRTEEW  676

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WVDLAERWGKI+DV VT DEMEMYVDLHPLTNTTP+TV ES+S AKAMVLFRQ
Sbjct  677  EVREKFTWVDLAERWGKIDDVTVTKDEMEMYVDLHPLTNTTPYTVLESMSAAKAMVLFRQ  736

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHM+I+PKYQA+GVSPVVGILTRQDLRAHNIL+ FPHLAKSKG  KGH
Sbjct  737  VGLRHMIIIPKYQASGVSPVVGILTRQDLRAHNILSAFPHLAKSKG-KKGH  786



>ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-like [Solanum tuberosum]
Length=784

 Score =   351 bits (900),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 199/229 (87%), Positives = 208/229 (91%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +KSVGDCFN SIY+IILELKGLPFLDANPEPWMRNITVGELADVK PVVTL GIEKVGRI
Sbjct  555  SKSVGDCFNLSIYEIILELKGLPFLDANPEPWMRNITVGELADVKPPVVTLRGIEKVGRI  614

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVLKNTT+NGFPVVDE  V        ATELHG+VLRTHLLLVLKKK F+HERRRTEEW
Sbjct  615  VEVLKNTTHNGFPVVDEGVVPPVGLPIGATELHGIVLRTHLLLVLKKKLFLHERRRTEEW  674

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKFSW+DLAERWGKIEDVAVT  EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  675  EVREKFSWIDLAERWGKIEDVAVTKSEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  734

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNIL+VFPHL KSK   K
Sbjct  735  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILSVFPHLVKSKSGKK  783



>ref|XP_010660593.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 ref|XP_010660594.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 emb|CBI21361.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   350 bits (899),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 204/231 (88%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSVGDC NPSIYDIIL LKGLPFLDANPEPWMRN+TVGELAD K PVVTL G+EKV RI
Sbjct  559  AKSVGDCINPSIYDIILHLKGLPFLDANPEPWMRNLTVGELADAKPPVVTLRGVEKVARI  618

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+NGFPVVDE  V        ATELHG+VLR HL+ VLKKK+F+ ERRRTEEW
Sbjct  619  VDVLRNTTHNGFPVVDEGVVPRVGLAIGATELHGIVLRAHLVKVLKKKWFLQERRRTEEW  678

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+W++LAER GK E+VAVTNDEMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  679  EVREKFTWIELAEREGKFEEVAVTNDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  738

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLIVPKYQAAGVSPVVGILTRQDLRA+NIL  FPHLAKSK   KG+
Sbjct  739  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAYNILTAFPHLAKSKEREKGN  789



>ref|XP_004233300.1| PREDICTED: chloride channel protein CLC-b [Solanum lycopersicum]
Length=784

 Score =   350 bits (898),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 199/229 (87%), Positives = 207/229 (90%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +KSVGDCFN SIY+IILELKGLPFLDANPEPWMRNITVGELADVK PVVTL GIEKVGRI
Sbjct  555  SKSVGDCFNLSIYEIILELKGLPFLDANPEPWMRNITVGELADVKPPVVTLRGIEKVGRI  614

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVLKNTT+NGFPVVDE  V        ATELHG+VLRTHLLLVLKKK F+HERRRTEEW
Sbjct  615  VEVLKNTTHNGFPVVDEGVVPPVGLPIGATELHGIVLRTHLLLVLKKKLFLHERRRTEEW  674

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKFSW+DLAERWGKIEDVAVT  EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  675  EVREKFSWIDLAERWGKIEDVAVTKSEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  734

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNIL VFPHL KSK   K
Sbjct  735  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILTVFPHLVKSKSGKK  783



>ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis vinifera]
 gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera]
Length=789

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 203/231 (88%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSVGDC NPSIYDIIL LKGLPFLDANPEPWMRN+TVGELAD K  VVTL G+EKV RI
Sbjct  559  AKSVGDCINPSIYDIILHLKGLPFLDANPEPWMRNLTVGELADAKPQVVTLRGVEKVARI  618

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+NGFPVVDE  V        ATELHG+VLR HL+ VLKKK+F+ ERRRTEEW
Sbjct  619  VDVLRNTTHNGFPVVDEGVVPRVGLAIGATELHGIVLRAHLVKVLKKKWFLQERRRTEEW  678

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+W++LAER GK E+VAVTNDEMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  679  EVREKFTWIELAEREGKFEEVAVTNDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  738

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLIVPKYQAAGVSPVVGILTRQDLRA+NIL  FPHLAKSK   KG+
Sbjct  739  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAYNILTAFPHLAKSKEREKGN  789



>ref|XP_011097296.1| PREDICTED: chloride channel protein CLC-b-like [Sesamum indicum]
Length=787

 Score =   347 bits (891),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 202/231 (87%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGDCFNPSIYDIILELKGLPFLDA+PEPWMRNITVGELADVK PVVTL GIEKV  I
Sbjct  557  AKTVGDCFNPSIYDIILELKGLPFLDAHPEPWMRNITVGELADVKPPVVTLSGIEKVSHI  616

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVLKNTT+NGFPVVD   +        ATELHG+VLR HL+LVLKKK+F+ E+RRT+EW
Sbjct  617  VEVLKNTTHNGFPVVDAGVIPPMGSPNGATELHGLVLRAHLILVLKKKWFLQEKRRTQEW  676

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+ +DLAER GKIE+V VT DEMEMYVDLHPL+NTTP+TV ES+SVAKAMVLFRQ
Sbjct  677  EVREKFTSIDLAERGGKIEEVTVTKDEMEMYVDLHPLSNTTPYTVVESMSVAKAMVLFRQ  736

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLI+PKYQAAGV PVVGILTRQDLRAHNIL+  P L KS GS KGH
Sbjct  737  VGLRHMLILPKYQAAGVYPVVGILTRQDLRAHNILSALPQLKKSNGSKKGH  787



>ref|XP_010029007.1| PREDICTED: chloride channel protein CLC-b [Eucalyptus grandis]
 gb|KCW55840.1| hypothetical protein EUGRSUZ_I01654 [Eucalyptus grandis]
Length=788

 Score =   347 bits (890),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 204/230 (89%), Gaps = 7/230 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD FNPSIY+IILELKGLPFLDANPEPWMR++TVGELADVK PVVTLCG+EKV R+
Sbjct  559  SKTVGDSFNPSIYEIILELKGLPFLDANPEPWMRDLTVGELADVKPPVVTLCGVEKVSRV  618

Query  660  VEVLKNTTYNGFPVVDEE-------RVATELHGVVLRTHLLLVLKKKYFMHerrrteewe  502
            VEVLKNTT+NGFPVV+            TELHG++LR HL+ V+KKK+F+ ERRRTE+WE
Sbjct  619  VEVLKNTTHNGFPVVEGVVPPAGLITSTTELHGLILRAHLVQVIKKKWFLQERRRTEDWE  678

Query  501  vrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            VRE+FSW+DLAER GKIE+VAVT DEMEMYVDLHP TNTTP+TV ES+SVAKAMVLFRQV
Sbjct  679  VRERFSWIDLAEREGKIEEVAVTRDEMEMYVDLHPFTNTTPYTVVESMSVAKAMVLFRQV  738

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            GLRHMLI+PKYQAAGVSPVVG+LTRQDLRA+NILA FPHLAKSKG   GH
Sbjct  739  GLRHMLILPKYQAAGVSPVVGVLTRQDLRAYNILAAFPHLAKSKGMEGGH  788



>ref|XP_006338691.1| PREDICTED: chloride channel protein CLC-a-like [Solanum tuberosum]
Length=774

 Score =   345 bits (885),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 185/223 (83%), Positives = 200/223 (90%), Gaps = 2/223 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSV DCFNPSIY+IILELKGLPFL+A+PE WMRNITVGELADVK PVVTL GIEKV RI
Sbjct  554  AKSVADCFNPSIYEIILELKGLPFLEAHPEAWMRNITVGELADVKPPVVTLEGIEKVRRI  613

Query  660  VEVLKNTTYNGFPVVDEERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFSW  481
            VEVLK TT+NGFPVVD   V  ELHG+VLRTHLLLVLKKK+F++ERRRTE+WEV EKF+W
Sbjct  614  VEVLKYTTHNGFPVVDG--VIPELHGLVLRTHLLLVLKKKWFLNERRRTEDWEVEEKFTW  671

Query  480  VDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLI  301
            +DLAERWGKIED+AVT DEMEMYVDLHPL NTTP TV ES+SVAKAMV FRQVGLRHM+I
Sbjct  672  IDLAERWGKIEDIAVTKDEMEMYVDLHPLINTTPHTVVESLSVAKAMVAFRQVGLRHMII  731

Query  300  VPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VPKYQAAGV PVVGILTRQDLRA NIL VFPHLAKSK   KG+
Sbjct  732  VPKYQAAGVFPVVGILTRQDLRACNILNVFPHLAKSKSIKKGN  774



>gb|KDO43321.1| hypothetical protein CISIN_1g0039662mg [Citrus sinensis]
Length=447

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 200/229 (87%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDA+PEPWMR +TVGEL D K PV+TL GIEKV +I
Sbjct  218  AKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQI  277

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+NGFPV+DE          VATELHG++LR HL+L LKKK+F+ E+RRTEEW
Sbjct  278  VDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEW  337

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKFSWV+LAER GKIE+VAVT++EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  338  EVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQ  397

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRH+L+VPKY+AAGVSPVVGILTRQDLRA NIL  FPHL +SK   K
Sbjct  398  VGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHLERSKSGQK  446



>ref|XP_007031847.1| Chloride channel B isoform 1 [Theobroma cacao]
 ref|XP_007031849.1| Chloride channel B isoform 1 [Theobroma cacao]
 gb|EOY02773.1| Chloride channel B isoform 1 [Theobroma cacao]
 gb|EOY02775.1| Chloride channel B isoform 1 [Theobroma cacao]
Length=606

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 198/229 (86%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDANPEPWMRN+TVG+LAD K PVVTLCG+EKV RI
Sbjct  376  AKTVGDSFNPSIYEIILELKGLPFLDANPEPWMRNLTVGDLADAKPPVVTLCGVEKVSRI  435

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FP+VD+  +        ATELHG++LR HL+  LKKK+FM E+RRTEEW
Sbjct  436  VDVLKNTTHNAFPIVDQGVLVPGTISTGATELHGLILRAHLVQALKKKWFMPEKRRTEEW  495

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WVDLAER  KIE VAVT DEMEMY DLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  496  EVREKFNWVDLAERELKIEQVAVTRDEMEMYADLHPLTNTTPYTVVESMSVAKAMVLFRQ  555

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRH+LIVPKYQ AGV+PVVGILTRQDLRA+NIL  FPHLA+ KG  K
Sbjct  556  VGLRHLLIVPKYQGAGVTPVVGILTRQDLRAYNILTAFPHLARCKGEEK  604



>ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF50918.1| chloride channel clc, putative [Ricinus communis]
Length=787

 Score =   338 bits (868),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 202/231 (87%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPFLDANPEPWMRN+TVGELAD K P+VTLCG+EKV RI
Sbjct  557  AKTVGDSFNPSIYEIILHLKGLPFLDANPEPWMRNLTVGELADAKPPLVTLCGVEKVSRI  616

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTTYNGFPVVD+  +        ATELHG++LR HL+  +KKK+F+ E+RRTEEW
Sbjct  617  VDVLKNTTYNGFPVVDDGVIPPVGLATGATELHGLILRAHLVQAIKKKWFLREKRRTEEW  676

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVR+KF+WVDLAER  KIE+VAVT DEMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  677  EVRQKFTWVDLAERELKIEEVAVTRDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  736

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRH+LIVPKY+A+GV PVVGILTRQDLRA+NIL+ FPHLA+SK   K H
Sbjct  737  VGLRHLLIVPKYEASGVPPVVGILTRQDLRAYNILSAFPHLARSKDREKRH  787



>ref|XP_004231786.1| PREDICTED: chloride channel protein CLC-a-like [Solanum lycopersicum]
Length=763

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 197/223 (88%), Gaps = 2/223 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK V DCFNPSIY+++LELKGLPFL+A+PE WMRNI VGEL+DVK+PVVTL GIEKV RI
Sbjct  543  AKIVADCFNPSIYEMVLELKGLPFLEAHPEAWMRNIIVGELSDVKSPVVTLEGIEKVRRI  602

Query  660  VEVLKNTTYNGFPVVDEERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFSW  481
            VEVLK TT+NGFPVVD   V  ELHG+VLRTHLLLVLKKK+F++ERRRTE WEV EKF+W
Sbjct  603  VEVLKYTTHNGFPVVDG--VIPELHGLVLRTHLLLVLKKKWFLNERRRTENWEVEEKFTW  660

Query  480  VDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLI  301
            +DLAERWGKIED+AVT DEMEMYVDLHPL NTTP TV ES+SVAKAMV FRQVGLRHM+I
Sbjct  661  IDLAERWGKIEDIAVTKDEMEMYVDLHPLINTTPHTVVESLSVAKAMVAFRQVGLRHMII  720

Query  300  VPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VPKYQAAGV PVVGILTRQDLRA NIL V PHLAKSK   KG+
Sbjct  721  VPKYQAAGVFPVVGILTRQDLRACNILNVIPHLAKSKSIKKGN  763



>ref|XP_002300101.1| Chloride channel protein CLC-a [Populus trichocarpa]
 gb|EEE84906.1| Chloride channel protein CLC-a [Populus trichocarpa]
Length=785

 Score =   336 bits (861),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 199/231 (86%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD FNPSIY+IIL+LKGLPFLDANPEPWMRN+TV ELAD K PVVTLCG+EKV RI
Sbjct  555  SKTVGDSFNPSIYEIILDLKGLPFLDANPEPWMRNLTVAELADAKPPVVTLCGVEKVSRI  614

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVL+NTT+NGFPVVDE  V        ATELHG++LR HL+ VLKKK+F+ E+RRTEEW
Sbjct  615  VEVLENTTHNGFPVVDEGVVPLMGLATGATELHGLILRAHLVQVLKKKWFLPEKRRTEEW  674

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF WV+LAER G IE+VAVT +EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  675  EVREKFDWVELAERDGTIEEVAVTRNEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  734

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLI+PKYQAAGV PVVGILTRQDLRAHNIL  FPHL  SK   K H
Sbjct  735  VGLRHMLILPKYQAAGVPPVVGILTRQDLRAHNILLAFPHLQGSKSREKKH  785



>ref|XP_011098867.1| PREDICTED: chloride channel protein CLC-a-like [Sesamum indicum]
Length=787

 Score =   336 bits (861),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 199/231 (86%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGDCFNPSIY+IILELKGLPFLDA+PEPWMRNITVGELADVK  VVTL GIEKV  I
Sbjct  557  SKTVGDCFNPSIYEIILELKGLPFLDAHPEPWMRNITVGELADVKPAVVTLNGIEKVRNI  616

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVLKNTT+NGFPVVD            ATELHG++LR HL+L LKKK+F  ERRRTEEW
Sbjct  617  VEVLKNTTHNGFPVVDSGVTPPTGSPNGATELHGLILRAHLILALKKKWFQQERRRTEEW  676

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+ +DLAER   IE+V VT DEMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  677  EVREKFTSIDLAERGATIEEVTVTKDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  736

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLI+PKYQAAGVSPVVGILTRQDL AHNIL+ FPHL +SKG+ KGH
Sbjct  737  VGLRHMLILPKYQAAGVSPVVGILTRQDLIAHNILSAFPHLERSKGNKKGH  787



>gb|KDO43317.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43318.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43319.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43320.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
Length=595

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 200/229 (87%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDA+PEPWMR +TVGEL D K PV+TL GIEKV +I
Sbjct  366  AKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELIDAKPPVITLSGIEKVSQI  425

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+NGFPV+DE          VATELHG++LR HL+L LKKK+F+ E+RRTEEW
Sbjct  426  VDVLRNTTHNGFPVLDEGVVPPSGLANVATELHGLILRAHLVLALKKKWFLQEKRRTEEW  485

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKFSWV+LAER GKIE+VAVT++EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  486  EVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQ  545

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRH+L+VPKY+AAGVSPVVGILTRQDLRA NIL  FPHL +SK   K
Sbjct  546  VGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHLERSKSGQK  594



>ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma cacao]
 gb|EOY02774.1| Chloride channel B isoform 2 [Theobroma cacao]
Length=787

 Score =   335 bits (859),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 198/229 (86%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDANPEPWMRN+TVG+LAD K PVVTLCG+EKV RI
Sbjct  557  AKTVGDSFNPSIYEIILELKGLPFLDANPEPWMRNLTVGDLADAKPPVVTLCGVEKVSRI  616

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FP+VD+  +        ATELHG++LR HL+  LKKK+FM E+RRTEEW
Sbjct  617  VDVLKNTTHNAFPIVDQGVLVPGTISTGATELHGLILRAHLVQALKKKWFMPEKRRTEEW  676

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WVDLAER  KIE VAVT DEMEMY DLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  677  EVREKFNWVDLAERELKIEQVAVTRDEMEMYADLHPLTNTTPYTVVESMSVAKAMVLFRQ  736

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRH+LIVPKYQ AGV+PVVGILTRQDLRA+NIL  FPHLA+ KG  K
Sbjct  737  VGLRHLLIVPKYQGAGVTPVVGILTRQDLRAYNILTAFPHLARCKGEEK  785



>gb|KHG13135.1| Chloride channel CLC-b -like protein [Gossypium arboreum]
Length=717

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 200/227 (88%), Gaps = 8/227 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGDCFNPSIY+IILELKGLPFLDANPEPWMRN+TVGELADVK PVVTLCG+EKV RI
Sbjct  491  AKTVGDCFNPSIYEIILELKGLPFLDANPEPWMRNLTVGELADVKPPVVTLCGVEKVSRI  550

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            ++VL+NTT+N FP+VD+  +        ATELHG++LR HL+  LKKK+F+ E+RRTEEW
Sbjct  551  MDVLRNTTHNAFPIVDQGVLVPGTVATGATELHGLILRAHLVQALKKKWFLPEKRRTEEW  610

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER  KIE VAVT DEMEMYVDLHPLTNTTPFTV ES+SVAKA+VLFRQ
Sbjct  611  EVREKFNWVELAERELKIEQVAVTRDEMEMYVDLHPLTNTTPFTVVESMSVAKALVLFRQ  670

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGS  184
            VGLRH+LIVPKYQ AGV+PVVGILTRQDLRA+NIL+ FPHL + K S
Sbjct  671  VGLRHLLIVPKYQGAGVAPVVGILTRQDLRAYNILSAFPHLERPKLS  717



>ref|XP_006447085.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 gb|ESR60325.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=605

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 199/229 (87%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDA+PEPWMR +TVGEL D K PV+T+ GIEKV RI
Sbjct  376  AKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELVDAKPPVITVSGIEKVSRI  435

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+NGFPV+DE  V        ATELHG++LR HL+L LKKK+F+ E+RRTEEW
Sbjct  436  VDVLRNTTHNGFPVLDEGVVPPSGLANGATELHGLILRAHLVLALKKKWFLQEKRRTEEW  495

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKFSWV+LAER GKIE+VAVT+ EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  496  EVREKFSWVELAEREGKIEEVAVTSAEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQ  555

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRH+L+VPKY+AAGVSPVVGILTRQDLRA NIL  FPHL +SK   K
Sbjct  556  VGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHLERSKSGQK  604



>ref|XP_011003929.1| PREDICTED: chloride channel protein CLC-b [Populus euphratica]
Length=802

 Score =   333 bits (855),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 198/231 (86%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD FNPSIY+IIL+LKGLPFLDANPEPWMRN+TV ELAD K PVVTLC +EKV RI
Sbjct  555  SKTVGDSFNPSIYEIILDLKGLPFLDANPEPWMRNLTVAELADAKPPVVTLCAVEKVSRI  614

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVL+NTT+NGFPVVDE  V        ATELHG++LR HL+ VLKKK+F+ E+RRTEEW
Sbjct  615  VEVLENTTHNGFPVVDEGVVPLMGLATGATELHGLILRAHLVQVLKKKWFLPEKRRTEEW  674

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF WV+LAER G IE+VAVT +EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  675  EVREKFDWVELAERDGTIEEVAVTRNEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  734

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLI+PKYQAAGV PVVGILTRQDLRAHNIL  FPHL  SK   K H
Sbjct  735  VGLRHMLILPKYQAAGVPPVVGILTRQDLRAHNILLAFPHLQGSKNREKKH  785



>gb|KJB76409.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   332 bits (852),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 199/227 (88%), Gaps = 8/227 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGDCFNPSIY+IILELKGLPFLDANPEPWMRN+TVGELADVK PVVTLCG+EKV RI
Sbjct  559  AKTVGDCFNPSIYEIILELKGLPFLDANPEPWMRNLTVGELADVKPPVVTLCGVEKVSRI  618

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FP+VD+           ATELHG++LR HL+  LKKK+F+ E+RRTEEW
Sbjct  619  VDVLRNTTHNAFPIVDQGVPVPGMVATGATELHGLILRAHLVQALKKKWFLPEKRRTEEW  678

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER  KIE VAVT DEMEMYVDLHPLTNTTPFTV ES+SVAKA+VLFRQ
Sbjct  679  EVREKFNWVELAEREIKIEQVAVTRDEMEMYVDLHPLTNTTPFTVVESLSVAKALVLFRQ  738

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGS  184
            VGLRH+LIVPKYQ AGV+PVVGILTRQDLRA+NIL+ FPHL + K S
Sbjct  739  VGLRHLLIVPKYQGAGVTPVVGILTRQDLRAYNILSAFPHLERPKLS  785



>gb|KJB76407.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   332 bits (852),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 199/227 (88%), Gaps = 8/227 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGDCFNPSIY+IILELKGLPFLDANPEPWMRN+TVGELADVK PVVTLCG+EKV RI
Sbjct  559  AKTVGDCFNPSIYEIILELKGLPFLDANPEPWMRNLTVGELADVKPPVVTLCGVEKVSRI  618

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FP+VD+           ATELHG++LR HL+  LKKK+F+ E+RRTEEW
Sbjct  619  VDVLRNTTHNAFPIVDQGVPVPGMVATGATELHGLILRAHLVQALKKKWFLPEKRRTEEW  678

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER  KIE VAVT DEMEMYVDLHPLTNTTPFTV ES+SVAKA+VLFRQ
Sbjct  679  EVREKFNWVELAEREIKIEQVAVTRDEMEMYVDLHPLTNTTPFTVVESLSVAKALVLFRQ  738

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGS  184
            VGLRH+LIVPKYQ AGV+PVVGILTRQDLRA+NIL+ FPHL + K S
Sbjct  739  VGLRHLLIVPKYQGAGVAPVVGILTRQDLRAYNILSAFPHLERPKLS  785



>ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 ref|XP_006470044.1| PREDICTED: chloride channel protein CLC-b-like [Citrus sinensis]
 gb|ESR60324.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=783

 Score =   329 bits (844),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 199/229 (87%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDA+PEPWMR +TVGEL D K PV+T+ GIEKV RI
Sbjct  554  AKTVGDSFNPSIYEIILELKGLPFLDAHPEPWMRTLTVGELVDAKPPVITVSGIEKVSRI  613

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+NGFPV+DE  V        ATELHG++LR HL+L LKKK+F+ E+RRTEEW
Sbjct  614  VDVLRNTTHNGFPVLDEGVVPPSGLANGATELHGLILRAHLVLALKKKWFLQEKRRTEEW  673

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKFSWV+LAER GKIE+VAVT+ EMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  674  EVREKFSWVELAEREGKIEEVAVTSAEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLFRQ  733

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRH+L+VPKY+AAGVSPVVGILTRQDLRA NIL  FPHL +SK   K
Sbjct  734  VGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHLERSKSGQK  782



>ref|XP_008441347.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=789

 Score =   328 bits (840),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 199/230 (87%), Gaps = 9/230 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFLDANPEPWMRNITVGELAD K  VV L G+EKV RI
Sbjct  558  AKTVGDSFNPSIYDIILHLKGLPFLDANPEPWMRNITVGELADAKPAVVILRGLEKVSRI  617

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            VEVL+NTT+NGFPVVD + V         ATELHG+VLR HLL VLKKK+F+ ERRRTEE
Sbjct  618  VEVLRNTTHNGFPVVDADSVVPPVGMAVGATELHGLVLRAHLLQVLKKKWFLRERRRTEE  677

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF+WV+LAER GKIE++ VT +EMEMYVDLHPLTNTTP+TV ES+SVAKA+VLFR
Sbjct  678  WEVREKFTWVELAEREGKIEELVVTKEEMEMYVDLHPLTNTTPYTVMESMSVAKALVLFR  737

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            QVGLRH+LIVPKY+AAGV PV+GILTRQDLR +NIL+ FP LA++KG+ K
Sbjct  738  QVGLRHLLIVPKYEAAGVPPVIGILTRQDLRPYNILSAFPDLARTKGNEK  787



>ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis sativus]
 gb|AFJ15538.1| chloride channel a [Cucumis sativus]
 gb|KGN63173.1| hypothetical protein Csa_2G406710 [Cucumis sativus]
Length=789

 Score =   327 bits (838),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 199/230 (87%), Gaps = 9/230 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFLDANPEPWMRNITVGELAD K  VVTL G+EKV RI
Sbjct  558  AKTVGDSFNPSIYDIILHLKGLPFLDANPEPWMRNITVGELADAKPAVVTLRGLEKVSRI  617

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            VEVL+NTT+NGFPVVD + V         ATELHG+VLR HLL VLKKK+F+ ERRRTE+
Sbjct  618  VEVLRNTTHNGFPVVDADAVVPPVGMAVGATELHGLVLRAHLLQVLKKKWFLRERRRTED  677

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF+WV+LAER GKIE++ VT +EMEMYVDLHPLTNTTP+TV ES+SVAKA+VLFR
Sbjct  678  WEVREKFTWVELAEREGKIEELVVTKEEMEMYVDLHPLTNTTPYTVLESMSVAKALVLFR  737

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            QVGLRH+LIVPKY+AAGV PV+GILTRQDLR +NIL+ FP LA+ KG+ K
Sbjct  738  QVGLRHLLIVPKYEAAGVPPVIGILTRQDLRPYNILSAFPDLARIKGNEK  787



>ref|XP_012070534.1| PREDICTED: chloride channel protein CLC-b [Jatropha curcas]
 gb|KDP46292.1| hypothetical protein JCGZ_10132 [Jatropha curcas]
Length=788

 Score =   325 bits (834),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 198/229 (86%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFLDANPEPWMRN+TVGELAD K PVVTLCG+EKV RI
Sbjct  558  AKTVGDSFNPSIYDIILHLKGLPFLDANPEPWMRNLTVGELADAKPPVVTLCGVEKVSRI  617

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FPVVD+  V        ATELHG++LR HL+ V+KKK+F+HE+RRTEEW
Sbjct  618  VDVLKNTTHNAFPVVDDGVVPPVGLAAGATELHGLILRAHLVQVIKKKWFLHEKRRTEEW  677

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            E REKFSWVDLAER GKIE+V VT  EMEM+VDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  678  EAREKFSWVDLAEREGKIEEVPVTRAEMEMFVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  737

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRH+LIVPKYQAAGV PVVGILTRQDL A+NIL  FPHLA++K   K
Sbjct  738  VGLRHLLIVPKYQAAGVPPVVGILTRQDLMAYNILTAFPHLARTKSREK  786



>ref|XP_010111585.1| Chloride channel protein CLC-b [Morus notabilis]
 gb|EXC31330.1| Chloride channel protein CLC-b [Morus notabilis]
Length=788

 Score =   325 bits (832),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 201/231 (87%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDANPEPWMRN+TV ELAD K PVVTL G+EKV R+
Sbjct  558  AKTVGDSFNPSIYEIILELKGLPFLDANPEPWMRNLTVAELADAKPPVVTLHGVEKVSRV  617

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVLKNTT+NGFPVVD+  V        ATELHG++LRTHL+ VLKKK+F+ E+RRTEEW
Sbjct  618  VEVLKNTTHNGFPVVDDGVVPPVGLPIEATELHGLILRTHLVQVLKKKWFLSEKRRTEEW  677

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+ VDLAER G IE+V VT DEM+MY+DLHPLTNTTP+TV ES+SVAKAMVLFR 
Sbjct  678  EVREKFTSVDLAEREGTIEEVVVTRDEMDMYIDLHPLTNTTPYTVVESMSVAKAMVLFRA  737

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRHMLIVPKY+AAGV P+VGILTRQDLRAHNIL+ FPHLA+SK   KGH
Sbjct  738  VGLRHMLIVPKYEAAGVPPIVGILTRQDLRAHNILSAFPHLARSKSREKGH  788



>gb|KEH22046.1| ClC chloride channel family protein [Medicago truncatula]
Length=796

 Score =   324 bits (831),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 199/229 (87%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGDCFNPSIY+IIL LKGLPF+DANPE WMRN+TVGEL DVK  V++L G+EKV +I
Sbjct  566  AKTVGDCFNPSIYEIILHLKGLPFMDANPESWMRNLTVGELVDVKPAVISLQGVEKVSKI  625

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+NGFPV+D+  V        ATELHG++LR HL+  LKK++F+ ERRRTEEW
Sbjct  626  VDVLKNTTHNGFPVMDDGVVPPVGQVNGATELHGLILRAHLIQALKKRFFLKERRRTEEW  685

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER GKIE+VA+T +EMEM+VDLHPLTNTTPFTV ESISVAKAM+LFRQ
Sbjct  686  EVREKFTWVELAEREGKIEEVAITREEMEMFVDLHPLTNTTPFTVLESISVAKAMILFRQ  745

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRH+L+VPKYQA+GV PV+GILTRQDL A+NIL VFPHLAKSK   K
Sbjct  746  VGLRHLLVVPKYQASGVCPVIGILTRQDLLAYNILTVFPHLAKSKNRQK  794



>ref|XP_008341308.1| PREDICTED: chloride channel protein CLC-b [Malus domestica]
Length=283

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 191/228 (84%), Gaps = 6/228 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPFL+A+PEPWMRN+TVGELAD K PVVTL GIEKV RI
Sbjct  55   AKTVGDSFNPSIYEIILHLKGLPFLEAHPEPWMRNLTVGELADAKXPVVTLRGIEKVDRI  114

Query  660  VEVLKNTTYNGFPVVDEE------RVATELHGVVLRTHLLLVLKKKYFMHerrrteewev  499
            VEVL+NTT+NGFPVV+         V   +HG++LR HLL VLKKK+F+ E+RRTEEW+V
Sbjct  115  VEVLRNTTHNGFPVVEGVVPPMGLAVGATVHGLILRAHLLQVLKKKWFLREKRRTEEWKV  174

Query  498  rEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            REKF+ V+LAER  KIE+VAVT DEMEMYVDLHPLTN TP+TV E +SVAKAMVLFRQVG
Sbjct  175  REKFTSVELAEREWKIEEVAVTKDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQVG  234

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKG  175
            LRH+L+VP Y+A+ V PVVGILTRQDL A+NIL  FPHLAKS G  KG
Sbjct  235  LRHLLVVPNYEASQVPPVVGILTRQDLIAYNILNAFPHLAKSAGREKG  282



>gb|EYU34803.1| hypothetical protein MIMGU_mgv1a001623mg [Erythranthe guttata]
Length=783

 Score =   323 bits (827),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 193/224 (86%), Gaps = 1/224 (0%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGDCFNPSIYD ILELKGLPFLDA+PEPWMRNITVGELAD K+ VVT+ GIEKVGRI
Sbjct  560  AKTVGDCFNPSIYDTILELKGLPFLDAHPEPWMRNITVGELADAKSAVVTIEGIEKVGRI  619

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            V+VL+NTT+NGFPVVD   V   ELHG+VLR HL+L LKKK+F+ ERRRT+  EVRE F+
Sbjct  620  VDVLRNTTHNGFPVVDAGVVPPNELHGLVLRAHLILALKKKWFLRERRRTKAEEVREIFT  679

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
              DLAER GKIEDV V++DEMEM+VDL+PL NTTP++V ES+SVAKAMVLFR+VGLRHML
Sbjct  680  SADLAERGGKIEDVIVSDDEMEMFVDLYPLINTTPYSVIESMSVAKAMVLFREVGLRHML  739

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            I+PKYQA+GV+PVVGILTRQDL AHNIL  FP L KS  S KG 
Sbjct  740  ILPKYQASGVAPVVGILTRQDLIAHNILCAFPQLEKSNASKKGR  783



>gb|KHN24330.1| Chloride channel protein CLC-b [Glycine soja]
Length=773

 Score =   322 bits (824),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 198/230 (86%), Gaps = 9/230 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPF+DANPEPWMRN+TVGEL DVK  VVTL G+EKV +I
Sbjct  542  AKTVGDSFNPSIYEIILHLKGLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGVEKVAKI  601

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VLKNTT+N FPV+D+  V          TELHG++LR HL+  LKKK+F+ ERRRTEE
Sbjct  602  VDVLKNTTHNAFPVMDDGVVPPVVGQANGGTELHGLILRAHLIQALKKKWFLKERRRTEE  661

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF+WV+LAER G IE+VAVT++EMEM+VDLHPLTNTTPFTV ES+SVAKAM+LFR
Sbjct  662  WEVREKFTWVELAEREGSIEEVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILFR  721

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            QVGLRH+L+VPKYQA+GVSPV+GILTRQDL AHNIL VFPHLA SKG  K
Sbjct  722  QVGLRHLLVVPKYQASGVSPVIGILTRQDLLAHNILTVFPHLAISKGREK  771



>gb|KHN10806.1| Chloride channel protein CLC-b [Glycine soja]
Length=774

 Score =   322 bits (824),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 197/230 (86%), Gaps = 9/230 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPF+DANPEPWMRN+TVGEL DVK PVVTL G+EKV +I
Sbjct  543  AKTVGDSFNPSIYEIILHLKGLPFIDANPEPWMRNLTVGELVDVKPPVVTLHGVEKVAKI  602

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VLKNTT+N FPV+D   V          TELHG++LR HL+  +KKK+F+ ERRRTEE
Sbjct  603  VDVLKNTTHNAFPVMDNGVVPPVVGQANGGTELHGLILRAHLIQAIKKKWFLKERRRTEE  662

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF+WV+LAER G IE+VAVT++EMEM+VDLHPLTNTTPFTV ES+SVAKAM LFR
Sbjct  663  WEVREKFTWVELAEREGSIEEVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMTLFR  722

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            QVGLRH+L+VPKYQA+G+SPV+GILTRQDL A NIL VFPHLAKSKG  K
Sbjct  723  QVGLRHLLVVPKYQASGISPVIGILTRQDLLAQNILTVFPHLAKSKGREK  772



>ref|XP_008231135.1| PREDICTED: chloride channel protein CLC-b [Prunus mume]
Length=791

 Score =   322 bits (825),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 199/231 (86%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPFLDA+PEPWMRN+TVGELAD K PVVTL GIEKV RI
Sbjct  561  AKTVGDSFNPSIYEIILHLKGLPFLDAHPEPWMRNLTVGELADAKLPVVTLRGIEKVERI  620

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVL+NTT+NGFPV+D+  V        ATE+HG++LR HL+ VLKKK+F  E+RRTEEW
Sbjct  621  VEVLRNTTHNGFPVIDDGVVPPVGLAVGATEVHGLILRAHLVHVLKKKWFQREKRRTEEW  680

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER GKIE+VAVT++EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  681  EVREKFTWVELAEREGKIEEVAVTSEEMEMYVDLHPLTNTTPYTVMESMSVAKAMVLFRQ  740

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            +GLRH+LIVPKY AAGV PVVGILTRQDL A+NIL  FPHL K+    KG+
Sbjct  741  LGLRHLLIVPKYVAAGVPPVVGILTRQDLIAYNILNAFPHLTKATSREKGN  791



>gb|KHF97413.1| Chloride channel CLC-b -like protein [Gossypium arboreum]
Length=721

 Score =   320 bits (820),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 195/229 (85%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDANPEPWMRN+TVGELA+ K+P VTL G+EKV RI
Sbjct  491  AKTVGDSFNPSIYEIILELKGLPFLDANPEPWMRNLTVGELANAKSPAVTLSGVEKVSRI  550

Query  660  VEVLKNTTYNGFPVVDEE--------RVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FP+VD++          ATELHG++LR HL+  LKKK+F+ E+RRT++W
Sbjct  551  VDVLKNTTHNAFPIVDQDVPVPGTVITGATELHGLILRAHLVQALKKKWFLAEKRRTDDW  610

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EV++KF+WV+L+ER  KIE VAV +DEMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  611  EVQKKFNWVELSERELKIEQVAVAHDEMEMYIDLHPLTNTTPYTVVESMSVAKAMVLFRQ  670

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRHMLIVPKYQ AGV  VVGILTRQDLRA+NIL VFPHLA  K   K
Sbjct  671  VGLRHMLIVPKYQGAGVPAVVGILTRQDLRAYNILTVFPHLATHKVQQK  719



>gb|KHN01525.1| Chloride channel protein CLC-b [Glycine soja]
Length=783

 Score =   322 bits (824),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 194/225 (86%), Gaps = 8/225 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPF+DANPEPWMRN+TVGEL DVK  VV+  G+EKV  I
Sbjct  557  AKTVGDSFNPSIYEIILHLKGLPFMDANPEPWMRNLTVGELVDVKPAVVSFKGVEKVANI  616

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V  LKNTT+NGFPV+D   V        ATELHG++LR HL+ VLKKK+F+ ERRRTEEW
Sbjct  617  VNALKNTTHNGFPVMDCGLVPTTGVANEATELHGIILRAHLIQVLKKKWFLKERRRTEEW  676

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER G IEDVAVT +EMEM+VDLHPLTNTTPFTV ES+SVAKAMVLFRQ
Sbjct  677  EVREKFTWVELAEREGNIEDVAVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKAMVLFRQ  736

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            VGLRHML+VPKYQA+GVSPV+GILTRQDL A+NIL VFPHLAKSK
Sbjct  737  VGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILTVFPHLAKSK  781



>ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Glycine 
max]
Length=780

 Score =   321 bits (823),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 198/230 (86%), Gaps = 9/230 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPF+DANPEPWMRN+TVGEL DVK  VVTL G+EKV +I
Sbjct  549  AKTVGDSFNPSIYEIILHLKGLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGVEKVAKI  608

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VLKNTT+N FPV+D+  V          TELHG++LR HL+  LKKK+F+ ERRRTEE
Sbjct  609  VDVLKNTTHNAFPVMDDGVVPPVVGQANGGTELHGLILRAHLIQALKKKWFLKERRRTEE  668

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF+WV+LAER G IE+VAVT++EMEM+VDLHPLTNTTPFTV ES+SVAKAM+LFR
Sbjct  669  WEVREKFTWVELAEREGSIEEVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILFR  728

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            QVGLRH+L+VPKYQA+GVSPV+GILTRQDL AHNIL VFPHLA SKG  K
Sbjct  729  QVGLRHLLVVPKYQASGVSPVIGILTRQDLLAHNILTVFPHLAISKGREK  778



>ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Glycine 
max]
Length=790

 Score =   322 bits (824),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 198/230 (86%), Gaps = 9/230 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPF+DANPEPWMRN+TVGEL DVK  VVTL G+EKV +I
Sbjct  559  AKTVGDSFNPSIYEIILHLKGLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGVEKVAKI  618

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VLKNTT+N FPV+D+  V          TELHG++LR HL+  LKKK+F+ ERRRTEE
Sbjct  619  VDVLKNTTHNAFPVMDDGVVPPVVGQANGGTELHGLILRAHLIQALKKKWFLKERRRTEE  678

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF+WV+LAER G IE+VAVT++EMEM+VDLHPLTNTTPFTV ES+SVAKAM+LFR
Sbjct  679  WEVREKFTWVELAEREGSIEEVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILFR  738

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            QVGLRH+L+VPKYQA+GVSPV+GILTRQDL AHNIL VFPHLA SKG  K
Sbjct  739  QVGLRHLLVVPKYQASGVSPVIGILTRQDLLAHNILTVFPHLAISKGREK  788



>gb|KJB11653.1| hypothetical protein B456_001G270200 [Gossypium raimondii]
Length=788

 Score =   321 bits (822),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 196/229 (86%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDANPEPWMRN+TVGELA+ K+P VTL G+EKV RI
Sbjct  558  AKTVGDSFNPSIYEIILELKGLPFLDANPEPWMRNLTVGELANAKSPAVTLSGVEKVSRI  617

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FP+VD++ +        ATELHG++LR HL+  LKKK+F+ E+RRTE+W
Sbjct  618  VDVLKNTTHNAFPIVDQDVLVPGTVVTGATELHGLILRAHLVQALKKKWFLAEKRRTEDW  677

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EV+EKF+WV+L+ER  KIE VAVT+DEMEMY+DLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  678  EVQEKFNWVELSERELKIEQVAVTHDEMEMYMDLHPLTNTTPYTVVESMSVAKAMVLFRQ  737

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            VGLRHMLIVPKYQ AGV  VVGILTRQDLRA+NI  VFPHLA  K   K
Sbjct  738  VGLRHMLIVPKYQGAGVPAVVGILTRQDLRAYNISTVFPHLATHKEQQK  786



>ref|XP_010670516.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670517.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
Length=804

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 192/229 (84%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSVGDCFNPSIY+IILELKGLPFLDANPEPWMRNI+VGELADVK P+V+L G+EKV RI
Sbjct  574  AKSVGDCFNPSIYEIILELKGLPFLDANPEPWMRNISVGELADVKPPLVSLRGLEKVSRI  633

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+NGFPV+D++          A ELHG++LR HL+ VLKKK+F+ + R+TEEW
Sbjct  634  VDVLKNTTHNGFPVIDDDVTIPTSDGTKARELHGLILRAHLVAVLKKKWFLEQPRKTEEW  693

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER    E VA++  EMEMYVDLHP TN TP+TV E +S AKAMVLFRQ
Sbjct  694  EVREKFTWVELAERDLDFEQVAISKREMEMYVDLHPFTNKTPYTVVEDMSAAKAMVLFRQ  753

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            V LRH+LIVPKYQ AG+ PV+GILTRQDLRAHNI  VFPH+AKSKG  K
Sbjct  754  VALRHLLIVPKYQGAGIYPVIGILTRQDLRAHNIQTVFPHIAKSKGREK  802



>ref|XP_007217037.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
 gb|EMJ18236.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
Length=791

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 198/231 (86%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPFLDA+PEPWMRN+TVGELAD K PVVTL GIE V RI
Sbjct  561  AKTVGDSFNPSIYEIILHLKGLPFLDAHPEPWMRNLTVGELADAKLPVVTLRGIETVERI  620

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVL+NTT+NGFPV+D+  V        ATE+HG++LR HL+ VLKKK+F  E+RRTEEW
Sbjct  621  VEVLRNTTHNGFPVIDDGVVPPVGLAVGATEVHGLILRAHLVHVLKKKWFQREKRRTEEW  680

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER GKIE+VAVT++EMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  681  EVREKFTWVELAEREGKIEEVAVTSEEMEMYVDLHPLTNTTPYTVMESMSVAKAMVLFRQ  740

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            +GLRH+LIVPKY+AAGV PVVGILTRQDL A+NIL  FPHL K     KG+
Sbjct  741  LGLRHLLIVPKYEAAGVPPVVGILTRQDLIAYNILNAFPHLTKPTSREKGN  791



>ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
 gb|ESW23525.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
Length=782

 Score =   320 bits (820),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 193/225 (86%), Gaps = 8/225 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPF+DANPEPWMRN+TVGEL DVK  V++  G+EKV  I
Sbjct  556  AKTVGDSFNPSIYDIILHLKGLPFMDANPEPWMRNLTVGELVDVKPAVISFKGVEKVANI  615

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V  LKNTT+NGFPV+D   V        ATELHG++LR HL+ VLKKK+F+ E+RRTE+W
Sbjct  616  VNALKNTTHNGFPVMDCGVVPTIGVASEATELHGIILRAHLIQVLKKKWFLKEKRRTEDW  675

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER G IEDVAVT +EMEM+VDLHPLTNTTPFTV ES+SVAKA+VLFRQ
Sbjct  676  EVREKFTWVELAEREGNIEDVAVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKALVLFRQ  735

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            VGLRHML+VPKYQA+GVSPV+GILTRQDL A+NIL VFPHL KSK
Sbjct  736  VGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILTVFPHLTKSK  780



>gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Erythranthe guttata]
Length=788

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 196/232 (84%), Gaps = 9/232 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGDCFNPSIYDIILELKGLPFLDANPEPWMRNIT GELAD K  +VTL G+EKVGRI
Sbjct  557  AKTVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITAGELADAKPAIVTLNGVEKVGRI  616

Query  660  VEVLKNTTYNGFPVVD---------EERVATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            VEVLKNTTYNGFPVVD             A ELHG++LR HLLLVLKKK F+ ERRRT+E
Sbjct  617  VEVLKNTTYNGFPVVDCGVTTSMGSSPNGANELHGLILRAHLLLVLKKKLFLKERRRTQE  676

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEV EKF+ +DLAER   IE+V V+ DEMEMYVDLHPLTNTTP+TV ESISVAKAMVLFR
Sbjct  677  WEVIEKFTCMDLAERGATIEEVTVSKDEMEMYVDLHPLTNTTPYTVVESISVAKAMVLFR  736

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            Q+ LRHMLI+PKYQAAGVSPVVGILTRQDL AHNIL+ FPHL KSK + KGH
Sbjct  737  QLALRHMLILPKYQAAGVSPVVGILTRQDLIAHNILSAFPHLEKSKANKKGH  788



>ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33736.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=791

 Score =   320 bits (819),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 196/231 (85%), Gaps = 10/231 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPF+DANPEPWMRN+TVGEL DVK  VVTL GIEKV +I
Sbjct  559  AKTVGDSFNPSIYEIILHLKGLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGIEKVAKI  618

Query  660  VEVLKNTTYNGFPVVD----------EERVATELHGVVLRTHLLLVLKKKYFMHerrrte  511
            V+VLKNTT+NGFPV+D          +   ATELHG+VLR HL+  LKKK+F  ERRRTE
Sbjct  619  VDVLKNTTHNGFPVMDDGVVVPPVVGQANGATELHGLVLRAHLIQALKKKWFFKERRRTE  678

Query  510  ewevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLF  331
            +WEVR+KF+WV+LAER G IE VAVT++EMEM+VDLHPLTNTTPFTV ES+SVAKAM+LF
Sbjct  679  DWEVRQKFTWVELAEREGSIEGVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILF  738

Query  330  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            RQVGLRH+L+VPKYQA+GVSPV+GILTRQDL AHNI  VFPHLAKSK   K
Sbjct  739  RQVGLRHLLVVPKYQASGVSPVIGILTRQDLLAHNISTVFPHLAKSKSRGK  789



>ref|NP_001236494.1| chloride channel [Glycine max]
 gb|AAY43007.1| chloride channel [Glycine max]
Length=783

 Score =   319 bits (817),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 193/225 (86%), Gaps = 8/225 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPF+DANPEPWMRN+TVGEL DVK  VV+  G+EKV  I
Sbjct  557  AKTVGDSFNPSIYEIILHLKGLPFMDANPEPWMRNLTVGELVDVKPAVVSFKGVEKVANI  616

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V  LKNTT+NGFPV+D   V        ATELHG++LR HL+ V KKK+F+ ERRRTEEW
Sbjct  617  VNALKNTTHNGFPVMDCGLVPTTGVANEATELHGIILRAHLIQVRKKKWFLKERRRTEEW  676

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER G IEDVAVT +EMEM+VDLHPLTNTTPFTV ES+SVAKAMVLFRQ
Sbjct  677  EVREKFTWVELAEREGNIEDVAVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKAMVLFRQ  736

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            VGLRHML+VPKYQA+GVSPV+GILTRQDL A+NIL VFPHLAKSK
Sbjct  737  VGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILTVFPHLAKSK  781



>ref|XP_010556277.1| PREDICTED: chloride channel protein CLC-b [Tarenaya hassleriana]
Length=653

 Score =   316 bits (809),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 195/227 (86%), Gaps = 8/227 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPFLDANPEPWMRN+TVGELAD K PVVTL G+EKV  I
Sbjct  424  AKTVGDSFNPSIYEIILHLKGLPFLDANPEPWMRNLTVGELADAKPPVVTLHGVEKVANI  483

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FPV+D+  V        ATELHG++LR HL+ VLKK++F+ E+RRTE+W
Sbjct  484  VDVLKNTTHNAFPVLDDADVPQVGLADGATELHGLILRAHLIKVLKKRWFLSEKRRTEDW  543

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER    E+VAVT+ +M+MYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  544  EVREKFTWVELAEREDNFEEVAVTSADMQMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  603

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGS  184
            VGLRH+LIVPK QAAG+SPV+GILTRQDLRA+NIL  FPHL KSKG 
Sbjct  604  VGLRHLLIVPKIQAAGMSPVLGILTRQDLRAYNILQAFPHLEKSKGG  650



>ref|XP_010678326.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=655

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 189/229 (83%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSVGDCFNPSIY+IILELKGLPFLDANPEPWMRNITVGELA+VK P+V+L G+EKV  I
Sbjct  425  AKSVGDCFNPSIYEIILELKGLPFLDANPEPWMRNITVGELAEVKPPLVSLRGVEKVAHI  484

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+NGFP++D+  +        A ELHG++LRTHL+  LKKK+F+ + RRTEEW
Sbjct  485  VDVLKNTTHNGFPIIDDGAMIPTSQGTKARELHGLILRTHLVAALKKKWFLEQPRRTEEW  544

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+L ER    E VA++  EMEMYVDLHP TN TP+TV E +SVAKAMVLFRQ
Sbjct  545  EVREKFTWVELTERDLNFEQVAISKHEMEMYVDLHPFTNKTPYTVVEDMSVAKAMVLFRQ  604

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            V LRHMLIVPKY  +G+ P+ GILTRQDLRAHNI  VFPHLA+SKG  K
Sbjct  605  VALRHMLIVPKYHGSGIYPITGILTRQDLRAHNIQNVFPHLARSKGREK  653



>ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-like [Fragaria vesca 
subsp. vesca]
Length=790

 Score =   315 bits (807),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 197/231 (85%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGDCFNPSIY+IIL LKGLPFLDA+PEPWMRN+ VGELAD K PVVTL GIEKV RI
Sbjct  560  SKTVGDCFNPSIYEIILHLKGLPFLDAHPEPWMRNLNVGELADAKPPVVTLRGIEKVERI  619

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVL+NTT+NGFPVVD+  V        ATELHG++LR HL+ VLKKK+F+ ERRRTEEW
Sbjct  620  VEVLRNTTHNGFPVVDDGIVPPVGLAVGATELHGLILRAHLVQVLKKKWFLKERRRTEEW  679

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+ V+LAER  KIE+VAVT+DEMEMYVDLHPLTNTTP TV E++SVAKAMVLFRQ
Sbjct  680  EVREKFTAVELAERELKIEEVAVTSDEMEMYVDLHPLTNTTPHTVLETMSVAKAMVLFRQ  739

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRH+LI+PKY+AAGV PVVGILTRQDL A+NIL  FPHL   K   KG+
Sbjct  740  VGLRHLLILPKYEAAGVPPVVGILTRQDLIAYNILNAFPHLKNPKSREKGN  790



>ref|XP_010678325.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=831

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 189/229 (83%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSVGDCFNPSIY+IILELKGLPFLDANPEPWMRNITVGELA+VK P+V+L G+EKV  I
Sbjct  601  AKSVGDCFNPSIYEIILELKGLPFLDANPEPWMRNITVGELAEVKPPLVSLRGVEKVAHI  660

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+NGFP++D+  +        A ELHG++LRTHL+  LKKK+F+ + RRTEEW
Sbjct  661  VDVLKNTTHNGFPIIDDGAMIPTSQGTKARELHGLILRTHLVAALKKKWFLEQPRRTEEW  720

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+L ER    E VA++  EMEMYVDLHP TN TP+TV E +SVAKAMVLFRQ
Sbjct  721  EVREKFTWVELTERDLNFEQVAISKHEMEMYVDLHPFTNKTPYTVVEDMSVAKAMVLFRQ  780

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            V LRHMLIVPKY  +G+ P+ GILTRQDLRAHNI  VFPHLA+SKG  K
Sbjct  781  VALRHMLIVPKYHGSGIYPITGILTRQDLRAHNIQNVFPHLARSKGREK  829



>ref|XP_009371657.1| PREDICTED: chloride channel protein CLC-b-like [Pyrus x bretschneideri]
Length=787

 Score =   312 bits (799),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 196/231 (85%), Gaps = 8/231 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPFL+A+PE WMRN+TVGELAD K PVVTL GIEKV RI
Sbjct  557  AKTVGDSFNPSIYEIILHLKGLPFLEAHPEQWMRNLTVGELADAKPPVVTLRGIEKVDRI  616

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVL+NTT+NGFPVVDE  V        ATE+HG++LR HLL VLKKK+F+ E+RRTEEW
Sbjct  617  VEVLRNTTHNGFPVVDEGVVPPMGLAVGATEVHGLILRAHLLQVLKKKWFLREKRRTEEW  676

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+ V+LAER GKIE+VAV +DEMEMYVDLHPLTN TP+TV E +SVAKAMVLFRQ
Sbjct  677  EVREKFTSVELAEREGKIEEVAVKSDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQ  736

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRH+L+VP Y+A+ + PVVGILTRQDL A+NIL  FPHLAKS G  KG+
Sbjct  737  VGLRHLLVVPNYEASRLPPVVGILTRQDLIAYNILNAFPHLAKSAGREKGN  787



>ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
 gb|ESQ32763.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
Length=778

 Score =   311 bits (797),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 193/231 (84%), Gaps = 9/231 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFLDANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  549  AKTVGDSFNPSIYDIILHLKGLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVAKI  608

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FPV+DE  V        A ELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  609  VDVLRNTTHNAFPVLDEAEVPQGGLATKAIELHGLILRAHLVKVLKKRWFLTEKRRTEEW  668

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  669  EVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQ  728

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRH+LIVPK QA G+SPVVGILTRQDLRAHNIL  FPHL K+KG  K H
Sbjct  729  VGLRHLLIVPKIQATGMSPVVGILTRQDLRAHNILQAFPHLKKTKGG-KAH  778



>ref|XP_010502678.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 191/226 (85%), Gaps = 8/226 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL+LKGLPFLDANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  514  AKTVGDSFNPSIYDIILDLKGLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKI  573

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FPV+DE  V        ATELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  574  VDVLRNTTHNAFPVLDEAEVPQVGLVTGATELHGLILRAHLVKVLKKRWFLTEKRRTEEW  633

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LAER    +DVA+T+ EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  634  EVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQ  693

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG  187
            VGLRH+LIVPK Q +G+ PVVGILTRQDLRAHNIL  FP L KSKG
Sbjct  694  VGLRHLLIVPKIQTSGLCPVVGILTRQDLRAHNILQAFPQLEKSKG  739



>ref|XP_006290621.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
 gb|EOA23519.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
Length=779

 Score =   309 bits (792),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 192/226 (85%), Gaps = 8/226 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFL+ANPEPWMRN++VGEL D K PVVTL G+E+V +I
Sbjct  550  AKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVERVSKI  609

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FPV+DE  V        ATELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  610  VDVLRNTTHNAFPVLDEAEVPQVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEW  669

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LAER    +DVA+T+ EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  670  EVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQ  729

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG  187
            VGLRH+LIVPK QA+G+ PVVGILTRQDLRAHNIL  FPHL KSKG
Sbjct  730  VGLRHLLIVPKIQASGMCPVVGILTRQDLRAHNILQAFPHLEKSKG  775



>ref|XP_010502677.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   309 bits (791),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 191/226 (85%), Gaps = 8/226 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL+LKGLPFLDANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  550  AKTVGDSFNPSIYDIILDLKGLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKI  609

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FPV+DE  V        ATELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  610  VDVLRNTTHNAFPVLDEAEVPQVGLVTGATELHGLILRAHLVKVLKKRWFLTEKRRTEEW  669

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LAER    +DVA+T+ EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  670  EVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQ  729

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG  187
            VGLRH+LIVPK Q +G+ PVVGILTRQDLRAHNIL  FP L KSKG
Sbjct  730  VGLRHLLIVPKIQTSGLCPVVGILTRQDLRAHNILQAFPQLEKSKG  775



>ref|XP_010425455.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   308 bits (788),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 192/226 (85%), Gaps = 8/226 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL+LKGLPFLDANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  514  AKTVGDSFNPSIYDIILDLKGLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKI  573

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FPV+DE  +        ATELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  574  VDVLRNTTHNAFPVLDEAELPQVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEW  633

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LAER    +DVA+T+ EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  634  EVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQ  693

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG  187
            VGLRH+LIVPK Q++G+ PVVGILTRQDLRAHNIL  FP + KSKG
Sbjct  694  VGLRHLLIVPKIQSSGLCPVVGILTRQDLRAHNILQAFPQMEKSKG  739



>ref|XP_010425454.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 192/226 (85%), Gaps = 8/226 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL+LKGLPFLDANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  550  AKTVGDSFNPSIYDIILDLKGLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKI  609

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FPV+DE  +        ATELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  610  VDVLRNTTHNAFPVLDEAELPQVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEW  669

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LAER    +DVA+T+ EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  670  EVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQ  729

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG  187
            VGLRH+LIVPK Q++G+ PVVGILTRQDLRAHNIL  FP + KSKG
Sbjct  730  VGLRHLLIVPKIQSSGLCPVVGILTRQDLRAHNILQAFPQMEKSKG  775



>gb|KFK33637.1| hypothetical protein AALP_AA5G039600 [Arabis alpina]
Length=778

 Score =   307 bits (786),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 193/231 (84%), Gaps = 9/231 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFLDANPEPWMRN++VGEL D K PVVTL G+E V +I
Sbjct  549  AKTVGDSFNPSIYDIILHLKGLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVETVAKI  608

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FPV+DE  V        A ELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  609  VDVLKNTTHNAFPVLDEAEVPQVGLATGAKELHGLILRAHLVKVLKKRWFLTEKRRTEEW  668

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LAER    +DVA+++ EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  669  EVREKFPWDELAEREDNFDDVAISSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFRQ  728

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            +GLRH+LIVPK QA+G+SPVVGILTRQDLRA+NIL  FPHL KSKG  K H
Sbjct  729  LGLRHLLIVPKIQASGMSPVVGILTRQDLRAYNILQAFPHLEKSKG-RKAH  778



>gb|KEH25445.1| ClC chloride channel family protein [Medicago truncatula]
Length=646

 Score =   303 bits (777),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 193/226 (85%), Gaps = 3/226 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPS+Y++IL LKGLPF+DA+PEPWMRN++VGEL DVK+ VV+  GIEKV  I
Sbjct  421  AKTVGDSFNPSVYEMILHLKGLPFMDADPEPWMRNLSVGELIDVKSSVVSFRGIEKVSNI  480

Query  660  VEVLKNTTYNGFPVVDE--ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ LKNTT+NGFPV+D+  E    +LHGV+LR HL+ VLKKK+F+ E+RRTEEWEVREKF
Sbjct  481  VDALKNTTHNGFPVMDDGDEVEIVKLHGVILRAHLIKVLKKKWFLKEKRRTEEWEVREKF  540

Query  486  SWVDLAERWGKIEDV-AVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRH  310
            SWV+LAER   IEDV  VT +EMEM+VDLHPLTNTTPFTV ES+SVAKA +LFRQVGLRH
Sbjct  541  SWVELAEREENIEDVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRH  600

Query  309  MLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            ML+VPKYQA+GVSPV+GILTRQDL A+NIL VFPHL  SKG  K +
Sbjct  601  MLVVPKYQASGVSPVIGILTRQDLLAYNILPVFPHLENSKGREKSN  646



>ref|XP_010528167.1| PREDICTED: chloride channel protein CLC-b-like [Tarenaya hassleriana]
Length=781

 Score =   306 bits (784),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 188/225 (84%), Gaps = 8/225 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPFLDANPEPWMRN+TVGELAD K  VVTL GIEKV  I
Sbjct  552  AKTVGDSFNPSIYEIILHLKGLPFLDANPEPWMRNLTVGELADAKTSVVTLHGIEKVANI  611

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FPV+D+           ATELHG++LR HL+ VLKK++F+ E+RRTE+W
Sbjct  612  VDVLKNTTHNAFPVLDDADAPQVGLADGATELHGLILRAHLVKVLKKRWFLTEKRRTEDW  671

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER    E+  VT+ EM+MYVDLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  672  EVREKFTWVELAEREDNFEEATVTSSEMQMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQ  731

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            VGLRH+LIVPK QAAG+ PVVGILTRQDLRA+NIL  FPHL K K
Sbjct  732  VGLRHLLIVPKIQAAGMCPVVGILTRQDLRAYNILQAFPHLVKPK  776



>ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana]
 sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; 
AltName: Full=CBS domain-containing protein CBSCLC7 [Arabidopsis 
thaliana]
 emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana]
 dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana]
Length=780

 Score =   306 bits (783),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 190/227 (84%), Gaps = 8/227 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  551  AKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLTVGELGDAKPPVVTLQGVEKVSNI  610

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FPV+DE  V        ATELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  611  VDVLKNTTHNAFPVLDEAEVPQVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEW  670

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LAER    +DVA+T+ EMEMYVDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  671  EVREKFPWDELAEREDNFDDVAITSAEMEMYVDLHPLTNTTPYTVMENMSVAKALVLFRQ  730

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGS  184
            VGLRH+LIVPK QA+G+ PVVGILTRQDLRA+NIL  FP L KSKG 
Sbjct  731  VGLRHLLIVPKIQASGMCPVVGILTRQDLRAYNILQAFPLLEKSKGG  777



>gb|KEH25446.1| ClC chloride channel family protein [Medicago truncatula]
Length=722

 Score =   304 bits (779),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 193/226 (85%), Gaps = 3/226 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPS+Y++IL LKGLPF+DA+PEPWMRN++VGEL DVK+ VV+  GIEKV  I
Sbjct  497  AKTVGDSFNPSVYEMILHLKGLPFMDADPEPWMRNLSVGELIDVKSSVVSFRGIEKVSNI  556

Query  660  VEVLKNTTYNGFPVVDE--ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ LKNTT+NGFPV+D+  E    +LHGV+LR HL+ VLKKK+F+ E+RRTEEWEVREKF
Sbjct  557  VDALKNTTHNGFPVMDDGDEVEIVKLHGVILRAHLIKVLKKKWFLKEKRRTEEWEVREKF  616

Query  486  SWVDLAERWGKIEDV-AVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRH  310
            SWV+LAER   IEDV  VT +EMEM+VDLHPLTNTTPFTV ES+SVAKA +LFRQVGLRH
Sbjct  617  SWVELAEREENIEDVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRH  676

Query  309  MLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            ML+VPKYQA+GVSPV+GILTRQDL A+NIL VFPHL  SKG  K +
Sbjct  677  MLVVPKYQASGVSPVIGILTRQDLLAYNILPVFPHLENSKGREKSN  722



>ref|XP_010514406.1| PREDICTED: chloride channel protein CLC-b [Camelina sativa]
Length=779

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 189/226 (84%), Gaps = 8/226 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFLDANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  550  AKTVGDSFNPSIYDIILHLKGLPFLDANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKI  609

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FPV+DE  V        ATELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  610  VDVLRNTTHNAFPVLDEAEVPQVGLATGATELHGLILRAHLVKVLKKRWFLTEKRRTEEW  669

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LA R    +DVA+T+ EMEM+VDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  670  EVREKFPWDELAGREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLFRQ  729

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG  187
            VGLRH+LIVPK Q +G+ PVVGILTRQDLRAHNIL  FP L KSKG
Sbjct  730  VGLRHLLIVPKIQTSGLCPVVGILTRQDLRAHNILQAFPQLEKSKG  775



>ref|XP_008379124.1| PREDICTED: chloride channel protein CLC-b isoform X2 [Malus domestica]
Length=790

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 193/230 (84%), Gaps = 7/230 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD FNPSIY+IIL LKGLPFL+A+PEPWMRN+TVGELA  K PVVTL GIEKV RI
Sbjct  561  SKTVGDSFNPSIYEIILHLKGLPFLEAHPEPWMRNLTVGELAXAKPPVVTLXGIEKVDRI  620

Query  660  VEVLKNTTYNGFPVVDE-------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewe  502
            VEVL+NTT+NGFPVV+E          AT +HG++LR HL+ VLKKK+F+ E+RRTEEWE
Sbjct  621  VEVLRNTTHNGFPVVEEVVPPMGLAVGATXVHGLILRAHLVQVLKKKWFLREKRRTEEWE  680

Query  501  vrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            VREKF+ V+LAE   KIE+VAVT DEMEMYVDLHPLTN TP+TV E +SVAKAMVLFRQV
Sbjct  681  VREKFTSVELAEXEAKIEEVAVTRDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQV  740

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            GLRH+LIVPKY+A+GV P+VGILTRQDL A+NIL  FPHL KS G  KG+
Sbjct  741  GLRHLLIVPKYEASGVPPLVGILTRQDLIAYNILNAFPHLTKSAGREKGN  790



>gb|AES75065.2| ClC chloride channel family protein [Medicago truncatula]
Length=775

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 193/226 (85%), Gaps = 3/226 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPS+Y++IL LKGLPF+DA+PEPWMRN++VGEL DVK+ VV+  GIEKV  I
Sbjct  550  AKTVGDSFNPSVYEMILHLKGLPFMDADPEPWMRNLSVGELIDVKSSVVSFRGIEKVSNI  609

Query  660  VEVLKNTTYNGFPVVDE--ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ LKNTT+NGFPV+D+  E    +LHGV+LR HL+ VLKKK+F+ E+RRTEEWEVREKF
Sbjct  610  VDALKNTTHNGFPVMDDGDEVEIVKLHGVILRAHLIKVLKKKWFLKEKRRTEEWEVREKF  669

Query  486  SWVDLAERWGKIEDV-AVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRH  310
            SWV+LAER   IEDV  VT +EMEM+VDLHPLTNTTPFTV ES+SVAKA +LFRQVGLRH
Sbjct  670  SWVELAEREENIEDVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRH  729

Query  309  MLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            ML+VPKYQA+GVSPV+GILTRQDL A+NIL VFPHL  SKG  K +
Sbjct  730  MLVVPKYQASGVSPVIGILTRQDLLAYNILPVFPHLENSKGREKSN  775



>ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago truncatula]
Length=780

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 193/226 (85%), Gaps = 3/226 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPS+Y++IL LKGLPF+DA+PEPWMRN++VGEL DVK+ VV+  GIEKV  I
Sbjct  555  AKTVGDSFNPSVYEMILHLKGLPFMDADPEPWMRNLSVGELIDVKSSVVSFRGIEKVSNI  614

Query  660  VEVLKNTTYNGFPVVDE--ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ LKNTT+NGFPV+D+  E    +LHGV+LR HL+ VLKKK+F+ E+RRTEEWEVREKF
Sbjct  615  VDALKNTTHNGFPVMDDGDEVEIVKLHGVILRAHLIKVLKKKWFLKEKRRTEEWEVREKF  674

Query  486  SWVDLAERWGKIEDV-AVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRH  310
            SWV+LAER   IEDV  VT +EMEM+VDLHPLTNTTPFTV ES+SVAKA +LFRQVGLRH
Sbjct  675  SWVELAEREENIEDVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARILFRQVGLRH  734

Query  309  MLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            ML+VPKYQA+GVSPV+GILTRQDL A+NIL VFPHL  SKG  K +
Sbjct  735  MLVVPKYQASGVSPVIGILTRQDLLAYNILPVFPHLENSKGREKSN  780



>ref|XP_009151988.1| PREDICTED: chloride channel protein CLC-b [Brassica rapa]
Length=783

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 193/232 (83%), Gaps = 10/232 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFL+ANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  553  AKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVEKVAKI  612

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VL+NTT+N FPV+DE  V         A ELHG++LR HL+ VLKK++F+ E+RRTEE
Sbjct  613  VDVLRNTTHNAFPVLDEAEVPPQMGLGTGAIELHGLILRAHLVKVLKKRWFLTEKRRTEE  672

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF W +LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFR
Sbjct  673  WEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFR  732

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            QVGLRH+LIVP+ QA+G SPV+GILTRQDLRA+NIL  FPHL KSKG  K H
Sbjct  733  QVGLRHLLIVPRIQASGRSPVIGILTRQDLRAYNILQAFPHLEKSKG-RKAH  783



>emb|CDY28488.1| BnaC02g36720D [Brassica napus]
Length=783

 Score =   304 bits (779),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 190/227 (84%), Gaps = 9/227 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFL+ANPEPWMRN++V +L D K PVVTL G+EKV RI
Sbjct  553  AKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLSVSDLGDAKPPVVTLQGVEKVARI  612

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VLKNTT+N FPV+DE  V         A ELHG++LR HL+ VLKK++F+ E+RRTEE
Sbjct  613  VDVLKNTTHNAFPVLDEAEVVPQAGLATGAIELHGLILRAHLVKVLKKRWFLTEKRRTEE  672

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF W +LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFR
Sbjct  673  WEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFR  732

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG  187
            QVGLRH+LIVPK Q +G+SPVVGILTRQDLRA+NIL  FPHL KSKG
Sbjct  733  QVGLRHLLIVPKIQVSGMSPVVGILTRQDLRAYNILQAFPHLEKSKG  779



>ref|XP_009129444.1| PREDICTED: chloride channel protein CLC-b-like [Brassica rapa]
Length=783

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 193/232 (83%), Gaps = 10/232 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFL+ANPEPWMRN++VG+L D K PVVTL G+EKV RI
Sbjct  553  AKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLSVGDLGDAKPPVVTLQGVEKVARI  612

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VLKNTT+N FPV+DE +V         A ELHG++LR HL+ VLKK++F+ E+RRTEE
Sbjct  613  VDVLKNTTHNAFPVLDEAQVVPQVGLANGAIELHGLILRAHLVKVLKKRWFLTEKRRTEE  672

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF W +LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFR
Sbjct  673  WEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFR  732

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            QVGL H+LIVPK Q +G+SPVVGILTRQDLRA+NIL  FPHL KSKG  K H
Sbjct  733  QVGLWHLLIVPKIQVSGMSPVVGILTRQDLRAYNILQAFPHLEKSKG-RKAH  783



>ref|XP_002875360.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51619.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
Length=779

 Score =   304 bits (778),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 192/231 (83%), Gaps = 9/231 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFL+ANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  550  AKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVEKVSKI  609

Query  660  VEVLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FPV+DE  V        ATELHG++LR HL+ VLKK++F+ E+RRTEEW
Sbjct  610  VDVLKNTTHNAFPVLDEAEVPQVGLPTSATELHGLILRAHLVKVLKKRWFLTEKRRTEEW  669

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF W +LAER    +DVA+ + EMEMYVDLHPLTNTTP+TV E++SVAKA+VLFRQ
Sbjct  670  EVREKFPWDELAEREDNFDDVAIRSAEMEMYVDLHPLTNTTPYTVMENMSVAKALVLFRQ  729

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            VGLRH+LIVPK QA+G+ PVVGILTRQDLRA+NIL  FP L KSKG  K H
Sbjct  730  VGLRHLLIVPKIQASGMCPVVGILTRQDLRAYNILQAFPLLEKSKGG-KAH  779



>emb|CDY13685.1| BnaA06g32380D [Brassica napus]
Length=783

 Score =   303 bits (777),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 193/232 (83%), Gaps = 10/232 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFL+ANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  553  AKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVEKVAKI  612

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VL+NTT+N FPV+DE  V         A ELHG++LR HL+ VLKK++F+ E+RRTEE
Sbjct  613  VDVLRNTTHNAFPVLDEAEVPPQMGLGTGAIELHGLILRAHLVKVLKKRWFLTEKRRTEE  672

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF W +LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFR
Sbjct  673  WEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFR  732

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            QVGLRH+LIVP+ QA+G SPV+GILTRQDLRA+NIL  FPHL K+KG  K H
Sbjct  733  QVGLRHLLIVPRIQASGRSPVIGILTRQDLRAYNILQAFPHLEKTKG-RKAH  783



>emb|CDX83663.1| BnaC07g24030D [Brassica napus]
Length=783

 Score =   303 bits (777),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 192/232 (83%), Gaps = 10/232 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFL+ANPEPWMRN++VGEL D K PVVTL G+EKV +I
Sbjct  553  AKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLSVGELGDAKPPVVTLQGVEKVAKI  612

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VL+NTT+N FPV+DE  V         A ELHG++LR HL+ VLKK++F+ E+RRTEE
Sbjct  613  VDVLRNTTHNAFPVLDEAEVPPQVGLGTGAIELHGLILRAHLVKVLKKRWFLTEKRRTEE  672

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF W +LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFR
Sbjct  673  WEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFR  732

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            QVGLRH+LIVP+ QA+G SPVVGILTRQDLRA NIL  FPHL KSKG  K H
Sbjct  733  QVGLRHLLIVPRIQASGRSPVVGILTRQDLRACNILQAFPHLEKSKG-RKAH  783



>ref|XP_010248967.1| PREDICTED: chloride channel protein CLC-b [Nelumbo nucifera]
Length=781

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/236 (69%), Positives = 191/236 (81%), Gaps = 18/236 (8%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+I+L +KGLPFL+A+PEPWMRN+TVGELAD K  VVTL G+EKV RI
Sbjct  542  AKTVGDYFNPSIYEIMLNMKGLPFLEAHPEPWMRNLTVGELADSKPAVVTLHGVEKVSRI  601

Query  660  VEVLKNTTYNGFPVVDEERV------------------ATELHGVVLRTHLLLVLKKKYF  535
            VEVL+NT +NGFPVVD+E +                   TELHG++LR HLL  L +K+F
Sbjct  602  VEVLRNTKHNGFPVVDQEAIYPFDPVGLRLPAASAGPGTTELHGLILRAHLLAALNEKWF  661

Query  534  MHerrrteewevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESIS  355
            + E RRTEEW+VREKF+   LAER  KIE+VA+T DEMEMYVDLHPLTNTTP+TV ES+S
Sbjct  662  LSEPRRTEEWKVREKFTSAVLAERGRKIEEVAITEDEMEMYVDLHPLTNTTPYTVVESMS  721

Query  354  VAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG  187
            VAKA+VLFRQVGLR MLI+PKY+AAG+SPVVGILTRQDLRA NIL+ F HLAKSKG
Sbjct  722  VAKAIVLFRQVGLRQMLIIPKYRAAGISPVVGILTRQDLRASNILSAFSHLAKSKG  777



>emb|CDY34173.1| BnaA02g28670D [Brassica napus]
Length=780

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 192/232 (83%), Gaps = 13/232 (6%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIYDIIL LKGLPFL+ANPEPWMRN++VG+L D K PVVTL G+EKV RI
Sbjct  553  AKTVGDSFNPSIYDIILHLKGLPFLEANPEPWMRNLSVGDLGDAKPPVVTLQGVEKVARI  612

Query  660  VEVLKNTTYNGFPVVDEERV---------ATELHGVVLRTHLLLVLKKKYFMHerrrtee  508
            V+VLKNTT+N FPV+DE +V         A ELHG++LR HL+ VLKK++F+ E+RRTEE
Sbjct  613  VDVLKNTTHNAFPVLDEAQVVPQVGLANGAIELHGLILRAHLVKVLKKRWFLTEKRRTEE  672

Query  507  wevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            WEVREKF W +LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV E++SVAKA+VLFR
Sbjct  673  WEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLFR  732

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            QVGLRH+LIVPK Q   +SPVVGILTRQDLRA+NIL  FPHL KSKG  K H
Sbjct  733  QVGLRHLLIVPKIQ---MSPVVGILTRQDLRAYNILQAFPHLEKSKG-RKAH  780



>ref|XP_009392485.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392486.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392487.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
Length=798

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 191/232 (82%), Gaps = 9/232 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFL+A+PEPWMRN+TVGELA  K  +V+L GIE+V R+
Sbjct  555  AKTVGDSFNPSIYEIILELKGLPFLEASPEPWMRNLTVGELAAAKPRIVSLRGIERVARV  614

Query  660  VEVLKNTTYNGFPVVDEERVA-----TELHGVVLRTHLLLVLKKKYFMHerrrteewevr  496
            V+VLK+T++NGFPVVD+   +     TELHG+VLR HL+ VL KK+F+ ERRRT EWEVR
Sbjct  615  VDVLKHTSHNGFPVVDQGAPSSPAGTTELHGLVLRAHLVAVLSKKWFLKERRRTAEWEVR  674

Query  495  EKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGL  316
              F+ VDLAE+  K+E V +T +EM+MYVDLHP TNTTP+TV ES+SVAKA+VLFRQVGL
Sbjct  675  AAFTSVDLAEKGQKVEHVKLTEEEMDMYVDLHPFTNTTPYTVVESMSVAKAVVLFRQVGL  734

Query  315  RHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG----SNKGH  172
            RH+L++PKYQ AG+SPVVGILTRQDLRAHNIL  FPHLA  +G    S KG 
Sbjct  735  RHLLVIPKYQGAGISPVVGILTRQDLRAHNILGAFPHLANKRGEEGRSKKGE  786



>ref|XP_010905204.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=784

 Score =   298 bits (763),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 182/224 (81%), Gaps = 10/224 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFL+ANPEPWMRN+TVGELA  K  VV+L GIEKV R+
Sbjct  558  AKTVGDAFNPSIYEIILELKGLPFLEANPEPWMRNLTVGELAAAKPGVVSLRGIEKVARV  617

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVLK+T +NGFPVVD+           ATELHGVVLR+HL+ VL+KK+F+ ERR  E  
Sbjct  618  VEVLKSTKHNGFPVVDQGVPSPVGMPEGATELHGVVLRSHLVAVLRKKWFLQERRTGEWE  677

Query  504  evrEKFSWVDLAERWG-KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
                KF+ VDLA++ G KIE++ +T DEM+MY+DLHP TN TP+TV E++SVAKAMVLFR
Sbjct  678  VRE-KFTSVDLAQKKGPKIEEIVLTEDEMDMYIDLHPFTNATPYTVLETMSVAKAMVLFR  736

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAK  196
            QV LRH+LIVPKYQ AG+SPVVGILTRQDLRAHNIL  FPHL K
Sbjct  737  QVALRHLLIVPKYQGAGISPVVGILTRQDLRAHNILGAFPHLEK  780



>ref|NP_001031990.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 gb|AED94613.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=643

 Score =   293 bits (749),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  420  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  479

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++   TELHG++LR HL+ VLKK++F++E+RRTEEWEVREKF
Sbjct  480  VDVLRNTTHNAFPVLDGADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKF  539

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  540  TPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  599

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  600  LVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  638



>ref|XP_010929772.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=795

 Score =   296 bits (758),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 191/229 (83%), Gaps = 8/229 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+ANPEPWMRN+TVGELA  K  VV+L GIEKV R+
Sbjct  564  AKTVGDAFNPSIYEIILDLKGLPFLEANPEPWMRNLTVGELAAAKPSVVSLGGIEKVVRV  623

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVLK+T +NGFPVVD+           ATELHG+VLR+HL+ VL+KK+F+ ERRRTEEW
Sbjct  624  VEVLKSTKHNGFPVVDQGVPSPIGMPTGATELHGLVLRSHLVAVLRKKWFLKERRRTEEW  683

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVRE+F  VDLA++  KI++V +T DEM+MY+DLHP TNTTP+TV E++SVAKA+VLFRQ
Sbjct  684  EVREQFMSVDLAQKGPKIQEVVLTEDEMDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRQ  743

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
            V LRH+LIVPKYQ AG+SP+VGILTRQDL AHNIL  FPHLAK + S  
Sbjct  744  VALRHLLIVPKYQGAGISPIVGILTRQDLIAHNILGAFPHLAKKEKSES  792



>ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-like [Cicer arietinum]
Length=792

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 185/231 (80%), Gaps = 10/231 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AKSVGDCFNPSIY+IIL LKGLPF+ ANPEPWMRN+TVGEL DVK  V++          
Sbjct  560  AKSVGDCFNPSIYEIILHLKGLPFMGANPEPWMRNLTVGELVDVKPAVISXXXXXXXXXX  619

Query  660  VE--VLKNTTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrte  511
                +LKNTT+NGFPV+D+  +        A ELHG++LR HL+  LKKK+F+ ERRRTE
Sbjct  620  XXXXLLKNTTHNGFPVMDDGIIPPVRHANGAMELHGLILRAHLIQALKKKWFLKERRRTE  679

Query  510  ewevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLF  331
            EWE REKF+WV+LAER G IE+VA+T +EMEM+VDLHPLTNTTPFTV ESISVAKAM+LF
Sbjct  680  EWEAREKFTWVELAEREGNIEEVAITREEMEMFVDLHPLTNTTPFTVLESISVAKAMILF  739

Query  330  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNK  178
             QVGLRH+L+VPKYQA+GV PV+GILTRQDL AHNIL VFPHLAKSK   K
Sbjct  740  HQVGLRHLLVVPKYQASGVCPVIGILTRQDLLAHNILTVFPHLAKSKRRQK  790



>emb|CDY11722.1| BnaC06g13300D [Brassica napus]
Length=770

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 188/217 (87%), Gaps = 2/217 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  551  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELGDAKPPVVTLRGVEKVANI  610

Query  660  VEVLKNTTYNGFPVVDEERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFSW  481
            V+ L+NTT+N FPV+D +  ATELHG++LR HL+ VLKK++F++E+RRTE+WEVREKF+ 
Sbjct  611  VDALRNTTHNAFPVLDGD--ATELHGLILRAHLVKVLKKRWFLNEKRRTEDWEVREKFTP  668

Query  480  VDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLI  301
            V+LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+LI
Sbjct  669  VELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLI  728

Query  300  VPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  729  VPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  765



>gb|ADD09860.1| chloride channel A [Eutrema halophilum]
Length=776

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 189/221 (86%), Gaps = 4/221 (2%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFLDANPEPWMRN+TVGEL D K PV++L G+EKV  I
Sbjct  551  AKTVGDSFNLSIYEIILHLKGLPFLDANPEPWMRNLTVGELGDAKPPVISLHGVEKVANI  610

Query  660  VEVLKNTTYNGFPVVDEERVAT----ELHGVVLRTHLLLVLKKKYFMHerrrteewevrE  493
            V+ L+NTT+N FPV+D E +AT    ELHG++LR HL+ VLKK++F++E+RRTEEWEVRE
Sbjct  611  VDALRNTTHNAFPVLDGEDLATGAATELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVRE  670

Query  492  KFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLR  313
            KF+ V+LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLR
Sbjct  671  KFTPVELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLR  730

Query  312  HMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            H+L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  731  HLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  771



>emb|CDX67478.1| BnaA07g15180D [Brassica napus]
Length=770

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 187/217 (86%), Gaps = 2/217 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  551  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELGDAKPPVVTLSGVEKVANI  610

Query  660  VEVLKNTTYNGFPVVDEERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFSW  481
            V+ L+NTT+N FPV+D +  ATELHG++LR HL+ VLKK++F++E+RRTE+WEVREKF+ 
Sbjct  611  VDALRNTTHNAFPVLDGD--ATELHGLILRAHLVKVLKKRWFLNEKRRTEDWEVREKFTP  668

Query  480  VDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLI  301
            V+LAER    +DV +T+ EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+LI
Sbjct  669  VELAEREDNFDDVGITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLI  728

Query  300  VPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  729  VPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  765



>gb|AAB17007.1| voltage-gated chloride channel [Arabidopsis thaliana]
Length=773

 Score =   293 bits (749),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  550  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  609

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++   TELHG++LR HL+ VLKK++F++E+RRTEEWEVREKF
Sbjct  610  VDVLRNTTHNAFPVLDGADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKF  669

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  670  TPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  729

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  730  LVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  768



>emb|CAA96057.1| CLC-a chloride channel protein [Arabidopsis thaliana]
Length=775

 Score =   293 bits (749),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  552  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  611

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++   TELHG++LR HL+ VLKK++F++E+RRTEEWEVREKF
Sbjct  612  VDVLRNTTHNAFPVLDGADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKF  671

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  672  TPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  731

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  732  LVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  770



>ref|NP_198905.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 sp|P92941.2|CLCA_ARATH RecName: Full=Chloride channel protein CLC-a; Short=AtCLC-a; 
AltName: Full=CBS domain-containing protein CBSCLC5 [Arabidopsis 
thaliana]
 gb|AAC05742.1| anion channel protein [Arabidopsis thaliana]
 dbj|BAB11351.1| anion channel protein [Arabidopsis thaliana]
 gb|AAN13022.1| anion channel protein [Arabidopsis thaliana]
 gb|AED94612.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=775

 Score =   293 bits (749),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  552  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  611

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++   TELHG++LR HL+ VLKK++F++E+RRTEEWEVREKF
Sbjct  612  VDVLRNTTHNAFPVLDGADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKF  671

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  672  TPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  731

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  732  LVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  770



>gb|AAL24139.1| putative anion channel protein [Arabidopsis thaliana]
Length=775

 Score =   293 bits (749),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  552  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  611

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++   TELHG++LR HL+ VLKK++F++E+RRTEEWEVREKF
Sbjct  612  VDVLRNTTHNAFPVLDGADQNTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKF  671

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  672  TPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  731

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  732  LVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  770



>ref|XP_009125164.1| PREDICTED: chloride channel protein CLC-a-like [Brassica rapa]
Length=770

 Score =   292 bits (748),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 187/217 (86%), Gaps = 2/217 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  551  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELGDAKPPVVTLRGVEKVANI  610

Query  660  VEVLKNTTYNGFPVVDEERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFSW  481
            V+ L+NTT+N FPV+D +  ATELHG++LR HL+ VLKK++F++E+RRTE+WEVREKF+ 
Sbjct  611  VDALRNTTHNAFPVLDGD--ATELHGLILRAHLVKVLKKRWFLNEKRRTEDWEVREKFTP  668

Query  480  VDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLI  301
            V+LAER    +DV +T+ EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+LI
Sbjct  669  VELAEREDNFDDVGITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHLLI  728

Query  300  VPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  729  VPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  765



>ref|XP_008806046.1| PREDICTED: chloride channel protein CLC-a-like [Phoenix dactylifera]
Length=792

 Score =   293 bits (749),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 188/224 (84%), Gaps = 9/224 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFL+ANPEPWMRN+TVGELA  K  VV L GIEKV  +
Sbjct  565  AKTVGDAFNPSIYEIILELKGLPFLEANPEPWMRNLTVGELAAAKPSVVNLRGIEKVSHV  624

Query  660  VEVLKNTTYNGFPVVDEE--------RVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVLK+T +NGFPVVD+           A ELHG+VLR+HL+ VL+KK+F+ ERRRTEEW
Sbjct  625  VEVLKSTKHNGFPVVDQGVASPIGMPEGAVELHGLVLRSHLIAVLRKKWFLKERRRTEEW  684

Query  504  evrEKFSWVDLAERWG-KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFR  328
            EVREKF+ VDLA + G K+E++ +T DEM+MY+DLHP TNTTP+TV E++SVAKA+VLFR
Sbjct  685  EVREKFTSVDLARKKGPKLEEMVLTEDEMDMYIDLHPFTNTTPYTVVETMSVAKAVVLFR  744

Query  327  QVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAK  196
            QV LRH+LI+PKYQ AG+SPVVGILTRQDLRAHNIL  FPHLA+
Sbjct  745  QVALRHLLIIPKYQGAGISPVVGILTRQDLRAHNILGAFPHLAE  788



>ref|XP_002868624.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44883.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  553  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  612

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++   TELHG++LR HL+ VLKK++F++E+RRTEEWEVREKF
Sbjct  613  VDVLRNTTHNAFPVLDGTDQTTGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKF  672

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  673  TPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  732

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  733  LVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  771



>ref|XP_009140242.1| PREDICTED: chloride channel protein CLC-a [Brassica rapa]
Length=776

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 188/221 (85%), Gaps = 4/221 (2%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PV+TL G+EKV  I
Sbjct  551  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELVDAKPPVITLRGVEKVANI  610

Query  660  VEVLKNTTYNGFPVVDEERV----ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrE  493
            V+ L+NTT+N FPV+D E V     TELHG++LR HL+ VLKK++F++E+RRTEEWEVRE
Sbjct  611  VDALRNTTHNAFPVLDGEDVDNGAGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVRE  670

Query  492  KFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLR  313
            KF+ V+LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLR
Sbjct  671  KFTPVELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLR  730

Query  312  HMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            H+L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  731  HLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  771



>ref|XP_006405416.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
 gb|ESQ46869.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
Length=776

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 189/221 (86%), Gaps = 4/221 (2%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PV++L G+EKV  I
Sbjct  551  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELGDAKPPVISLHGVEKVANI  610

Query  660  VEVLKNTTYNGFPVVDEERVAT----ELHGVVLRTHLLLVLKKKYFMHerrrteewevrE  493
            V+ L+NTT+N FPV+D E +AT    ELHG++LR HL+ VLKK++F++E+RRTEEWEVRE
Sbjct  611  VDALRNTTHNAFPVLDGEDLATGAATELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVRE  670

Query  492  KFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLR  313
            KF+ V+LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLR
Sbjct  671  KFTPVELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLR  730

Query  312  HMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            H+L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  731  HLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  771



>ref|XP_010450591.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 188/219 (86%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  552  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  611

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++    ELHG++LR HL+ VLKK++F++E+RRTEEWEVREKF
Sbjct  612  VDVLRNTTHNAFPVLDGADQATGAELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKF  671

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  672  TAVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  731

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LIVPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  732  LIVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  770



>ref|XP_010441254.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 188/219 (86%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  552  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  611

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++    ELHG++LR HL+ VLKK++F++E+RRTEEWEVREKF
Sbjct  612  VDVLRNTTHNAFPVLDGADQATGAELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKF  671

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  672  TAVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  731

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LIVPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  732  LIVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  770



>ref|XP_006285462.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
 gb|EOA18360.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
Length=777

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 188/219 (86%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  554  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  613

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++   TELHG++LR HL+ VLKK++F+ E+RRTEEWEVREKF
Sbjct  614  VDVLRNTTHNAFPVLDGADQATGTELHGLILRAHLVKVLKKRWFLDEKRRTEEWEVREKF  673

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  674  TPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  733

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  734  LVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  772



>ref|XP_010436030.1| PREDICTED: chloride channel protein CLC-a-like [Camelina sativa]
Length=775

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 187/219 (85%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  552  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELNDAKPPVVTLNGVEKVANI  611

Query  660  VEVLKNTTYNGFPVVD--EERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+NTT+N FPV+D  ++    ELHG++LR HL+ VLKK++F++E+RRTEEWEVREKF
Sbjct  612  VDVLRNTTHNAFPVLDGADQATGAELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVREKF  671

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            + V+LAER    +DVA+T+ EM+ YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLRH+
Sbjct  672  TAVELAEREDNFDDVAITSSEMQFYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLRHL  731

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LIVPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  732  LIVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  770



>gb|KJB76408.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=818

 Score =   292 bits (747),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 188/232 (81%), Gaps = 16/232 (7%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGDCFNPSIY+IILELKGLPFLDANPEPWMRN+TVGELADVK PVVTLCG+EKV RI
Sbjct  559  AKTVGDCFNPSIYEIILELKGLPFLDANPEPWMRNLTVGELADVKPPVVTLCGVEKVSRI  618

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VL+NTT+N FP+VD+           ATELHG++LR HL+  LKKK+F+ E+RRTEEW
Sbjct  619  VDVLRNTTHNAFPIVDQGVPVPGMVATGATELHGLILRAHLVQALKKKWFLPEKRRTEEW  678

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WV+LAER  KIE VAVT DEMEMYVDLHPLTNTTPFTV ES+SVAKA+VLFRQ
Sbjct  679  EVREKFNWVELAEREIKIEQVAVTRDEMEMYVDLHPLTNTTPFTVVESLSVAKALVLFRQ  738

Query  324  VGLRHMLIVPKYQAAGVSPVVGILT-RQDLRAHNILAVFPHLA---KSKGSN  181
            VGLRH+LIVPKYQ AGVS    +LT    L  H   ++F HL     S GS+
Sbjct  739  VGLRHLLIVPKYQGAGVS----LLTINTSLLFHAYSSIFVHLTYKVASAGSS  786



>emb|CDY15925.1| BnaA04g11860D [Brassica napus]
Length=776

 Score =   290 bits (743),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 187/219 (85%), Gaps = 4/219 (2%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PV+TL G+EKV  I
Sbjct  551  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELVDAKPPVITLRGVEKVANI  610

Query  660  VEVLKNTTYNGFPVVDEERV----ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrE  493
            V+ L+NTT+N FPV+D E V     TELHG++LR HL+ VLKK++F++E+RRTEEWEVRE
Sbjct  611  VDALRNTTHNAFPVLDGEDVDNGAGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVRE  670

Query  492  KFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLR  313
            KF+ V+LAER    +DVA+T+ EM+MYVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLR
Sbjct  671  KFTPVELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLR  730

Query  312  HMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAK  196
            H+L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K
Sbjct  731  HLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDK  769



>ref|XP_008788897.1| PREDICTED: chloride channel protein CLC-b-like [Phoenix dactylifera]
Length=785

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 185/223 (83%), Gaps = 8/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+ANPEPWMRN+TVGELA  K  V +L GIEKV R+
Sbjct  559  AKTVGDAFNPSIYEIILDLKGLPFLEANPEPWMRNLTVGELAAAKPSVASLRGIEKVARV  618

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            VEVLK+T +NGFPVVD+           ATE HG+VLR+HL+ VL+KK+F+ ERRRTEEW
Sbjct  619  VEVLKSTKHNGFPVVDQGVPSPIGMPTGATEFHGLVLRSHLVAVLRKKWFVKERRRTEEW  678

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVRE F+ VDL ++  KI++V +T DEM+MY+DLHP  NTTP+TV E++SVAKA+VLFRQ
Sbjct  679  EVRESFTSVDLTQKGPKIQEVVLTEDEMDMYIDLHPFANTTPYTVVETMSVAKAVVLFRQ  738

Query  324  VGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAK  196
            V LRH+LIVPKYQ AG+ P+VGILTRQDL+AHNIL  FPHLAK
Sbjct  739  VALRHLLIVPKYQGAGIPPIVGILTRQDLKAHNILGAFPHLAK  781



>gb|KFK33054.1| hypothetical protein AALP_AA6G324100 [Arabis alpina]
Length=776

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 186/221 (84%), Gaps = 4/221 (2%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PVVTL G+EKV  I
Sbjct  551  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELGDAKPPVVTLQGVEKVANI  610

Query  660  VEVLKNTTYNGFPVVDEER----VATELHGVVLRTHLLLVLKKKYFMHerrrteewevrE  493
            V+ L+NTT+N FPV+D         TELHG++LR HL+ VLKK++F++E+RRTEEWEVRE
Sbjct  611  VDALRNTTHNAFPVLDGSDSVTGAGTELHGLILRAHLVKVLKKRWFLNEKRRTEEWEVRE  670

Query  492  KFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLR  313
            KF+ V+LAER    ++VA+T+ EM++YVDLHPLTNTTP+TV +S+SVAKA+VLFR VGLR
Sbjct  671  KFTPVELAEREDNFDEVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLR  730

Query  312  HMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            H+L+VPK QA+G+SPV+GILTRQDLRA+NIL  FPHL K K
Sbjct  731  HLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHLDKHK  771



>emb|CDX99630.1| BnaC04g33870D [Brassica napus]
Length=776

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 187/221 (85%), Gaps = 4/221 (2%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FN SIY+IIL LKGLPFL+ANPEPWMRN+TVGEL D K PV+TL G+EKV  I
Sbjct  551  AKTVGDSFNLSIYEIILHLKGLPFLEANPEPWMRNLTVGELVDAKPPVITLRGVEKVANI  610

Query  660  VEVLKNTTYNGFPVVDEERV----ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrE  493
            V+ L+NTT+N FPV+D E V     TELHG++LR H++ VLKK++F++E+RRTEEWEVRE
Sbjct  611  VDALRNTTHNAFPVLDGEDVDTGAGTELHGLILRAHIVKVLKKRWFLNEKRRTEEWEVRE  670

Query  492  KFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLR  313
            KF+ V+LAER    +DVA+T+ EM+M+VDLHPLTNTTP+TV +S+SVAKA+VLFR VGLR
Sbjct  671  KFTPVELAEREDNFDDVAITSSEMQMWVDLHPLTNTTPYTVVQSMSVAKALVLFRSVGLR  730

Query  312  HMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            H+L+VPK QA+G+SPV+GILTRQDLRA+NIL  FP L K K
Sbjct  731  HLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPRLDKHK  771



>emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera]
Length=753

 Score =   282 bits (721),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 183/225 (81%), Gaps = 12/225 (5%)
 Frame = -3

Query  810  SIYDIILEL-KGLPFLDAN---PEPWMRNITVGELADVKAPVVTLCGIEKVGRIVEVLKN  643
            S+  I LEL   L F   N   P    +N+TVGELAD K PVVTL G+EKV RIV+VL+N
Sbjct  529  SLCVIFLELTNNLLFTTHNNDCPPNSQKNLTVGELADAKPPVVTLRGVEKVARIVDVLRN  588

Query  642  TTYNGFPVVDEERV--------ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            TT+NGFPVVDE  V        ATELHG+VLR HL+ VLKKK+F+ ERRRTEEWEVREKF
Sbjct  589  TTHNGFPVVDEGVVPRVGLAIGATELHGIVLRAHLVKVLKKKWFLQERRRTEEWEVREKF  648

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            +W++LAER GK E+VAVTNDEMEMYVDLHPLTNTTP+TV ES+SVAKAMVLFRQVGLRHM
Sbjct  649  TWIELAEREGKFEEVAVTNDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLFRQVGLRHM  708

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            LIVPKYQAAGVSPVVGILTRQDLRA+NIL  FPHLAKSK   KG+
Sbjct  709  LIVPKYQAAGVSPVVGILTRQDLRAYNILTAFPHLAKSKEREKGN  753



>ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theobroma cacao]
 gb|EOY02776.1| Chloride channel B isoform 4, partial [Theobroma cacao]
Length=799

 Score =   283 bits (723),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 169/196 (86%), Gaps = 8/196 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IILELKGLPFLDANPEPWMRN+TVG+LAD K PVVTLCG+EKV RI
Sbjct  555  AKTVGDSFNPSIYEIILELKGLPFLDANPEPWMRNLTVGDLADAKPPVVTLCGVEKVSRI  614

Query  660  VEVLKNTTYNGFPVVDE--------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteew  505
            V+VLKNTT+N FP+VD+           ATELHG++LR HL+  LKKK+FM E+RRTEEW
Sbjct  615  VDVLKNTTHNAFPIVDQGVLVPGTISTGATELHGLILRAHLVQALKKKWFMPEKRRTEEW  674

Query  504  evrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQ  325
            EVREKF+WVDLAER  KIE VAVT DEMEMY DLHPLTNTTP+TV ES+SVAKAMVLFRQ
Sbjct  675  EVREKFNWVDLAERELKIEQVAVTRDEMEMYADLHPLTNTTPYTVVESMSVAKAMVLFRQ  734

Query  324  VGLRHMLIVPKYQAAG  277
            VGLRH+LIVPKYQ AG
Sbjct  735  VGLRHLLIVPKYQGAG  750



>gb|EMT27070.1| Chloride channel protein CLC-b [Aegilops tauschii]
Length=537

 Score =   274 bits (700),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PEPWM+++TVGELA  KA  ++L  +EKV  +
Sbjct  317  AKTVGDAFNPSIYEIILDLKGLPFLEPKPEPWMKDLTVGELAAAKARTISLQVVEKVSTV  376

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            +EVL+NT +NGFPVVD  R   +ELHG+VLR+HL+ VL+K++F+ E+RRTEEWE RE+FS
Sbjct  377  LEVLRNTGHNGFPVVDRPRPGLSELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFS  436

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
             V+LA++  KI+D+ +T +E+EMYVDLHP TNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  437  SVELADKNCKIDDLELTPEELEMYVDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHML  496

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAK  196
            I+PKYQ   +SP+VGILTRQDLRAHNIL  FPHL+K
Sbjct  497  IMPKYQGPEISPLVGILTRQDLRAHNILGAFPHLSK  532



>gb|EMT23598.1| hypothetical protein F775_52599 [Aegilops tauschii]
Length=664

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PEPWM+++TVGELA  K   ++L  +EKV  +
Sbjct  444  AKTVGDAFNPSIYEIILDLKGLPFLEPKPEPWMKDLTVGELAAAKPRTISLQVVEKVSTV  503

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            +EVLKNT +NGFPVVD  R   +ELHG+VLR+HL+ VL+K++F+ E+RRTEEWE RE+FS
Sbjct  504  LEVLKNTGHNGFPVVDRPRPGLSELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFS  563

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
             V+LA++  KI+D+ +T +E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  564  SVELADKNCKIDDLELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHML  623

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAK  196
            I+PKYQ   +SP+VGILTRQDLRAHNIL  FPHLAK
Sbjct  624  IMPKYQGPEISPLVGILTRQDLRAHNILGAFPHLAK  659



>dbj|BAJ88201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   272 bits (696),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PEPWM+++TVGELA  K   + L  +EKV  I
Sbjct  567  AKTVGDAFNPSIYEIILDLKGLPFLEPKPEPWMKDLTVGELAAAKPRTINLQVVEKVSTI  626

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            ++VL+NT +NGFPVVD  R   +ELHG+VLR+HL+ VL+K++F+ E+RRTEEWE RE+FS
Sbjct  627  IQVLRNTGHNGFPVVDRPRPGLSELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFS  686

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
             V+LA++  KI+D+ +T +E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  687  SVELADKNCKIDDIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHML  746

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLA-KSK  190
            I+PKYQ   +SP+VGILTRQDLRAHNIL  FPHLA KSK
Sbjct  747  IMPKYQGPEISPIVGILTRQDLRAHNILGAFPHLANKSK  785



>dbj|BAJ92499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   272 bits (696),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PEPWM+++TVGELA  K   + L  +EKV  I
Sbjct  567  AKTVGDAFNPSIYEIILDLKGLPFLEPKPEPWMKDLTVGELAAAKPRTINLQVVEKVSTI  626

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            ++VL+NT +NGFPVVD  R   +ELHG+VLR+HL+ VL+K++F+ E+RRTEEWE RE+FS
Sbjct  627  IQVLRNTGHNGFPVVDRPRPGLSELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFS  686

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
             V+LA++  KI+D+ +T +E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  687  SVELADKNCKIDDIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHML  746

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLA-KSK  190
            I+PKYQ   +SP+VGILTRQDLRAHNIL  FPHLA KSK
Sbjct  747  IMPKYQGPEISPIVGILTRQDLRAHNILGAFPHLANKSK  785



>dbj|BAJ96369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   272 bits (696),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PEPWM+++TVGELA  K   + L  +EKV  I
Sbjct  567  AKTVGDAFNPSIYEIILDLKGLPFLEPKPEPWMKDLTVGELAAAKPRTINLQVVEKVSTI  626

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            ++VL+NT +NGFPVVD  R   +ELHG+VLR+HL+ VL+K++F+ E+RRTEEWE RE+FS
Sbjct  627  IQVLRNTGHNGFPVVDRPRPGLSELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFS  686

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
             V+LA++  KI+D+ +T +E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  687  SVELADKNCKIDDIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHML  746

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLA-KSK  190
            I+PKYQ   +SP+VGILTRQDLRAHNIL  FPHLA KSK
Sbjct  747  IMPKYQGPEISPIVGILTRQDLRAHNILGAFPHLANKSK  785



>dbj|BAJ91019.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 183/219 (84%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PEPWM+++TVGELA  K   ++L  IEKV  +
Sbjct  562  AKTVGDAFNPSIYEIILDLKGLPFLEPKPEPWMKDLTVGELAAAKPRTISLQVIEKVSNV  621

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            +EVL++T +NGFPVVD  R   +ELHG+VLR+HL+ VL+K++F+ E+RRTEEWE RE+FS
Sbjct  622  LEVLRSTGHNGFPVVDRPRPGLSELHGLVLRSHLVAVLRKRWFLAEKRRTEEWEARERFS  681

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
             V+LA++  KI+D+ +T +E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  682  SVELADKNCKIDDIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHML  741

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLA-KSK  190
            I+PKYQ   +SP+VGILTRQDLRAHNIL  FPHLA KSK
Sbjct  742  IMPKYQGPEISPIVGILTRQDLRAHNILGAFPHLANKSK  780



>ref|XP_006664534.1| PREDICTED: chloride channel protein CLC-a-like [Oryza brachyantha]
Length=784

 Score =   265 bits (676),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 178/218 (82%), Gaps = 1/218 (0%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+A PEPWM+++TVGELA  K   VTL  +E+V  +
Sbjct  564  AKTVGDAFNPSIYEIILDLKGLPFLEAKPEPWMKDLTVGELAAAKPRAVTLQVLERVSTV  623

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            VE L++T +NGFPV+D  R   +ELHG+VLR+HL+ VLKK++F+ ERRRTEEWE RE+F+
Sbjct  624  VEALRSTRHNGFPVLDRPRPGVSELHGLVLRSHLVAVLKKRWFLPERRRTEEWEARERFT  683

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
              +LA++ G ++ +  + +EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  684  SAELADKAGDVDGLDFSPEEMAMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHML  743

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            I+PK+Q   +SP+VGILTRQDLRAHNIL  FPHLA  +
Sbjct  744  IMPKFQGPEISPIVGILTRQDLRAHNILGAFPHLANKR  781



>ref|XP_003576525.1| PREDICTED: chloride channel protein CLC-a-like [Brachypodium 
distachyon]
Length=790

 Score =   264 bits (675),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 179/219 (82%), Gaps = 2/219 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PEPWM+++TVGELA  K   V+L  +E+V  I
Sbjct  569  AKTVGDAFNPSIYEIILDLKGLPFLEPKPEPWMKDLTVGELAAAKPRTVSLQVVERVSTI  628

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            VEVL+ T +NGFPVV   R   +ELHG+VLR+HL+ VL+K++F+ E+RRTE+WE RE+FS
Sbjct  629  VEVLRGTGHNGFPVVGRPRPGLSELHGLVLRSHLVAVLRKRWFLTEQRRTEDWEARERFS  688

Query  483  WVDLAERWGKIEDVA-VTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
             V+LA++  K+ED+  +T +EMEM+VDLHP TNTTP+TV E++SVAKA+VLFR V LRHM
Sbjct  689  SVELADKSAKLEDLQEITPEEMEMFVDLHPFTNTTPYTVVETMSVAKAVVLFRAVALRHM  748

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LI+PK+Q   +SP+VGILTRQDLRAHNIL  FPHLA  +
Sbjct  749  LIMPKFQGPEISPIVGILTRQDLRAHNILGAFPHLANKR  787



>ref|XP_002438781.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
 gb|EER90148.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
Length=801

 Score =   264 bits (675),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 179/220 (81%), Gaps = 3/220 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PE WM+++ VGELA  K  VVTL  IEKV  +
Sbjct  579  AKTVGDAFNPSIYEIILDLKGLPFLEPKPETWMKDLAVGELAAAKPRVVTLQVIEKVSTV  638

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            VEVL++T +NGFPV+D  R   +ELHG+VLR+HL+ VLKK++F+ E+RRTEEWE RE+FS
Sbjct  639  VEVLRSTPHNGFPVLDRPRPGVSELHGLVLRSHLMAVLKKRWFLTEKRRTEEWEARERFS  698

Query  483  WVDLAERWGKIEDVAV--TNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRH  310
              +LAE+ G I++VAV  T +E++MY+DLHP TNTTP+TV E++SVAKA+VLFR   LRH
Sbjct  699  STELAEKSGSIDEVAVQLTPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRH  758

Query  309  MLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            MLI+PK+Q   ++P+VGILTRQDLRAHNIL  FPHLA  +
Sbjct  759  MLIIPKFQGPEIAPIVGILTRQDLRAHNILGAFPHLANKR  798



>ref|XP_004962545.1| PREDICTED: chloride channel protein CLC-a-like isoform X2 [Setaria 
italica]
Length=794

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 175/218 (80%), Gaps = 1/218 (0%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PE WM+++TVGELA  K   VTL  +EKV  I
Sbjct  574  AKTVGDAFNPSIYEIILDLKGLPFLEPKPETWMKDLTVGELAAAKPRAVTLQVVEKVSTI  633

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            V VL+ T +NGFPV+D  R   +ELHG+VLR HL+ VL+K++F+ E+RRTEEWE RE+FS
Sbjct  634  VAVLRATPHNGFPVLDRPRPGVSELHGLVLRQHLMAVLRKRWFLQEKRRTEEWEARERFS  693

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
              +LAE+ G I+DV ++ +E++MY+DLHP TNTTP+TV E++SVAKA+VLFR   LRHML
Sbjct  694  STELAEKAGSIDDVQLSPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHML  753

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            I+PK+Q   +SP++GILTRQDLRAHNIL  FPHLA  +
Sbjct  754  IIPKFQGLEISPIMGILTRQDLRAHNILGAFPHLANKR  791



>ref|XP_008658999.1| PREDICTED: chloride channel protein isoform X1 [Zea mays]
 gb|AFW87643.1| chloride channel protein [Zea mays]
Length=801

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 179/220 (81%), Gaps = 3/220 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PE WM+++ VGELA  K  VVTL  IEKV  +
Sbjct  579  AKTVGDAFNPSIYEIILDLKGLPFLEPKPETWMKDLAVGELAAAKPRVVTLQVIEKVSTV  638

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            VEVL++T +NGFPV+D  R   +ELHG+VLR+HL+ VLKK++F+ ++RRTEEWE RE+FS
Sbjct  639  VEVLRSTPHNGFPVLDWPRPGVSELHGLVLRSHLMAVLKKRWFLTDKRRTEEWEARERFS  698

Query  483  WVDLAERWGKIEDVAV--TNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRH  310
              +LAE+ G I++VAV  T +E++MY+DLHP TNTTP+TV E++SVAKA+VLFR   LRH
Sbjct  699  STELAEKSGSIDEVAVQLTPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRH  758

Query  309  MLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            MLI+PK+Q   ++P+VGILTRQDLRAHNIL  FPHLA  +
Sbjct  759  MLIIPKFQGPEIAPIVGILTRQDLRAHNILGAFPHLANKR  798



>gb|ABA98017.1| Chloride channel protein CLC-a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95101.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97716.1| unnamed protein product [Oryza sativa Japonica Group]
Length=625

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 175/218 (80%), Gaps = 1/218 (0%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+A PEPWM+++TVGELA  K   V L  +E+V  +
Sbjct  405  AKTVGDAFNPSIYEIILDLKGLPFLEAKPEPWMKDLTVGELAAAKPRAVALQVVERVSTV  464

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            VE L+ T +NGFPV+D  R   +ELHG+VLR+HL+  L+K++F+ ERRRTEEWE RE FS
Sbjct  465  VEALRATRHNGFPVLDRPRPGVSELHGLVLRSHLVAALRKRWFLPERRRTEEWEAREMFS  524

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
              +LA++ G ++++ ++ +EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  525  SAELADKCGGVDELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHML  584

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            I+PK+Q   +SP+VGILTRQDL AHNIL  FPHLA  +
Sbjct  585  IMPKFQGPEISPIVGILTRQDLIAHNILGAFPHLASKR  622



>gb|EEC69202.1| hypothetical protein OsI_38195 [Oryza sativa Indica Group]
Length=621

 Score =   258 bits (659),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 175/218 (80%), Gaps = 1/218 (0%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+A PEPWM+++TVGELA  K   V L  +E+V  +
Sbjct  401  AKTVGDAFNPSIYEIILDLKGLPFLEAKPEPWMKDLTVGELAAAKPRAVALQVVERVSTV  460

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            VE L+ T +NGFPV+D  R   +ELHG+VLR+HL+  L+K++F+ ERRRTEEWE RE FS
Sbjct  461  VEALRATRHNGFPVLDRPRPGVSELHGLVLRSHLVAALRKRWFLPERRRTEEWEAREMFS  520

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
              +LA++ G ++++ ++ +EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  521  SAELADKCGGVDELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHML  580

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            I+PK+Q   +SP+VGILTRQDL AHNIL  FPHLA  +
Sbjct  581  IMPKFQGPEISPIVGILTRQDLIAHNILGAFPHLASKR  618



>ref|XP_008379123.1| PREDICTED: chloride channel protein CLC-b isoform X1 [Malus domestica]
Length=791

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 168/197 (85%), Gaps = 7/197 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD FNPSIY+IIL LKGLPFL+A+PEPWMRN+TVGELA  K PVVTL GIEKV RI
Sbjct  561  SKTVGDSFNPSIYEIILHLKGLPFLEAHPEPWMRNLTVGELAXAKPPVVTLXGIEKVDRI  620

Query  660  VEVLKNTTYNGFPVVDE-------ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewe  502
            VEVL+NTT+NGFPVV+E          AT +HG++LR HL+ VLKKK+F+ E+RRTEEWE
Sbjct  621  VEVLRNTTHNGFPVVEEVVPPMGLAVGATXVHGLILRAHLVQVLKKKWFLREKRRTEEWE  680

Query  501  vrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            VREKF+ V+LAE   KIE+VAVT DEMEMYVDLHPLTN TP+TV E +SVAKAMVLFRQV
Sbjct  681  VREKFTSVELAEXEAKIEEVAVTRDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLFRQV  740

Query  321  GLRHMLIVPKYQAAGVS  271
            GLRH+LIVPKY+A+GVS
Sbjct  741  GLRHLLIVPKYEASGVS  757



>gb|EEE53145.1| hypothetical protein OsJ_35963 [Oryza sativa Japonica Group]
Length=716

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 175/218 (80%), Gaps = 1/218 (0%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+A PEPWM+++TVGELA  K   V L  +E+V  +
Sbjct  496  AKTVGDAFNPSIYEIILDLKGLPFLEAKPEPWMKDLTVGELAAAKPRAVALQVVERVSTV  555

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            VE L+ T +NGFPV+D  R   +ELHG+VLR+HL+  L+K++F+ ERRRTEEWE RE FS
Sbjct  556  VEALRATRHNGFPVLDRPRPGVSELHGLVLRSHLVAALRKRWFLPERRRTEEWEAREMFS  615

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
              +LA++ G ++++ ++ +EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  616  SAELADKCGGVDELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHML  675

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            I+PK+Q   +SP+VGILTRQDL AHNIL  FPHLA  +
Sbjct  676  IMPKFQGPEISPIVGILTRQDLIAHNILGAFPHLASKR  713



>ref|NP_001066692.1| Os12g0438600 [Oryza sativa Japonica Group]
 dbj|BAF29711.1| Os12g0438600, partial [Oryza sativa Japonica Group]
Length=707

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 175/218 (80%), Gaps = 1/218 (0%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+A PEPWM+++TVGELA  K   V L  +E+V  +
Sbjct  487  AKTVGDAFNPSIYEIILDLKGLPFLEAKPEPWMKDLTVGELAAAKPRAVALQVVERVSTV  546

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            VE L+ T +NGFPV+D  R   +ELHG+VLR+HL+  L+K++F+ ERRRTEEWE RE FS
Sbjct  547  VEALRATRHNGFPVLDRPRPGVSELHGLVLRSHLVAALRKRWFLPERRRTEEWEAREMFS  606

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
              +LA++ G ++++ ++ +EM MYVDLHPLTNTTP+TV E++SVAKA+VLFR V LRHML
Sbjct  607  SAELADKCGGVDELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHML  666

Query  303  IVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            I+PK+Q   +SP+VGILTRQDL AHNIL  FPHLA  +
Sbjct  667  IMPKFQGPEISPIVGILTRQDLIAHNILGAFPHLASKR  704



>gb|ERN10006.1| hypothetical protein AMTR_s00013p00233550 [Amborella trichopoda]
Length=634

 Score =   253 bits (645),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 177/221 (80%), Gaps = 2/221 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGDCFNPSIY+IIL LKGLPFL+A+ EPW+RNI+VG L   K  +V+L G+EKV ++
Sbjct  409  SKTVGDCFNPSIYEIILHLKGLPFLEAHAEPWLRNISVGNLIRAKEEIVSLSGVEKVSQV  468

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            + VL+NTT+NGFPVVD   ++   ELHG+VLR HLL VL+K++F  ERRR+ E EV E+F
Sbjct  469  LAVLRNTTHNGFPVVDMPPISPVPELHGMVLRAHLLEVLEKRWFFRERRRSSEEEVTERF  528

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            S  DLA+R  KIEDV V+ +E EMY+DLHP TN TP+TV ES+SVAKA+VLFRQVGLRHM
Sbjct  529  SSWDLAKRGRKIEDVVVSEEEEEMYIDLHPFTNMTPYTVMESMSVAKAVVLFRQVGLRHM  588

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGS  184
            L++PK Q AG SPVVGILTRQDL A+NI + +PHL +   S
Sbjct  589  LVMPKSQVAGGSPVVGILTRQDLIANNIKSAYPHLLRRGKS  629



>ref|XP_006848425.2| PREDICTED: chloride channel protein CLC-a [Amborella trichopoda]
Length=777

 Score =   253 bits (645),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 177/221 (80%), Gaps = 2/221 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGDCFNPSIY+IIL LKGLPFL+A+ EPW+RNI+VG L   K  +V+L G+EKV ++
Sbjct  552  SKTVGDCFNPSIYEIILHLKGLPFLEAHAEPWLRNISVGNLIRAKEEIVSLSGVEKVSQV  611

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            + VL+NTT+NGFPVVD   ++   ELHG+VLR HLL VL+K++F  ERRR+ E EV E+F
Sbjct  612  LAVLRNTTHNGFPVVDMPPISPVPELHGMVLRAHLLEVLEKRWFFRERRRSSEEEVTERF  671

Query  486  SWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHM  307
            S  DLA+R  KIEDV V+ +E EMY+DLHP TN TP+TV ES+SVAKA+VLFRQVGLRHM
Sbjct  672  SSWDLAKRGRKIEDVVVSEEEEEMYIDLHPFTNMTPYTVMESMSVAKAVVLFRQVGLRHM  731

Query  306  LIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGS  184
            L++PK Q AG SPVVGILTRQDL A+NI + +PHL +   S
Sbjct  732  LVMPKSQVAGGSPVVGILTRQDLIANNIKSAYPHLLRRGKS  772



>ref|XP_007161741.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33735.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=742

 Score =   236 bits (603),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 151/181 (83%), Gaps = 10/181 (6%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL LKGLPF+DANPEPWMRN+TVGEL DVK  VVTL GIEKV +I
Sbjct  559  AKTVGDSFNPSIYEIILHLKGLPFMDANPEPWMRNLTVGELVDVKPSVVTLHGIEKVAKI  618

Query  660  VEVLKNTTYNGFPVV----------DEERVATELHGVVLRTHLLLVLKKKYFMHerrrte  511
            V+VLKNTT+NGFPV+           +   ATELHG+VLR HL+  LKKK+F  ERRRTE
Sbjct  619  VDVLKNTTHNGFPVMDDGVVVPPVVGQANGATELHGLVLRAHLIQALKKKWFFKERRRTE  678

Query  510  ewevrEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLF  331
            +WEVR+KF+WV+LAER G IE VAVT++EMEM+VDLHPLTNTTPFTV ES+SVAKAM+LF
Sbjct  679  DWEVRQKFTWVELAEREGSIEGVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILF  738

Query  330  R  328
            R
Sbjct  739  R  739



>ref|XP_004962544.1| PREDICTED: chloride channel protein CLC-a-like isoform X1 [Setaria 
italica]
Length=876

 Score =   218 bits (556),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 152/191 (80%), Gaps = 1/191 (1%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PE WM+++TVGELA  K   VTL  +EKV  I
Sbjct  574  AKTVGDAFNPSIYEIILDLKGLPFLEPKPETWMKDLTVGELAAAKPRAVTLQVVEKVSTI  633

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            V VL+ T +NGFPV+D  R   +ELHG+VLR HL+ VL+K++F+ E+RRTEEWE RE+FS
Sbjct  634  VAVLRATPHNGFPVLDRPRPGVSELHGLVLRQHLMAVLRKRWFLQEKRRTEEWEARERFS  693

Query  483  WVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHML  304
              +LAE+ G I+DV ++ +E++MY+DLHP TNTTP+TV E++SVAKA+VLFR   LRHML
Sbjct  694  STELAEKAGSIDDVQLSPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRHML  753

Query  303  IVPKYQAAGVS  271
            I+PK+Q   VS
Sbjct  754  IIPKFQGLEVS  764



>ref|NP_001183936.1| chloride channel protein [Zea mays]
 gb|ACV66338.1| chloride channel protein [Zea mays]
Length=792

 Score =   217 bits (552),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 160/205 (78%), Gaps = 7/205 (3%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PE WM+++ VGELA  K  VVTL  IEKV  +
Sbjct  579  AKTVGDAFNPSIYEIILDLKGLPFLEPKPETWMKDLAVGELAAAKPRVVTLQVIEKVSTV  638

Query  660  VEVLKNTTYNGFPVVDEERVA-TELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            VEVL++T +NGFPV+D  R   +ELHG+VLR+HL+ VLKK++F+ ++RRTEEWE RE+FS
Sbjct  639  VEVLRSTPHNGFPVLDWPRPGVSELHGLVLRSHLMAVLKKRWFLTDKRRTEEWEARERFS  698

Query  483  WVDLAERWGKIEDVAV--TNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRH  310
              +LAE+ G I++VAV  T +E++MY+DLHP TNTTP+TV E++SVAKA+VLFR   LRH
Sbjct  699  STELAEKSGSIDEVAVQLTPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLFRTCALRH  758

Query  309  MLIVPKYQAAGVSPVVGILTRQDLR  235
            MLI+PK+Q     P V   + QD R
Sbjct  759  MLIIPKFQG----PEVRATSCQDPR  779



>gb|EMS65031.1| Chloride channel protein CLC-b [Triticum urartu]
Length=518

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 154/220 (70%), Gaps = 31/220 (14%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            AK+VGD FNPSIY+IIL+LKGLPFL+  PEPWM+++TVGELA  K   ++L  +EKV  +
Sbjct  330  AKTVGDAFNPSIYEIILDLKGLPFLEPKPEPWMKDLTVGELAAAKPRTISLQVVEKVSTV  389

Query  660  VEVLKNTTYNGFPVVDEERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFSW  481
            +E                                 VL+K++F  E+RRTEEWE RE+FS 
Sbjct  390  LEXA-------------------------------VLRKRWFFLEKRRTEEWEARERFSS  418

Query  480  VDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLRHMLI  301
            V+LA++  KI+ + +T +E+EMY+DLHP TNTTP+TV E++SVAKA+VLFR V LRHMLI
Sbjct  419  VELADKNCKIDGLELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLFRSVALRHMLI  478

Query  300  VPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSN  181
            +PKYQ   +SP+VGILTRQDLRAHNIL  FPHLAK   ++
Sbjct  479  MPKYQGPEISPLVGILTRQDLRAHNILGAFPHLAKKSKTH  518



>ref|XP_003581281.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
 ref|XP_010239959.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=795

 Score =   214 bits (545),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 160/222 (72%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ DCFN  +YD I+ +KGLPF++A+ EP+MR++  G++  V  P+++  G+EKVG I
Sbjct  577  SKTIADCFNKGVYDQIVVMKGLPFMEAHAEPYMRHLVAGDV--VSGPLISFSGVEKVGNI  634

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ L+ T +NGFPVVDE  +  A EL G+VLR+HLL++LK K FM E+ +T    V ++F
Sbjct  635  VQALRITGHNGFPVVDEPPISEAPELVGLVLRSHLLVLLKGKTFMKEKVKTSGSFVLQRF  694

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       KIED+  T++EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  695  GAFDFAKAGSGKGIKIEDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAVLFRALG  754

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+L+VPK    G  P+VGILTR DL   +I  +FP+L KS
Sbjct  755  LRHLLVVPK--TPGRPPIVGILTRHDLMPEHIHGLFPNLRKS  794



>ref|XP_006652320.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=803

 Score =   213 bits (543),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 160/222 (72%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ DCFN  +YD I+ +KGLPF++A+ EP+M+++  G++  V  P+++  G+EKVG I
Sbjct  585  SKTIADCFNKGVYDQIVVMKGLPFMEAHAEPYMKHLVAGDV--VSGPLISFSGVEKVGNI  642

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  V  A EL G+VLR+HLL++LK K FM E+ +T    V  +F
Sbjct  643  VHALRITGHNGFPVVDEPPVSEAPELVGLVLRSHLLVLLKGKTFMKEQAKTSGSFVLRRF  702

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+  T++E+EMYVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  703  GAFDFAKPGSGKGLKIEDLDFTDEELEMYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  762

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+L+VPK    G  P+VGILTR D    +IL +FP+L+KS
Sbjct  763  LRHLLVVPK--TPGRPPIVGILTRHDFMPEHILGLFPNLSKS  802



>ref|XP_010674330.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score =   212 bits (540),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 161/223 (72%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +Y+ I++LKGLP+L+A+ EP+M+++  G+   V  P+VT  G+EKV  I
Sbjct  566  SKTVADCFNHGVYEQIVKLKGLPYLEAHAEPYMKHLVAGD--AVSGPLVTFSGVEKVESI  623

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L++T +NGFPV+DE   +   EL G+VLR+HLL++LK KYF  ERR +    ++ KF
Sbjct  624  VHALQSTGHNGFPVIDEPPFSDTPELCGLVLRSHLLVLLKAKYFTRERRLSGRDILK-KF  682

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+    +  K+EDV +T +EMEMY+DLHP+TN +P+TV E++S+AKA VLFRQ+G
Sbjct  683  SPFDFAKPGTGKGLKLEDVTITEEEMEMYIDLHPITNASPYTVLETMSLAKAKVLFRQIG  742

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRHM +VPK Q  G SP+VG+LTR D    +IL ++PH+ + K
Sbjct  743  LRHMCVVPKSQ--GRSPIVGLLTRHDFMPEHILGLYPHMKQHK  783



>ref|XP_010905340.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Elaeis guineensis]
Length=645

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 160/223 (72%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I++LKGLP+L+A+ EP+MR +TV ++  V  P+ T  G+EKVG I
Sbjct  409  SKTVADTFNANIYDLIVKLKGLPYLEAHAEPYMRQLTVSDV--VTGPLQTFHGVEKVGNI  466

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T ++GFPV+DE   +    L G++LR HLL++LKKK F+H    +     +  F
Sbjct  467  VHVLKTTGHHGFPVIDEPPFSDSPVLFGLILRAHLLVLLKKKEFLHTCALSSFDASK-PF  525

Query  486  SWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R  GK   I+D+ +T +EMEMY+DLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  526  SADDFAKRGSGKHDSIDDIELTVEEMEMYIDLHPFTNTSPYTVVETMSLAKALILFREVG  585

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  586  LRHLLVVPK--SSSRAPVVGILTRHDFMPEHILGLHPFLLKSR  626



>ref|XP_010240516.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Brachypodium distachyon]
Length=662

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 159/223 (71%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN ++YD+++ LKG PFL+ + EP+MR ++V ++  V  P+ T  G+EKVGRI
Sbjct  430  SKTVADAFNANVYDLLVNLKGFPFLEGHAEPYMRQLSVSDV--VTGPLQTFNGLEKVGRI  487

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VLK T +NGFPVVDE   +    L+G+VLR HLL++L+KK F+         +  + F
Sbjct  488  VDVLKTTGHNGFPVVDEPPFSDIPLLYGLVLRAHLLVLLRKKDFI-SSCTASALDASKHF  546

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R      +IED+ +T DEMEM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  547  SPDDFAKRGSGKHDRIEDIELTADEMEMFVDLHPFTNTSPYTVVETMSLAKALILFREVG  606

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    ++L + P+L KS+
Sbjct  607  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHVLGLHPYLIKSR  647



>ref|XP_010905336.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905338.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905339.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
Length=779

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 160/223 (72%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I++LKGLP+L+A+ EP+MR +TV ++  V  P+ T  G+EKVG I
Sbjct  543  SKTVADTFNANIYDLIVKLKGLPYLEAHAEPYMRQLTVSDV--VTGPLQTFHGVEKVGNI  600

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T ++GFPV+DE   +    L G++LR HLL++LKKK F+H    +     +  F
Sbjct  601  VHVLKTTGHHGFPVIDEPPFSDSPVLFGLILRAHLLVLLKKKEFLHTCALSSFDASK-PF  659

Query  486  SWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R  GK   I+D+ +T +EMEMY+DLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  660  SADDFAKRGSGKHDSIDDIELTVEEMEMYIDLHPFTNTSPYTVVETMSLAKALILFREVG  719

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  720  LRHLLVVPK--SSSRAPVVGILTRHDFMPEHILGLHPFLLKSR  760



>ref|NP_001169702.1| uncharacterized protein LOC100383583 [Zea mays]
 gb|ACN34587.1| unknown [Zea mays]
Length=341

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 154/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN SIYD+IL LKGLP LD + EP+MR + VG++  V  P+ +  G+EKVG +
Sbjct  97   SKTVADSFNSSIYDLILRLKGLPHLDGHAEPYMRQLAVGDV--VAGPLRSFGGVEKVGNV  154

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T ++ FPVVDE     A  L+G+VLR HLL++LKK+ F+    R  +  V E+F
Sbjct  155  VHTLRTTGHHAFPVVDEPPFSPAPVLYGLVLRAHLLVLLKKREFLVAPERCPKEYVAERF  214

Query  486  SWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D  +R  GK   I DV ++ +EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VG
Sbjct  215  QAEDFDKRGSGKQDTIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVG  274

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK  A   SPVVGILTR D    +IL + P L +S+
Sbjct  275  LRHLLVVPK--ACDRSPVVGILTRHDFMPEHILELHPVLLRSR  315



>ref|XP_009418228.1| PREDICTED: putative chloride channel-like protein CLC-g [Musa 
acuminata subsp. malaccensis]
Length=801

 Score =   209 bits (532),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 160/223 (72%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FNP+IYD+IL LKGLP+LD + EP+MR++TVG++  V  P+ T  G+EKVG +
Sbjct  560  SKTVADAFNPNIYDLILRLKGLPYLDDHAEPYMRHLTVGDV--VAGPLRTFNGVEKVGNV  617

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V +LK T ++ FPV+DE   ++   L+G+VLR HLL +LKKK F+   R     +   +F
Sbjct  618  VHILKTTGHHAFPVIDEPPFSSSPVLYGLVLRAHLLSLLKKKRFL-PTRSVAGLDAAGQF  676

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               +L +R      ++EDV V+ +EMEM+VDLHP TN++P+TV E++S+AKA++LFR++G
Sbjct  677  GADELGKRGSGKHDRVEDVEVSAEEMEMFVDLHPFTNSSPYTVVETMSLAKALILFREMG  736

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+LIVPK  ++  +PVVGILTR D  A +IL + P L KS+
Sbjct  737  LRHLLIVPK--SSSRAPVVGILTRHDFMAEHILGLHPFLRKSR  777



>ref|XP_009392132.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=806

 Score =   209 bits (533),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 158/223 (71%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FNP+IYD+IL+LKGLP+L+ + EP+MR +TV ++  V  P+ T  G+EKVG I
Sbjct  565  SKTVADSFNPNIYDLILKLKGLPYLEDHAEPYMRQLTVSDV--VAGPLRTFNGVEKVGNI  622

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            + +LK T ++ FPV+DE   ++   L+G++LR HLL +LKKK F+        ++  ++F
Sbjct  623  IHILKTTGHHAFPVIDEPPFSSSPVLYGLILRAHLLSLLKKKCFL-PTCTLSSFDASKQF  681

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+R      +IED+ VT +EMEMY+DLHP TNT+P+TV E++S+AKA+ LFRQVG
Sbjct  682  VADDFAKRGSGKHDRIEDIEVTAEEMEMYIDLHPFTNTSPYTVVETMSLAKALTLFRQVG  741

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+LIVPK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  742  LRHLLIVPK--SSCRAPVVGILTRHDFMPEHILGLHPFLVKSR  782



>ref|XP_008801913.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801914.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=778

 Score =   209 bits (531),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 160/223 (72%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I++LKGLP+L+A+ EP+MR +TV ++  V  P+    G+EKVG I
Sbjct  542  SKTVADTFNANIYDMIVKLKGLPYLEAHAEPYMRQLTVSDV--VTGPLQIFHGVEKVGNI  599

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T ++GFPV+DE   +    L G+VLR HLL++LKK+ F+H    +     + +F
Sbjct  600  VHVLKTTGHHGFPVIDEPPFSDSPVLFGLVLRAHLLVLLKKREFLHTCALSGVDASK-QF  658

Query  486  SWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R  GK   I+D+ +T +EMEMY+DLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  659  SADDFAKRGSGKRDSIDDIELTTEEMEMYIDLHPFTNTSPYTVVETMSLAKALILFREVG  718

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  719  LRHLLVVPK--SSSRAPVVGILTRHDFMPEHILGLHPCLLKSR  759



>ref|XP_003580671.2| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Brachypodium distachyon]
Length=826

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 159/223 (71%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN ++YD+++ LKG PFL+ + EP+MR ++V ++  V  P+ T  G+EKVGRI
Sbjct  594  SKTVADAFNANVYDLLVNLKGFPFLEGHAEPYMRQLSVSDV--VTGPLQTFNGLEKVGRI  651

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VLK T +NGFPVVDE   +    L+G+VLR HLL++L+KK F+     +     +  F
Sbjct  652  VDVLKTTGHNGFPVVDEPPFSDIPLLYGLVLRAHLLVLLRKKDFISSCTASALDASK-HF  710

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R      +IED+ +T DEMEM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  711  SPDDFAKRGSGKHDRIEDIELTADEMEMFVDLHPFTNTSPYTVVETMSLAKALILFREVG  770

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    ++L + P+L KS+
Sbjct  771  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHVLGLHPYLIKSR  811



>gb|EEE60792.1| hypothetical protein OsJ_14377 [Oryza sativa Japonica Group]
Length=773

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 158/222 (71%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLPF++A+ EP+MRN+  G++  V  P++T  G+EKVG I
Sbjct  555  SKTIADSFNKGVYDQIVVMKGLPFMEAHAEPFMRNLVAGDV--VSGPLITFSGVEKVGNI  612

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  V  A EL G+VLR+HLL++LK + FM E+ +T    V  +F
Sbjct  613  VHALRITGHNGFPVVDEPPVSEAPELVGLVLRSHLLVLLKGRSFMKEKVKTSGSFVLRRF  672

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+ +T++E++MYVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  673  GAFDFAKPGSGKGLKIEDLDLTDEELDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  732

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+L+VPK    G  P+VGILTR D    +I  +FP+L KS
Sbjct  733  LRHLLVVPK--TPGRPPIVGILTRHDFMHEHIHGLFPNLGKS  772



>gb|EAY94258.1| hypothetical protein OsI_16029 [Oryza sativa Indica Group]
Length=803

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 158/222 (71%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLPF++A+ EP+MRN+  G++  V  P++T  G+EKVG I
Sbjct  585  SKTIADSFNKGVYDQIVVMKGLPFMEAHAEPFMRNLVAGDV--VSGPLITFSGVEKVGNI  642

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  V  A EL G+VLR+HLL++LK + FM E+ +T    V  +F
Sbjct  643  VHALRITGHNGFPVVDEPPVSEAPELVGLVLRSHLLVLLKGRSFMKEKVKTSGSFVLRRF  702

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+ +T++E++MYVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  703  GAFDFAKPGSGKGLKIEDLDLTDEELDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  762

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+L+VPK    G  P+VGILTR D    +I  +FP+L KS
Sbjct  763  LRHLLVVPK--TPGRPPIVGILTRHDFMHEHIHGLFPNLGKS  802



>ref|XP_009405902.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=780

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 156/223 (70%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I+ +KGLP+++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  562  SKTVADCFNKGVYDQIVMMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNI  619

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            VE L+ T +NGFPV+DE     A EL G+VLR+HLL++LK K F  ER +T   E+  +F
Sbjct  620  VEALRLTGHNGFPVIDEPPFSDAPELVGLVLRSHLLVLLKGKRFTRERVKTGVKEILRRF  679

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K ED+ +  DEM+M+VDLHP+TNT+P+TV E++S+AKA VLFR++G
Sbjct  680  GAFDFAKAGSGKGLKFEDLNILEDEMDMFVDLHPITNTSPYTVVETMSLAKAAVLFRELG  739

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G  P+VGILTR D  + +IL +FPH+   K
Sbjct  740  LRHLCVVPK--TPGRPPIVGILTRHDFTSEHILGLFPHIHPHK  780



>dbj|BAB97267.1| chloride channel [Oryza sativa Japonica Group]
Length=801

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 158/222 (71%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLPF++A+ EP+MRN+  G++  V  P++T  G+EKVG I
Sbjct  583  SKTIADSFNKGVYDQIVVMKGLPFMEAHAEPFMRNLVAGDV--VSGPLITFSGVEKVGNI  640

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  V  A EL G+VLR+HLL++LK + FM E+ +T    V  +F
Sbjct  641  VHALRITGHNGFPVVDEPPVSEAPELVGLVLRSHLLVLLKGRSFMKEKVKTSGSFVLRRF  700

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+ +T++E++MYVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  701  GAFDFAKPGSGKGLKIEDLDLTDEELDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  760

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+L+VPK    G  P+VGILTR D    +I  +FP+L KS
Sbjct  761  LRHLLVVPK--TPGRPPIVGILTRHDFMHEHIHGLFPNLGKS  800



>ref|XP_010057598.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Eucalyptus grandis]
 gb|KCW74787.1| hypothetical protein EUGRSUZ_E03522 [Eucalyptus grandis]
Length=771

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 157/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I++ KG P+L+A+ EP+MR +TV ++  VK P+    GIE+VG +
Sbjct  539  SKTVADAFNNNIYDLIMKAKGFPYLEAHAEPFMRQLTVSDV--VKGPLQLFHGIERVGNV  596

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+ TT+NGFPV+DE  ++    L+G++LR HL+ +LKKK F+     T       +F
Sbjct  597  VQVLRTTTHNGFPVIDESPLSESPVLYGLILRAHLIELLKKKAFLSSTEPTGIDVSE-QF  655

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S VD A++      KIEDV VTN+E  M++DLHP TNT+P+TV E++S+AKA++L RQVG
Sbjct  656  SVVDFAKKGSGNADKIEDVDVTNEEENMFLDLHPFTNTSPYTVVETMSLAKALILLRQVG  715

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK    G SPVVGILTR D    +IL+  P L +S+
Sbjct  716  LRHLLVIPKIY--GRSPVVGILTRHDFMPEDILSSHPALTRSR  756



>ref|XP_010057599.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Eucalyptus grandis]
Length=700

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 157/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I++ KG P+L+A+ EP+MR +TV ++  VK P+    GIE+VG +
Sbjct  468  SKTVADAFNNNIYDLIMKAKGFPYLEAHAEPFMRQLTVSDV--VKGPLQLFHGIERVGNV  525

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+VL+ TT+NGFPV+DE  ++    L+G++LR HL+ +LKKK F+     T       +F
Sbjct  526  VQVLRTTTHNGFPVIDESPLSESPVLYGLILRAHLIELLKKKAFLSSTEPTGIDVSE-QF  584

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S VD A++      KIEDV VTN+E  M++DLHP TNT+P+TV E++S+AKA++L RQVG
Sbjct  585  SVVDFAKKGSGNADKIEDVDVTNEEENMFLDLHPFTNTSPYTVVETMSLAKALILLRQVG  644

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK    G SPVVGILTR D    +IL+  P L +S+
Sbjct  645  LRHLLVIPKIY--GRSPVVGILTRHDFMPEDILSSHPALTRSR  685



>gb|ADW93911.1| chloride channel 1 [Hordeum vulgare subsp. vulgare]
Length=799

 Score =   207 bits (526),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 156/222 (70%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ DCFN  +YD I+ +KGLPF++A+ EP+MR++   ++  V  P+++  G+EKVG I
Sbjct  581  SKTIADCFNKGVYDQIVVMKGLPFMEAHAEPYMRHLVASDV--VSGPLISFSGVEKVGNI  638

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  V  A EL G+VLR+HLL++L  + FM E+ +T    V  +F
Sbjct  639  VHALRITGHNGFPVVDEPPVSEAPELVGLVLRSHLLVLLNGRNFMKEKVKTSGSFVLRRF  698

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+  T +EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  699  GAFDFAKPGSGKGMKIEDLDFTEEEMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  758

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+L+VPK    G  P+VGILTR DL   +I  +FP+L KS
Sbjct  759  LRHLLVVPK--TPGRFPIVGILTRHDLMPEHIHGLFPNLRKS  798



>ref|XP_004975700.1| PREDICTED: chloride channel protein CLC-c-like isoform X3 [Setaria 
italica]
Length=844

 Score =   207 bits (526),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 157/222 (71%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KG+PFL+A+ EP+MR +  G++  V  P+++  G+E+VG I
Sbjct  626  SKTIADSFNKGVYDQIIVMKGMPFLEAHAEPYMRQLVAGDV--VSGPLISFSGVERVGNI  683

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ L+ T +NGFPVVDE  +  A EL G+VLR+HLL++LK K FM E+ +T    V +KF
Sbjct  684  VQALRITGHNGFPVVDEPPLSEAPELVGLVLRSHLLVLLKGKGFMKEKVKTSGSFVLKKF  743

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       KIED+  T++EM+MYVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  744  GAFDFAKAGSGKGLKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  803

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+L+VPK    G  P+VGILTR D    +I  +FP+L KS
Sbjct  804  LRHLLVVPK--TPGRPPIVGILTRHDFMPEHIHGLFPNLHKS  843



>ref|XP_004975698.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Setaria 
italica]
Length=875

 Score =   207 bits (526),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 157/222 (71%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KG+PFL+A+ EP+MR +  G++  V  P+++  G+E+VG I
Sbjct  657  SKTIADSFNKGVYDQIIVMKGMPFLEAHAEPYMRQLVAGDV--VSGPLISFSGVERVGNI  714

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ L+ T +NGFPVVDE  +  A EL G+VLR+HLL++LK K FM E+ +T    V +KF
Sbjct  715  VQALRITGHNGFPVVDEPPLSEAPELVGLVLRSHLLVLLKGKGFMKEKVKTSGSFVLKKF  774

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       KIED+  T++EM+MYVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  775  GAFDFAKAGSGKGLKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  834

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+L+VPK    G  P+VGILTR D    +I  +FP+L KS
Sbjct  835  LRHLLVVPK--TPGRPPIVGILTRHDFMPEHIHGLFPNLHKS  874



>ref|XP_006381102.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP58899.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score =   206 bits (524),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 157/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+  KG P+L+A+ EP+MR +TVGE+  V+ P+    GIEKVG+I
Sbjct  543  SKTVADAFNGNIYDLIMNAKGFPYLEAHTEPYMRQLTVGEV--VRGPLQIFQGIEKVGKI  600

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L+G++LR HL+ +LKKK F+     T     +  F
Sbjct  601  VHVLRTTRHNGFPVIDEPPLSESPVLYGLILRAHLIELLKKKAFVPTPVPTGTDAFKLFF  660

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            +  D A+R      KIED+  T +EMEM++DLHP TN +P+TV+E++S+AKA++LFR+VG
Sbjct  661  AG-DFAKRGSGNGDKIEDLQFTEEEMEMFLDLHPFTNASPYTVAETMSLAKALILFREVG  719

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +G SPVVGILTR D    +IL + P L +S+
Sbjct  720  LRHLLVIPKI--SGRSPVVGILTRHDFMPGHILGLHPMLIRSR  760



>ref|XP_006453099.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453100.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453101.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006474404.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474405.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X2 [Citrus sinensis]
 gb|ESR66339.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66340.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66341.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
Length=794

 Score =   206 bits (523),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 155/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I++ KG P+L+ + EP+MR +TVG++  V AP+    GIEK G +
Sbjct  562  SKTVADAFNGNIYDLIMKAKGFPYLETHVEPYMRQLTVGDV--VTAPLQLFHGIEKAGNV  619

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L+G++LR HL+ +LKKK F+         +   +F
Sbjct  620  VHVLRTTRHNGFPVIDENPLSETPILYGLILRAHLITLLKKKAFL-PTPNPTVNDAFSQF  678

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S VD A+R      KIED+ ++ +EMEMYVDLHP  N +P+TV E++S+AKA++LFR+VG
Sbjct  679  SAVDFAKRGSGNGDKIEDIELSEEEMEMYVDLHPFANASPYTVVETMSLAKALILFREVG  738

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK      SPVVGILTR D    +ILA+ P LA+S+
Sbjct  739  LRHLLVIPKISNG--SPVVGILTRHDFMPEHILALNPLLARSR  779



>ref|NP_001170245.1| uncharacterized protein LOC100384199 [Zea mays]
 gb|ACN36355.1| unknown [Zea mays]
Length=455

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 157/222 (71%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLPFL+A+ EP+M ++   ++  V  P+++  G+E+VG I
Sbjct  237  SKTIADSFNKGVYDQIVVMKGLPFLEAHAEPYMTHLVASDV--VSGPLISFSGVERVGNI  294

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ L+ T +NGFPVVDE  +  A EL G+VLR+HLL++LK K FM E+ +T    V E+F
Sbjct  295  VQALRITGHNGFPVVDEPPLSEAPELVGLVLRSHLLVLLKGKGFMKEKMKTSGSFVLERF  354

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+  T++EM++YVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  355  GAFDFAKPGSGKGLKIEDLDFTDEEMDLYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  414

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRHML+VPK    G  P+VGILTR D    +I  +FP++ KS
Sbjct  415  LRHMLVVPK--TPGRPPIVGILTRHDFIPEHIHGLFPNIHKS  454



>gb|KDO73468.1| hypothetical protein CISIN_1g003801mg [Citrus sinensis]
Length=794

 Score =   204 bits (520),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 155/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I++ KG P+L+ + EP+MR +TVG++  V AP+    GIEK G +
Sbjct  562  SKTVADAFNGNIYDLIMKAKGFPYLETHVEPYMRQLTVGDV--VTAPLQLFHGIEKAGNV  619

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L+G++LR HL+ +LKKK F+         +   +F
Sbjct  620  VHVLRTTRHNGFPVIDENPLSETPILYGLILRAHLITLLKKKAFL-PTPNPTVNDAFSQF  678

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S VD A+R      KIED+ ++ +EMEMYVDLHP  N +P+TV E++S+AKA++LFR+VG
Sbjct  679  SAVDFAKRGSGNGDKIEDIELSEEEMEMYVDLHPFANASPYTVVETMSLAKALILFREVG  738

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK      SPV+GILTR D    +ILA+ P LA+S+
Sbjct  739  LRHLLVIPKISNG--SPVMGILTRHDFMPEHILALNPLLARSR  779



>gb|EMS56130.1| Putative chloride channel-like protein CLC-g [Triticum urartu]
Length=866

 Score =   205 bits (521),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 161/229 (70%), Gaps = 11/229 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN ++YD++++LKG PFL+ + EP+MR ++V ++  V  P+ T  GIEKVGRI
Sbjct  640  SKTVADAFNANVYDLLVKLKGFPFLEGHAEPYMRQLSVSDV--VTGPLQTFNGIEKVGRI  697

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ LK T +NGFPVVDE   +    L+G+VLR+HLL++L+KK F+         +  + F
Sbjct  698  VDTLKATGHNGFPVVDEPPFSDTPLLYGLVLRSHLLVLLRKKEFI-SSSTASASDASKHF  756

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R      +IED+ +T +E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  757  SPEDFAKRGSGKHDRIEDIELTAEELEMFVDLHPFTNTSPYTVVETMSLAKALILFREVG  816

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH  172
            LRH+L++PK   +  +PVVGILTR D    ++L + P+L KS+   + H
Sbjct  817  LRHLLVLPK--TSKRAPVVGILTRHDFMPEHVLGLHPYLFKSRWKKEHH  863



>ref|XP_009393492.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393493.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
Length=780

 Score =   204 bits (520),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 154/219 (70%), Gaps = 10/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD ++++KG PF++A+ EP+MRN+   ++  V  P+VTL G+E+VG I
Sbjct  562  SKTVADCFNKGVYDQMVKMKGFPFMEAHAEPYMRNLVASDV--VSGPLVTLSGVERVGNI  619

Query  660  VEVLKNTTYNGFPVVDEE--RVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  ++ T +NGFPVVDE    V  EL G+VLRTHLL++LK K F  ER  T   +V ++F
Sbjct  620  VHAIRLTGHNGFPVVDEPPFSVVPELCGLVLRTHLLVLLKGKRFTKERVSTGAADVLQRF  679

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+E++ +  +EMEMYVDLHP+TN +P+TV+E++S+AKA +LFR++G
Sbjct  680  GAYDFAKAGSGKGVKLEEIDINEEEMEMYVDLHPITNRSPYTVAETMSLAKAAILFRELG  739

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRH+ +VPK    G  P+VGILTR D  + +IL +FP +
Sbjct  740  LRHLCVVPK--TPGRPPIVGILTRHDFMSEHILGLFPRI  776



>gb|EMT23162.1| Putative chloride channel-like protein CLC-g [Aegilops tauschii]
Length=1241

 Score =   206 bits (524),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 160/223 (72%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN ++YD++++LKG PFL+ + EP+MR ++V ++  V  P+ T  GIEKVGRI
Sbjct  583  SKTVADAFNANVYDLLVKLKGFPFLEGHAEPYMRQLSVSDV--VTGPLQTFNGIEKVGRI  640

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V++LK T +NGFPVVDE   +    L+G+VLR+HLL++L+KK F+         +  + F
Sbjct  641  VDILKATGHNGFPVVDEPPFSDTPLLYGLVLRSHLLVLLRKKEFI-SSSTASASDASKHF  699

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R      +IED+ +T +E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  700  SPEDFAKRGSGKHDRIEDIELTAEELEMFVDLHPFTNTSPYTVVETMSLAKALILFREVG  759

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +  +PVVGILTR D    ++L + P+L KS+
Sbjct  760  LRHLLVLPK--TSKRAPVVGILTRHDFMPEHVLGLHPYLFKSR  800



>gb|KHN47107.1| Putative chloride channel-like protein CLC-g [Glycine soja]
Length=765

 Score =   203 bits (517),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 157/227 (69%), Gaps = 12/227 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYDII++ KGLP+L+ + EP+MR ++VG++  V  P+ T  G+EKV  I
Sbjct  541  SKTVADAFNANIYDIIMKAKGLPYLETHAEPYMRQLSVGDV--VTGPLQTFNGVEKVCNI  598

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V +L+ T +NGFPV+DE  ++    L G++LR HLL +LKKK FM     T    +  +F
Sbjct  599  VFILRTTGHNGFPVIDEPPISQAPVLFGIILRDHLLTLLKKKAFMSSPMATSGDVIN-EF  657

Query  486  SWVDLAERWG-----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            S  D A++       KIED+ ++ +EM+M++DLHP TN +P+TV E++S+ KA+ LFR++
Sbjct  658  SADDFAKKGSSKGRLKIEDIQLSEEEMDMFIDLHPFTNASPYTVVETMSLGKALTLFREL  717

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSN  181
            GLRH+L+VPK+  +G SPVVGILTR D  + +IL + P L ++ G +
Sbjct  718  GLRHLLVVPKF--SGRSPVVGILTRHDFMSEHILGLHPFLVRNTGKS  762



>ref|XP_003542650.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Glycine max]
Length=765

 Score =   203 bits (517),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 157/227 (69%), Gaps = 12/227 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYDII++ KGLP+L+ + EP+MR ++VG++  V  P+ T  G+EKV  I
Sbjct  541  SKTVADAFNANIYDIIMKAKGLPYLETHAEPYMRQLSVGDV--VTGPLQTFNGVEKVCNI  598

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V +L+ T +NGFPV+DE  ++    L G++LR HLL +LKKK FM     T    +  +F
Sbjct  599  VFILRTTGHNGFPVIDEPPISQAPVLFGIILRDHLLTLLKKKAFMSSPMATSGDVIN-EF  657

Query  486  SWVDLAERWG-----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            S  D A++       KIED+ ++ +EM+M++DLHP TN +P+TV E++S+ KA+ LFR++
Sbjct  658  SADDFAKKGSSKGRLKIEDIQLSEEEMDMFIDLHPFTNASPYTVVETMSLGKALTLFREL  717

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSN  181
            GLRH+L+VPK+  +G SPVVGILTR D  + +IL + P L ++ G +
Sbjct  718  GLRHLLVVPKF--SGRSPVVGILTRHDFMSEHILGLHPFLVRNTGKS  762



>ref|XP_003573678.1| PREDICTED: putative chloride channel-like protein CLC-g [Brachypodium 
distachyon]
Length=806

 Score =   203 bits (517),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 155/224 (69%), Gaps = 11/224 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN SIYD+IL+LKGLP LD + EP+MR +TVG++  V  P+ +  G+EKV  +
Sbjct  561  SKTLADSFNSSIYDLILKLKGLPHLDGHAEPYMRQLTVGDV--VAGPLRSFGGVEKVAHV  618

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKK-YFMHerrrteewevrEK  490
            V VL+ T ++ FPVVDE   A    L+G+VLR HLL++LKKK +FM    R  +  +  +
Sbjct  619  VHVLRTTGHHAFPVVDEPPFAQSPVLYGLVLRAHLLVLLKKKEFFMATPVRCAKESIAGR  678

Query  489  FSWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            F   D  +R  GK   +EDV ++ +EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+V
Sbjct  679  FEAQDFDKRGSGKQDAVEDVEISAEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREV  738

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            GLRH+L+VPK  A   SPVVGILTR D    +IL + P L   +
Sbjct  739  GLRHLLVVPK--ACDRSPVVGILTRHDFMPEHILGLHPVLLGGR  780



>emb|CBI27719.3| unnamed protein product [Vitis vinifera]
Length=742

 Score =   203 bits (516),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 154/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I++LKGLP+++A+ EP+M+++   ++  V  P+VT  GIEKVG I
Sbjct  525  SKTVADSFNKGVYDQIVKLKGLPYMEAHAEPYMKHLAARDV--VSGPLVTFSGIEKVGNI  582

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L+ T +NGFPV+DE     A EL G+VLR+HLL++LK K F   +       +R K+
Sbjct  583  MHALRTTGHNGFPVIDEPPFTDAPELCGLVLRSHLLVLLKGKSFSRNQVHCGGEILR-KY  641

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            + +D A+       K+ED+ +  +EMEMYVDLHP+TN +P+TV E++S+AKA +LFRQVG
Sbjct  642  AALDFAKAGSGKGVKLEDLNIEEEEMEMYVDLHPITNASPYTVVETMSLAKAAILFRQVG  701

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRHM +VPK Q  G  P+VGILTR D    +IL ++PHL+  K
Sbjct  702  LRHMCVVPKSQ--GRPPIVGILTRHDFMPEHILGLYPHLSPHK  742



>ref|XP_002453459.1| hypothetical protein SORBIDRAFT_04g006250 [Sorghum bicolor]
 gb|EES06435.1| hypothetical protein SORBIDRAFT_04g006250 [Sorghum bicolor]
Length=793

 Score =   203 bits (516),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 154/224 (69%), Gaps = 11/224 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN SIYD+IL LKGLP LD + EP+MR +TVG++  V  P+ +  G+EKVG +
Sbjct  548  SKTVADSFNSSIYDLILRLKGLPHLDGHAEPYMRQLTVGDV--VAGPLRSFGGVEKVGSV  605

Query  660  VEVLKNTTYNGFPVVDEERVATE---LHGVVLRTHLLLVLKKKYFMHerrrteewevrEK  490
            V  L+ T ++ FPVVDE   +     L+G+VLR HLL++LKK+ F+    R  +  V  +
Sbjct  606  VHTLRTTGHHAFPVVDEPPFSPGPPVLYGLVLRAHLLVLLKKREFLAAPERCRKEYVAGR  665

Query  489  FSWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            F   D  +R  GK   I DV ++ +EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+V
Sbjct  666  FQAEDFDKRGSGKQDAIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREV  725

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            GLRH+L+VPK  A   SPVVGILTR D    +IL + P L KS+
Sbjct  726  GLRHLLVVPK--ACDRSPVVGILTRHDFMPEHILGLHPVLLKSR  767



>ref|XP_003592890.1| Chloride channel protein CLC-c [Medicago truncatula]
 gb|ABE91957.1| CBS; Cl- channel, voltage gated; Twin-arginine translocation 
pathway signal [Medicago truncatula]
 gb|AES63141.1| chloride channel ClC1 protein [Medicago truncatula]
Length=761

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 151/223 (68%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I+ LKGLP+++A+ EP+MRN+  G++  V  P+ + CGIEKVG I
Sbjct  543  SKTVADCFNKGVYDQIVALKGLPYMEAHAEPYMRNLVAGDV--VSGPLFSFCGIEKVGNI  600

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  LK T ++GFPVVDE  +  A EL G+VLR+HL ++LK K      R      +  K 
Sbjct  601  LHALKVTEHHGFPVVDEPPLTDAPELCGLVLRSHLWVLLKHKTLFTRERVMTGSTIVNKV  660

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    R  ++ED+ ++ +EMEMYVDLHP+TNT+P+TV E++S+AKA +LFR++G
Sbjct  661  KARDFAKPGLGRGIRVEDLDISQEEMEMYVDLHPITNTSPYTVVETMSLAKAALLFRELG  720

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK    G  P+VGILTR D     IL +FP+L   K
Sbjct  721  LRHLLVVPK--KPGRPPIVGILTRHDFMHDYILGLFPNLNPHK  761



>ref|XP_002447895.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
 gb|EES12223.1| hypothetical protein SORBIDRAFT_06g017570 [Sorghum bicolor]
Length=798

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 158/222 (71%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLPFL+A+ EP MR++  G++  V  P+++  G+E+VG I
Sbjct  580  SKTIADSFNKGVYDQIVVMKGLPFLEAHAEPHMRHLVAGDV--VSGPLISFSGVERVGNI  637

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ L+ T +NGFPVVDE  +  A EL G+VLR+HLL++LK K FM E+ +T    V ++F
Sbjct  638  VQALRITGHNGFPVVDEPPLSEAPELVGLVLRSHLLVLLKGKGFMKEKMKTSGSFVLQRF  697

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+  T++EM+MYVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  698  GAFDFAKPGSGKGLKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  757

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+L+VPK    G  P+VGILTR D    +I  +FP++ KS
Sbjct  758  LRHLLVVPK--TPGRPPIVGILTRHDFMPEHIHGLFPNIHKS  797



>ref|NP_001268085.1| uncharacterized protein LOC100259734 [Vitis vinifera]
 ref|XP_010653021.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653022.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653023.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653024.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653025.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653026.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653027.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 gb|ADK66981.1| chloride channel ClC3 [Vitis vinifera]
Length=780

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 154/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I++LKGLP+++A+ EP+M+++   ++  V  P+VT  GIEKVG I
Sbjct  563  SKTVADSFNKGVYDQIVKLKGLPYMEAHAEPYMKHLAARDV--VSGPLVTFSGIEKVGNI  620

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L+ T +NGFPV+DE     A EL G+VLR+HLL++LK K F   +       +R K+
Sbjct  621  MHALRTTGHNGFPVIDEPPFTDAPELCGLVLRSHLLVLLKGKSFSRNQVHCGGEILR-KY  679

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            + +D A+       K+ED+ +  +EMEMYVDLHP+TN +P+TV E++S+AKA +LFRQVG
Sbjct  680  AALDFAKAGSGKGVKLEDLNIEEEEMEMYVDLHPITNASPYTVVETMSLAKAAILFRQVG  739

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRHM +VPK Q  G  P+VGILTR D    +IL ++PHL+  K
Sbjct  740  LRHMCVVPKSQ--GRPPIVGILTRHDFMPEHILGLYPHLSPHK  780



>ref|XP_006852872.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Amborella trichopoda]
 gb|ERN14339.1| hypothetical protein AMTR_s00033p00206270 [Amborella trichopoda]
Length=785

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 156/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+++KGLP+L+A+ EP+M+N+T G++  V  P+    G+E+V  I
Sbjct  548  SKTVADAFNGNIYDLIMQIKGLPYLEAHAEPYMKNLTAGDV--VVGPLHIFNGVERVCNI  605

Query  660  VEVLKNTTYNGFPVVDE--ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V +L+ T +NGFPVVDE     +  L G+VLR HLL++LKK+ F H          +  F
Sbjct  606  VHLLRATKHNGFPVVDEPPNSESPVLFGLVLRAHLLMLLKKREFSHTPALVGVDAFK-HF  664

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S+ D A+R      +IED+ ++++EMEM+VDLHP  NT+P+TV E++S+AKA++LFRQVG
Sbjct  665  SFDDFAKRGSGKGDQIEDIELSDEEMEMFVDLHPFANTSPYTVVETMSLAKALILFRQVG  724

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK    G +PVVGILTR D    ++L + P+L  S+
Sbjct  725  LRHLLVVPKTH--GRAPVVGILTRHDFMPEHVLGLHPYLKGSQ  765



>ref|XP_011626413.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Amborella trichopoda]
Length=743

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 156/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+++KGLP+L+A+ EP+M+N+T G++  V  P+    G+E+V  I
Sbjct  506  SKTVADAFNGNIYDLIMQIKGLPYLEAHAEPYMKNLTAGDV--VVGPLHIFNGVERVCNI  563

Query  660  VEVLKNTTYNGFPVVDE--ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V +L+ T +NGFPVVDE     +  L G+VLR HLL++LKK+ F H          +  F
Sbjct  564  VHLLRATKHNGFPVVDEPPNSESPVLFGLVLRAHLLMLLKKREFSHTPALVGVDAFK-HF  622

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S+ D A+R      +IED+ ++++EMEM+VDLHP  NT+P+TV E++S+AKA++LFRQVG
Sbjct  623  SFDDFAKRGSGKGDQIEDIELSDEEMEMFVDLHPFANTSPYTVVETMSLAKALILFRQVG  682

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK    G +PVVGILTR D    ++L + P+L  S+
Sbjct  683  LRHLLVVPKTH--GRAPVVGILTRHDFMPEHVLGLHPYLKGSQ  723



>ref|XP_009401373.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=786

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 158/223 (71%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD++++LKGLP+L+A+ EP+MR +TVG++  V  P+    G+EKV  I
Sbjct  550  SKTVADVFNADVYDMLVKLKGLPYLEAHAEPYMRQLTVGDV--VGGPLQIFNGVEKVSNI  607

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V +LK T ++GFPVVDE   ++   L G++LR HLL++LKKK F+H R        + +F
Sbjct  608  VHLLKTTGHHGFPVVDEPPFSSSPVLFGLILRAHLLVLLKKKTFLHARTLVSIDVSK-QF  666

Query  486  SWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R  GK   IE + +T +EM+MYVDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  667  SAEDFAKRGSGKHENIEGIDLTAEEMDMYVDLHPYTNTSPYTVVETMSLAKALILFREVG  726

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    +IL   P L +S+
Sbjct  727  LRHLLVIPK--SSSRAPVVGILTRHDFMPEHILGTHPFLLQSR  767



>gb|KHG07842.1| Chloride channel CLC-c -like protein [Gossypium arboreum]
Length=700

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 152/218 (70%), Gaps = 9/218 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD FN  +YD I++LKGLP+++A+ EP+M+++   ++  V  P++T  G+EKVG I
Sbjct  483  SKTVGDMFNHGVYDQIVKLKGLPYMEAHAEPYMKHLVARDV--VSGPLITFSGVEKVGNI  540

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrte--ewevrE  493
            +  LK T +NGFPV+DE   A   EL G+VLR+HLL++LK K F  +R  +         
Sbjct  541  LHALKTTGHNGFPVIDEPPFADAPELCGLVLRSHLLVLLKGKIFSRDRALSGDEVVRRIS  600

Query  492  KFSWVDLAERWG-KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGL  316
            KF +       G K+ED+ + ++EM+MYVDLHP+TNT+P+TV E++S+AKA VLFRQ+GL
Sbjct  601  KFDFAKAGSGKGVKLEDLDIKDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRQLGL  660

Query  315  RHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            RHM +VPK Q  G  P+VGILTR D    +IL ++PH+
Sbjct  661  RHMCVVPKSQ--GRPPIVGILTRHDFLPEHILGLYPHI  696



>ref|XP_009618449.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=782

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 150/223 (67%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I+++KGLP+L+A+ EP+MR +  G++     P++T  G+EKVG I
Sbjct  564  SKTVADCFNKGVYDQIVKMKGLPYLEAHAEPYMRQLVAGDVC--SGPLITFSGVEKVGNI  621

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  LK T +NGFPV+D      A E  G+ LR+HLL++LK K F      +    +R  F
Sbjct  622  IHALKFTRHNGFPVIDAPPFSDAPEFCGLALRSHLLVLLKGKKFTKLSVLSGSSILR-SF  680

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K+ED++ T++EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+G
Sbjct  681  HAFDFAKPGSGKGPKLEDLSFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRQLG  740

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK +  G  P+VGILTR D    +I  ++PHL   K
Sbjct  741  LRHLCVVPK-KTTGRDPIVGILTRHDFMPEHIKGLYPHLVHHK  782



>ref|XP_008786445.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=778

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 155/223 (70%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLP+++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  560  SKTVADSFNLGVYDQIVKMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNI  617

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPV+DE     A EL G+VLR+HLL++LK K F  ER RT   E+ ++F
Sbjct  618  VHALRLTGHNGFPVIDEPPFSDAPELCGLVLRSHLLVLLKGKRFTKERVRTGVTELLQRF  677

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K ED+ +  +EM+MYVDLHP+TNT+P+TV E++S+AKA VLFRQ+G
Sbjct  678  GAFDFAKPGSGKGLKFEDLDIQEEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRQLG  737

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G  P+VGILTR D    +IL +FPH    K
Sbjct  738  LRHLCVVPK--TPGRPPIVGILTRHDFVPEHILGLFPHFNPHK  778



>ref|XP_011084085.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Sesamum indicum]
Length=787

 Score =   202 bits (513),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 154/222 (69%), Gaps = 13/222 (6%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD  + +IYDII+ LKGLPFL A+ EP+MR +TVG++  V+ P+    G EKVG +
Sbjct  543  SKAVGDAISGNIYDIIMTLKGLPFLKAHAEPYMRQLTVGDV--VRGPLQIFHGFEKVGNV  600

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVV+    +    L G++LR HLL++LK K F+        + +R +F
Sbjct  601  VNVLKTTQHNGFPVVENPPFSASPVLFGLILRAHLLILLKSKTFLRTPAPAGRYAIR-RF  659

Query  486  SWVDLAERWG-----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            S  D A +WG      IED+ ++ +EM+MYVDLHP TNT+P+TV E++S+AKA+ LFR+V
Sbjct  660  SDDDFA-KWGFGHDDNIEDIELSEEEMDMYVDLHPFTNTSPYTVVETMSLAKALKLFREV  718

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAK  196
            GLRH+L++PK+  +G  PVVGILTR D    +IL + P LA+
Sbjct  719  GLRHLLVIPKF--SGRIPVVGILTRHDFMPEDILNLHPRLAR  758



>ref|XP_009791971.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
 emb|CAA64829.1| C1C-Nt1 [Nicotiana tabacum]
Length=780

 Score =   201 bits (512),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 150/223 (67%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I+++KGLP+L+A+ EP+MR +  G++     P++T  G+EKVG I
Sbjct  562  SKTVADCFNHGVYDQIVKMKGLPYLEAHAEPYMRQLVAGDVC--SGPLITFSGVEKVGNI  619

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  LK T +NGFPV+D      A E  G+ LR+HLL++LK K F      +    +R  F
Sbjct  620  IHALKFTRHNGFPVIDAPPFSDAPEFCGLALRSHLLVLLKAKKFTKLSVLSGSSILR-SF  678

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K+ED++ T++EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+G
Sbjct  679  HAFDFAKPGSGKGPKLEDLSFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRQLG  738

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK +  G  P+VGILTR D    +I  ++PHL   K
Sbjct  739  LRHLCVVPK-KTTGRDPIVGILTRHDFMPEHIKGLYPHLVHHK  780



>ref|XP_009411882.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score =   201 bits (512),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 151/219 (69%), Gaps = 10/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD +++LKG PF++A+ EP+MRN+  G++  V  P++TL G+EKVG I
Sbjct  561  SKTVADCFNKGVYDQMVKLKGFPFMEAHAEPYMRNLKAGDV--VSGPLITLAGVEKVGNI  618

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  LK T +NGFPVV+E     A EL G+ L++HLL++LK K F  ER  T   +V  +F
Sbjct  619  VHALKWTRHNGFPVVNEPPFSDARELCGLALKSHLLVLLKGKGFTKERVSTGAADVLRRF  678

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+E++ + + EMEMYVDLHP+ N +P+TV E++S+AKA VLFR++G
Sbjct  679  DPFDFAKAGSGKGVKLEELDIDDAEMEMYVDLHPIVNRSPYTVKETMSLAKAAVLFRELG  738

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRH+ +VPK  + G SPV GILTR D    +IL  FPHL
Sbjct  739  LRHLCVVPK--SPGGSPVAGILTRHDFMPEHILGRFPHL  775



>ref|XP_011084086.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Sesamum indicum]
Length=651

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 154/222 (69%), Gaps = 13/222 (6%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD  + +IYDII+ LKGLPFL A+ EP+MR +TVG++  V+ P+    G EKVG +
Sbjct  407  SKAVGDAISGNIYDIIMTLKGLPFLKAHAEPYMRQLTVGDV--VRGPLQIFHGFEKVGNV  464

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVV+    +    L G++LR HLL++LK K F+        + +R +F
Sbjct  465  VNVLKTTQHNGFPVVENPPFSASPVLFGLILRAHLLILLKSKTFLRTPAPAGRYAIR-RF  523

Query  486  SWVDLAERWG-----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            S  D A +WG      IED+ ++ +EM+MYVDLHP TNT+P+TV E++S+AKA+ LFR+V
Sbjct  524  SDDDFA-KWGFGHDDNIEDIELSEEEMDMYVDLHPFTNTSPYTVVETMSLAKALKLFREV  582

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAK  196
            GLRH+L++PK+  +G  PVVGILTR D    +IL + P LA+
Sbjct  583  GLRHLLVIPKF--SGRIPVVGILTRHDFMPEDILNLHPRLAR  622



>ref|XP_009358559.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 155/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+  D FN +IYD+I++ KGLP+L+++ EP+MR +TV ++  V  P+    GIEKVG I
Sbjct  546  SKTTADAFNSNIYDLIMKAKGLPYLESHVEPYMRQLTVADV--VTGPLQLFQGIEKVGNI  603

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L G+VLR HL+ +LKKK F+     T     +  F
Sbjct  604  VHVLRTTGHNGFPVIDEPPLSETPVLFGIVLRAHLIELLKKKAFVSNPVLTSTDSFKL-F  662

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S VD A+R      KIED+ +T +EMEM++DLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  663  SSVDFAKRGSGKGDKIEDIELTEEEMEMFIDLHPFTNTSPYTVVETMSLAKALILFREVG  722

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +  +PVVGILTR D    +IL++ P L  S+
Sbjct  723  LRHLLVIPKL--SNRTPVVGILTRHDFMPEHILSLHPMLVSSR  763



>ref|XP_010930514.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=778

 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 155/223 (70%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLP+++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  560  SKTVADSFNLGVYDQIVKMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFAGVEKVGNI  617

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPV+DE     A EL G+VLR+HLL++LK K F  ER RT   E+ ++F
Sbjct  618  VHALRLTGHNGFPVIDEPPFSDAPELCGLVLRSHLLVLLKGKRFTKERVRTGVGELLQRF  677

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K ED+ +  +EM+MY+DLHP+TNT+P+TV E++S+AKA VLFRQ+G
Sbjct  678  GAFDFAKPGSGKGMKFEDLDIQEEEMDMYLDLHPITNTSPYTVVETMSLAKAAVLFRQLG  737

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G  P+VGILTR D    +IL +FPH    K
Sbjct  738  LRHLCVVPK--TPGRPPIVGILTRHDFVPEHILGLFPHFNPHK  778



>gb|AAQ56538.1| putative chloride channel [Oryza sativa Japonica Group]
 gb|AAQ56565.1| putative chloride channel protein [Oryza sativa Japonica Group]
 dbj|BAC92420.1| putative chloride channel protein [Oryza sativa Japonica Group]
 gb|EAZ06475.1| hypothetical protein OsI_28712 [Oryza sativa Indica Group]
 gb|EAZ42255.1| hypothetical protein OsJ_26819 [Oryza sativa Japonica Group]
 dbj|BAG89940.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39689.1| putative chloride channel [Oryza sativa Indica Group]
Length=796

 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 153/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN SIYD+IL LKGLP LD + EP+MR +TVG++  V  P+ +  G+EKVG I
Sbjct  551  SKTVADSFNSSIYDLILNLKGLPHLDGHAEPYMRQLTVGDV--VAGPLRSFNGVEKVGHI  608

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T ++ FPVVDE     A  L+G+VLR HLL++LKK+ F+    R  +  +  +F
Sbjct  609  VHTLRTTGHHAFPVVDEPPFSPAPVLYGLVLRAHLLVLLKKREFLTAPVRCPKDYMAGRF  668

Query  486  SWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D  +R  GK   I DV ++ +EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VG
Sbjct  669  EAQDFDKRGSGKQDTIADVELSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVG  728

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK  +   SPVVGILTR D    +IL + P L  S+
Sbjct  729  LRHLLVVPK--SCDRSPVVGILTRHDFMPEHILGLHPVLVGSR  769



>gb|KJB40519.1| hypothetical protein B456_007G067500 [Gossypium raimondii]
Length=767

 Score =   201 bits (511),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 154/218 (71%), Gaps = 9/218 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD FN  +YD I++LKGLP+++A+ EP+M+++   ++  V  P++T  G+EKVG I
Sbjct  550  SKTVGDMFNHGVYDQIVKLKGLPYMEAHAEPYMKHLVARDV--VSGPLITFSGVEKVGNI  607

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewev--rE  493
            +  LK T +NGFPV+DE   A   EL G+VLR+HLL++LK K F  +R  + +  V    
Sbjct  608  LHALKTTGHNGFPVIDEPPFADAPELCGLVLRSHLLVLLKGKIFSRDRVLSGDEVVHRIS  667

Query  492  KFSWVDLAERWG-KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGL  316
            KF +       G K+ED+ + ++EM+MYVDLHP+TNT+P+TV E++S+AKA VLFRQ+GL
Sbjct  668  KFDFAKAGSGKGVKLEDLDIKDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVLFRQLGL  727

Query  315  RHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            RHM +VPK Q  G  P+VGILTR D    +IL ++PH+
Sbjct  728  RHMCVVPKSQ--GRPPIVGILTRHDFLPEHILGLYPHI  763



>ref|XP_008242835.1| PREDICTED: putative chloride channel-like protein CLC-g [Prunus 
mume]
Length=775

 Score =   201 bits (511),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 151/221 (68%), Gaps = 9/221 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+  D FN +IYD+I++ KGLP+L+A+ EP+MR +TV ++  V  P+    GIEKVG I
Sbjct  545  SKTTADAFNDNIYDLIMKAKGLPYLEAHVEPYMRQLTVADV--VTGPLQLFYGIEKVGNI  602

Query  660  VEVLKNTTYNGFPVVDEERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFSW  481
            V VL+ T +NGFPV+DE   +  L G+VLR HL+ +LKKK F+     T     + +FS 
Sbjct  603  VHVLRTTGHNGFPVIDELSESPVLFGIVLRAHLIELLKKKAFVSTPVPTSTDSFK-QFSS  661

Query  480  VDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGLR  313
             D A+R      KIED+ +  +EMEM++DLHP TN +P+TV E++S+AKA++LFR+VGLR
Sbjct  662  EDFAKRGSGNGDKIEDIKLNEEEMEMFIDLHPFTNASPYTVVETMSLAKALILFREVGLR  721

Query  312  HMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            H+L++PK      SPVVGILTR D    +IL++ P L  S+
Sbjct  722  HLLVIPKISTR--SPVVGILTRHDFMPEHILSLNPTLVNSR  760



>ref|XP_010928311.1| PREDICTED: putative chloride channel-like protein CLC-g [Elaeis 
guineensis]
Length=790

 Score =   201 bits (511),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 158/223 (71%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD IL+LKGLP+L+ + EP+MR +TV ++  V  P+ T  G+E+VG I
Sbjct  549  SKTVADSFNANIYDQILKLKGLPYLEGHAEPYMRQLTVSDV--VTGPLQTFNGVERVGNI  606

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T ++GFPV+DE   ++   L G++LR HLL++LKKK F+   R     +  + F
Sbjct  607  VHVLKTTGHHGFPVIDEPPFSSTPVLFGLILRAHLLVLLKKKDFL-PTRSRSNVDASKMF  665

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+R      +IED+ +T +EMEM++DLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  666  VANDFAKRSSGKHDRIEDIELTAEEMEMFLDLHPFTNTSPYTVVETMSLAKALILFREVG  725

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK  ++  +PVVGILTR D    +IL + P+L +S+
Sbjct  726  LRHLLVVPK--SSPRAPVVGILTRHDFMPEHILGLHPYLMRSR  766



>ref|XP_004979167.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Setaria italica]
Length=793

 Score =   201 bits (510),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 153/224 (68%), Gaps = 11/224 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN SIYD+IL+LKGLP LD + EP+MR +TVG++  V  P+ +  G+EKVG I
Sbjct  548  SKTVADSFNSSIYDLILQLKGLPHLDGHAEPYMRQLTVGDV--VAGPLRSFNGVEKVGNI  605

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrte-ewevrEK  490
            V +L+ T +N FPVVDE     A  L+G+VLR HLL++LKK+ F+  +     +  V  +
Sbjct  606  VHILRTTGHNAFPVVDEPPFSPAPVLYGLVLRAHLLVLLKKREFLRAQELRYPKEYVAGR  665

Query  489  FSWVDLAERWGKIED----VAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            F   D  +R    +D    V ++ +EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+V
Sbjct  666  FQAEDFDKRGSGKQDTIGAVQLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREV  725

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            GLRH+L+VPK  A   SPVVGILTR D    +IL + P L  S+
Sbjct  726  GLRHLLVVPK--ACDRSPVVGILTRHDFMPEHILGLHPVLLGSR  767



>ref|XP_008368156.1| PREDICTED: chloride channel protein CLC-c-like [Malus domestica]
Length=778

 Score =   201 bits (510),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 155/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  IYD I+++KGLP+L+A+ EP+MR +   ++A    P+VT  GIEKVGRI
Sbjct  560  SKTVADNFNKGIYDQIVKIKGLPYLEAHAEPYMRQLVTADVA--TGPLVTFSGIEKVGRI  617

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            ++ L+ T +NGFPV+DE     A EL G+VLR+HLL++LK K F  ER   EE  +  +F
Sbjct  618  LDALRTTGHNGFPVIDEPPFSDAPELCGLVLRSHLLILLKGKVFSRERVVCEEEILG-RF  676

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            +  + A+       K+ED+ +  +EM+MYVDLHP+TN +P+TV E++S+AKA +LFRQ+G
Sbjct  677  AAFNFAKAGSGKGIKVEDLDIEEEEMDMYVDLHPITNASPYTVVETMSLAKAAILFRQLG  736

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK Q  G  P+VGILTR D    +IL ++PH+   K
Sbjct  737  LRHLCLVPKSQ--GRPPIVGILTRHDFMPEHILGLYPHIKAHK  777



>ref|XP_010241599.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g [Nelumbo nucifera]
Length=781

 Score =   201 bits (510),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 157/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYDII++LKGLP+L+A+ EP+MR +TVG++  V  P+    GIEKV  I
Sbjct  544  SKTVADTFNQNIYDIIMKLKGLPYLEAHAEPYMRQLTVGDV--VTGPLQCFNGIEKVRNI  601

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T ++GFPV+D+  V+    L G+VLR HL+++LKKK F+     T    ++ +F
Sbjct  602  VNVLKATGHHGFPVIDQPPVSDSPVLSGLVLRAHLIVLLKKKAFLSTPMLTSSDFMK-QF  660

Query  486  SWVDLAERW-GKIEDV---AVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R  G  ED+    VT +EM+M++DLHP TN +P+TV E++S+AK+++LFR VG
Sbjct  661  SANDFAKRGSGNNEDIYNIEVTEEEMDMFIDLHPFTNASPYTVVETMSLAKSLILFRGVG  720

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK   +  SPVVGILTR D    +IL ++P L KS+
Sbjct  721  LRHLLVVPK--TSNWSPVVGILTRHDFMPEHILGLYPXLQKSR  761



>gb|AFW70592.1| hypothetical protein ZEAMMB73_317914 [Zea mays]
Length=648

 Score =   199 bits (506),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 154/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN SIYD+IL LKGLP LD + EP+MR + VG++  V  P+ +  G+EKVG +
Sbjct  404  SKTVADSFNSSIYDLILRLKGLPHLDGHAEPYMRQLAVGDV--VAGPLRSFGGVEKVGNV  461

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T ++ FPVVDE     A  L+G+VLR HLL++LKK+ F+    R  +  V E+F
Sbjct  462  VHTLRTTGHHAFPVVDEPPFSPAPVLYGLVLRAHLLVLLKKREFLVAPERCPKEYVAERF  521

Query  486  SWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D  +R  GK   I DV ++ +EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VG
Sbjct  522  QAEDFDKRGSGKQDTIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVG  581

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK  A   SPVVGILTR D    +IL + P L +S+
Sbjct  582  LRHLLVVPK--ACDRSPVVGILTRHDFMPEHILELHPVLLRSR  622



>ref|XP_010241600.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nelumbo nucifera]
Length=765

 Score =   200 bits (509),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 156/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYDII++LKG P+L+A+ EP+MR +TVG++  V  P+    GIEKV  I
Sbjct  544  SKTVADTFNQNIYDIIMKLKGFPYLEAHAEPYMRQLTVGDV--VTGPLQCFNGIEKVRNI  601

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T ++GFPV+DE  V+ +  L G+VLR HL+++LKKK F+     T     + +F
Sbjct  602  VHVLKTTGHHGFPVIDEPPVSYDPVLSGLVLRDHLIVLLKKKAFLSTPILTRSDVTK-QF  660

Query  486  SWVDLAER----WGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R    +  I+++ VT +EM+M++DLHP TN +P+TV E++S+AKA++LFR+VG
Sbjct  661  SANDFAKRGSTKYETIDNIEVTEEEMDMFIDLHPFTNASPYTVLETMSLAKALILFRKVG  720

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK      SPVVGILTR D    ++L + P L +S+
Sbjct  721  LRHLLVVPKTSTR--SPVVGILTRHDFMPEHVLGLHPFLLESR  761



>ref|XP_011020210.1| PREDICTED: putative chloride channel-like protein CLC-g [Populus 
euphratica]
Length=806

 Score =   200 bits (509),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 155/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+  KG P+L+A+ EP+MR +TVG++  V  P+    GIE+VG+I
Sbjct  574  SKTVADAFNGNIYDLIMNAKGFPYLEAHTEPYMRQLTVGDV--VCGPLQIFRGIEQVGKI  631

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L+G++LR HLL +LKKK F+     T     +  F
Sbjct  632  VHVLRTTRHNGFPVIDEPPLSESPVLYGLILRAHLLELLKKKAFVPTPVPTGTDAFKL-F  690

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R      KIED+  T +EMEM++DLHP TN +P+TV+E++S+AKA++LFR+VG
Sbjct  691  SADDFAKRGSGNGDKIEDLQFTEEEMEMFLDLHPFTNASPYTVAETMSLAKALILFREVG  750

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +G  PVVGILTR D    +IL + P L +S+
Sbjct  751  LRHLLVIPKI--SGRPPVVGILTRHDFMPGHILGLHPMLIRSR  791



>ref|XP_004508447.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Cicer arietinum]
Length=777

 Score =   200 bits (509),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 155/223 (70%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +KSV + FN ++YD+I++ KGLP+L+ + EP+MR +TVG++  V  P+    GIEKV  I
Sbjct  541  SKSVANIFNANVYDLIMKAKGLPYLETHAEPYMRQLTVGDV--VTGPLQMFNGIEKVRNI  598

Query  660  VEVLKNTTYNGFPVVDEER--VATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            + VL+ TT+NGFPV+DE R   A  L G++LR HLL +LKKK F+        ++V  +F
Sbjct  599  MFVLRTTTHNGFPVIDEPRHSEAPVLFGIILRDHLLTLLKKKAFLPAPVVENSYDVLREF  658

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A++      KIED+ +T++EM M++DLHP TN +P+TV E++S+AKA++LFR+VG
Sbjct  659  SADDFAKKGSGERIKIEDIQLTDEEMGMFIDLHPFTNASPYTVVETMSLAKALILFREVG  718

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK    G  PVVGILTR D    +IL + P L +S+
Sbjct  719  LRHLLVIPKIP--GRWPVVGILTRHDFMPEHILGMHPFLVRSR  759



>ref|XP_004287270.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Fragaria vesca subsp. vesca]
Length=752

 Score =   200 bits (508),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 149/223 (67%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+  D FN +IYD+I++ KGLP+L  + EP+MR +TV ++  V  P+    GIEKVG I
Sbjct  520  SKTTADVFNSNIYDLIMKAKGLPYLKGHAEPYMRQLTVSDV--VTGPLQLFNGIEKVGNI  577

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE        L G+VLR HL+ +LKKK F+         +  E+F
Sbjct  578  VHVLRTTGHNGFPVIDESPPPEPPILFGLVLRAHLIELLKKKAFV-STPVRTTTDAFEQF  636

Query  486  SWVDLAERW----GKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R      KIED+ +T +EMEMY+DLHP TN +P+TV E++S+AKA++LFRQVG
Sbjct  637  SSEDFAKRGLGNGDKIEDIELTEEEMEMYIDLHPFTNASPYTVVETMSLAKALILFRQVG  696

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  +  +SP+VGILTR D    +I  + P L  SK
Sbjct  697  LRHLLVIPKMSS--MSPIVGILTRHDFMPEHIFGIHPMLVSSK  737



>ref|XP_009599120.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=775

 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 153/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLPFL+A+ EP+MR++  G++     P+++  G+EKVG I
Sbjct  558  SKTVADSFNKGVYDQIVKMKGLPFLEAHAEPFMRHLVAGDVCS--GPLLSFSGVEKVGNI  615

Query  660  VEVLKNTTYNGFPVVDEE--RVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  LK T +NGFPV+DE     A EL G+VLR+HLL++L  K FM +R  +    +R +F
Sbjct  616  VHALKYTRHNGFPVIDEPPFSEAPELCGLVLRSHLLVLLNGKKFMKQRVLSGSSILR-RF  674

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K ED+ +T +EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+G
Sbjct  675  HAFDFAKPGSGKGLKFEDLVITQEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLG  734

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G +P+ GILTR D    +I  ++PHL   K
Sbjct  735  LRHLCVVPK--KTGRAPIAGILTRHDFMHEHISNLYPHLVPHK  775



>ref|XP_004287269.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Fragaria vesca subsp. vesca]
Length=780

 Score =   200 bits (508),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 149/223 (67%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+  D FN +IYD+I++ KGLP+L  + EP+MR +TV ++  V  P+    GIEKVG I
Sbjct  548  SKTTADVFNSNIYDLIMKAKGLPYLKGHAEPYMRQLTVSDV--VTGPLQLFNGIEKVGNI  605

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE        L G+VLR HL+ +LKKK F+         +  E+F
Sbjct  606  VHVLRTTGHNGFPVIDESPPPEPPILFGLVLRAHLIELLKKKAFV-STPVRTTTDAFEQF  664

Query  486  SWVDLAERW----GKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R      KIED+ +T +EMEMY+DLHP TN +P+TV E++S+AKA++LFRQVG
Sbjct  665  SSEDFAKRGLGNGDKIEDIELTEEEMEMYIDLHPFTNASPYTVVETMSLAKALILFRQVG  724

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  +  +SP+VGILTR D    +I  + P L  SK
Sbjct  725  LRHLLVIPKMSS--MSPIVGILTRHDFMPEHIFGIHPMLVSSK  765



>ref|XP_002530769.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF31629.1| chloride channel clc, putative [Ricinus communis]
Length=775

 Score =   200 bits (508),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 151/222 (68%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I++ KG P+L+ + EP+MR +TV ++  V  P+    GIEKVG I
Sbjct  544  SKTVADAFNGNIYDLIMKAKGFPYLETHAEPYMRQLTVSDV--VMGPLQLFHGIEKVGNI  601

Query  660  VEVLKNTTYNGFPVVDEERVATE-LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKFS  484
            V VLK T +NGFPV+DE  + +  L+G++LR HL+ +LK K F +          + +FS
Sbjct  602  VHVLKTTRHNGFPVIDEPPLESPVLYGLILRAHLIELLKNKVFSYTPVPISNDAFK-QFS  660

Query  483  WVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVGL  316
              D A+R      KIEDV +T +EMEM++DLHP TN +P+TV E++S+AKA VLFR+VGL
Sbjct  661  PGDFAKRGSGNGDKIEDVEITEEEMEMFLDLHPFTNASPYTVVETMSLAKACVLFREVGL  720

Query  315  RHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            RH+L++PK  +   SPVVGILTR D    +IL + P LA S+
Sbjct  721  RHLLVIPKISSR--SPVVGILTRHDFMPEHILGLHPFLASSR  760



>ref|XP_009768532.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
Length=775

 Score =   200 bits (508),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 153/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLPFL+A+ EP+MR++  G++     P+++  G+EKVG I
Sbjct  558  SKTVADSFNKGVYDQIVKMKGLPFLEAHAEPFMRHLVAGDVCS--GPLLSFSGVEKVGNI  615

Query  660  VEVLKNTTYNGFPVVDEE--RVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  LK T +NGFPV+DE     A EL G+VLR+HLL++L  K FM +R  +    +R +F
Sbjct  616  VHALKYTRHNGFPVIDEPPFSEAPELCGLVLRSHLLVLLNGKKFMKQRVLSGSSILR-RF  674

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K ED+ +T +EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+G
Sbjct  675  HAFDFAKPGSGKGLKFEDLVITQEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLG  734

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G +P+ GILTR D    +I  ++PHL   K
Sbjct  735  LRHLCVVPK--KTGRAPIAGILTRHDFMHEHISNLYPHLVPHK  775



>ref|XP_008644088.1| PREDICTED: uncharacterized protein LOC100383583 isoform X1 [Zea 
mays]
Length=793

 Score =   199 bits (507),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 154/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN SIYD+IL LKGLP LD + EP+MR + VG++  V  P+ +  G+EKVG +
Sbjct  549  SKTVADSFNSSIYDLILRLKGLPHLDGHAEPYMRQLAVGDV--VAGPLRSFGGVEKVGNV  606

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T ++ FPVVDE     A  L+G+VLR HLL++LKK+ F+    R  +  V E+F
Sbjct  607  VHTLRTTGHHAFPVVDEPPFSPAPVLYGLVLRAHLLVLLKKREFLVAPERCPKEYVAERF  666

Query  486  SWVDLAERW-GK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D  +R  GK   I DV ++ +EMEMYVDLHP TNT+P+TV E++S+AKA+VLFR+VG
Sbjct  667  QAEDFDKRGSGKQDTIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVG  726

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK  A   SPVVGILTR D    +IL + P L +S+
Sbjct  727  LRHLLVVPK--ACDRSPVVGILTRHDFMPEHILELHPVLLRSR  767



>ref|XP_008336976.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=778

 Score =   199 bits (507),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+  D FN +IYD+I++ KGLP+L+++ EP+MR +TV ++  V  P+    G EKVG I
Sbjct  546  SKTTADAFNSNIYDLIMKAKGLPYLESHVEPYMRQLTVADV--VTGPLQLFQGXEKVGNI  603

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L G+VLR HL+ +LKKK F+           +  F
Sbjct  604  VHVLRTTGHNGFPVIDEPPLSETPVLFGIVLRAHLIELLKKKAFVSNPVLASXDSFKL-F  662

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S VD A+R      KIED+ +T +EMEM++DLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  663  SSVDFAKRGSGKGDKIEDIELTEEEMEMFIDLHPFTNTSPYTVVETMSLAKALILFREVG  722

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK      +PVVGILTR D    +IL++ P L  S+
Sbjct  723  LRHLLVIPKLSXR--TPVVGILTRHDFMPEHILSLHPMLVSSR  763



>ref|NP_001275140.1| chloride channel protein CLC-c-like [Solanum tuberosum]
 emb|CAA71369.1| chloride channel Stclc1 [Solanum tuberosum]
Length=764

 Score =   199 bits (507),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLPFL+A+ EP+MRN+  G++     P+++  G+EKVG I
Sbjct  547  SKTVADIFNKGVYDQIVKMKGLPFLEAHAEPFMRNLVAGDVCS--GPLLSFSGVEKVGNI  604

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  LK T +NGFPV+DE   +   EL G+VLR+HLL++L  K F  +R  +    +  +F
Sbjct  605  VHALKYTRHNGFPVIDEPPFSETPELCGLVLRSHLLVLLNGKKFTKQRVLSASNILS-RF  663

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K ED+ +T +EMEMY+DLHP+TNT+P+TV E++S+AKA +LFRQ+G
Sbjct  664  HAFDFAKPGSGKGLKFEDLVITEEEMEMYIDLHPITNTSPYTVVETMSLAKAAILFRQLG  723

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G +P+VGILTR D    +I  ++PHL   K
Sbjct  724  LRHLCVVPK--KTGRAPIVGILTRHDFMHEHISNLYPHLVPHK  764



>ref|XP_010099780.1| Chloride channel protein CLC-c [Morus notabilis]
 gb|EXB80398.1| Chloride channel protein CLC-c [Morus notabilis]
Length=763

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 151/219 (69%), Gaps = 11/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD IL LKGLP+++A+ EP+MRN+   ++  V  P+VT  GIEKVG I
Sbjct  544  SKTVADCFNKGVYDQILVLKGLPYMEAHAEPYMRNLIASDV--VSGPLVTFSGIEKVGNI  601

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  LK T +NGFPV+DE  +  A EL G+VLR+HLL++LK K F  +R  T    +R K 
Sbjct  602  LLALKITRHNGFPVIDEPPLSDAPELCGLVLRSHLLVLLKGKKFSEQRVMTGSQIMR-KI  660

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+ED+ +T  EMEMYVDLHP+TN +P+TV E++S+AKA VLFR +G
Sbjct  661  KAHDFAKAGSGKGIKLEDLDITEAEMEMYVDLHPITNASPYTVVETMSLAKAAVLFRDLG  720

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRH+L+VPK    G  P+VGILTR D    ++L ++PH+
Sbjct  721  LRHLLVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPHI  757



>gb|ACF78606.1| unknown [Zea mays]
Length=496

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K V D FN ++YD+++ LKG P L+   EP+MR ++V ++  V  P+ T  GIEKVG I
Sbjct  264  SKVVADAFNANVYDLLVRLKGFPHLEGYAEPYMRQLSVSDV--VTGPLQTFNGIEKVGHI  321

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE   +    L+G++LR HLL++L+KK F+     +    +   F
Sbjct  322  VHVLKTTGHNGFPVVDEPPFSDTPTLYGLILRDHLLVLLRKKDFIRSCTASTLNALN-HF  380

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  + A+R      +IED+ +  +E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  381  SHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVG  440

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  441  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHILGLHPFLFKSR  481



>ref|XP_009363967.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 156/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+  D FN +IYD+I++ KGLP+L+++ EP+MR +TV ++  V  P+    GIEKVG I
Sbjct  546  SKTTADAFNGNIYDLIMKAKGLPYLESHVEPYMRQLTVADV--VIGPLQLFQGIEKVGNI  603

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L+G+VLRTHL+ +LKKK F+    RT     +  F
Sbjct  604  VHVLRTTGHNGFPVIDEPPLSETPVLYGLVLRTHLIELLKKKAFVSTPVRTSTNSFKL-F  662

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S VD A+R      KIED+ +T +E EM++DLHP TN +P+TV E++S+AKA+ LFR+VG
Sbjct  663  SSVDFAKRGSGNGDKIEDIELTEEEKEMFIDLHPFTNASPYTVVETMSLAKALTLFREVG  722

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +  SPVVGILTR D    +IL++ P L +S+
Sbjct  723  LRHLLVIPKL--SNRSPVVGILTRHDFMPEHILSLHPMLVRSR  763



>gb|AFW58337.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58338.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58339.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
Length=795

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 157/222 (71%), Gaps = 10/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLPFL+A+ EP+M ++   ++  V  P+++  G+E+VG I
Sbjct  577  SKTIADSFNKGVYDQIVVMKGLPFLEAHAEPYMTHLVASDV--VSGPLISFSGVERVGNI  634

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V+ L+ T +NGFPVVDE  +  A EL G+VLR+HLL++LK K FM E+ +T    V E+F
Sbjct  635  VQALRITGHNGFPVVDEPPLSEAPELVGLVLRSHLLVLLKGKGFMKEKMKTSGSFVLERF  694

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+  T++EM++YVDLHP+TNT+P+TV E++S+AKA VLFR +G
Sbjct  695  GAFDFAKPGSGKGLKIEDLDFTDEEMDLYVDLHPITNTSPYTVVETMSLAKAAVLFRALG  754

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRHML+VPK    G  P+VGILTR D    +I  +FP++ KS
Sbjct  755  LRHMLVVPK--TPGRPPIVGILTRHDFIPEHIHGLFPNIHKS  794



>ref|XP_007155066.1| hypothetical protein PHAVU_003G170300g [Phaseolus vulgaris]
 gb|ESW27060.1| hypothetical protein PHAVU_003G170300g [Phaseolus vulgaris]
Length=800

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 153/225 (68%), Gaps = 12/225 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYDII++ KGLP+L+ + EP+MR +TVG++  V  P+ TL GIEKV  I
Sbjct  576  SKTVADAFNGNIYDIIMKAKGLPYLETHAEPYMRQLTVGDV--VTGPLQTLNGIEKVRNI  633

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V +LK T +NGFPV+DE  +  A  L G++LR HLL +LK K F+     T    +  KF
Sbjct  634  VFILKTTGHNGFPVIDEPPMSEAPVLFGIILRDHLLTLLKNKVFISSPSATTGNVLN-KF  692

Query  486  SWVDLAERWG-----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            S  D A++       KIED+ +  +EM+M++DLHP TN +P+TV E++S+ KA+ LFR++
Sbjct  693  SADDFAKKGSSKVRLKIEDIQLLEEEMDMFIDLHPFTNASPYTVVETMSLGKALTLFREL  752

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKG  187
            GLRH+L++PK  +   SPVVGILTR D    +IL + P LA++ G
Sbjct  753  GLRHLLVIPKISSR--SPVVGILTRHDFMPEHILGLHPLLARNTG  795



>ref|XP_008788814.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=790

 Score =   199 bits (505),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 156/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD IL+LKGLP+L+ + EP+MR +TV ++  V  P+ T  G+EKVG I
Sbjct  549  SKTVADSFNANIYDQILKLKGLPYLEGHAEPYMRQLTVSDV--VTGPLQTFNGVEKVGNI  606

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T ++GFPV+D+   ++   L G++LR HLL++LKKK F+         +  + F
Sbjct  607  VHALRTTGHHGFPVIDDPPFSSSPVLFGLILRAHLLVLLKKKDFL-PTCSRSGADASKMF  665

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+R      ++ED+ +T +EMEM++DLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  666  MANDFAKRSSGKHDRVEDIELTAEEMEMFIDLHPFTNTSPYTVVETMSLAKALILFREVG  725

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK  ++  +PVVGILTR D    +IL + P+L +S+
Sbjct  726  LRHLLVVPK--SSPRAPVVGILTRHDFMPEHILGLHPYLMRSR  766



>ref|XP_004248849.1| PREDICTED: chloride channel protein CLC-c-like [Solanum lycopersicum]
Length=778

 Score =   198 bits (504),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLPFL+A+ EP+MRN+  G++     P+++  G+EKVG I
Sbjct  561  SKTVADIFNKGVYDQIVKMKGLPFLEAHAEPFMRNLVAGDVCS--GPLLSFSGVEKVGNI  618

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  LK + +NGFPV+DE   +   EL G+VLR+HLL++L  K F  +R  +    +  +F
Sbjct  619  VHALKYSRHNGFPVIDEPPFSETPELCGLVLRSHLLVLLNGKKFTKQRVLSASNILS-RF  677

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K ED+ +T +EMEMY+DLHP+TNT+P+TV E++S+AKA +LFRQ+G
Sbjct  678  HAFDFAKPGSGKGLKFEDLVITEEEMEMYIDLHPITNTSPYTVVETMSLAKAAILFRQLG  737

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G +P+VGILTR D    +I  ++PHL   K
Sbjct  738  LRHLCVVPK--KTGRAPIVGILTRHDFMHEHISNLYPHLVPHK  778



>ref|XP_010250239.1| PREDICTED: putative chloride channel-like protein CLC-g [Nelumbo 
nucifera]
Length=776

 Score =   198 bits (503),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 154/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYDII++LKG P+L+A+ EP+MR +TVG++  V  P+    GIEKV  I
Sbjct  544  SKTVADTFNGNIYDIIMKLKGFPYLEAHAEPYMRQLTVGDV--VTGPLQCFNGIEKVRNI  601

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T ++GFPV+DE   +    L G+VLR HL+++LKKK F+         ++ ++F
Sbjct  602  VHVLKTTRHHGFPVIDEPPFSDCPVLSGLVLRAHLIVLLKKKVFL-PTPVLTGTDITKRF  660

Query  486  SWVDLAERWGK----IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R       IED+ VT +EM+MY+DLHP TN +P+TV E++S+AKA++LFR+VG
Sbjct  661  SANDFAKRGSGNNDHIEDIEVTEEEMDMYIDLHPFTNASPYTVVETMSLAKALILFREVG  720

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK   +  S VVG+LTR D    +IL + P L +S+
Sbjct  721  LRHLLVVPK--TSNRSSVVGVLTRHDFMPEHILGLHPFLIRSR  761



>ref|XP_008793993.1| PREDICTED: putative chloride channel-like protein CLC-g [Phoenix 
dactylifera]
Length=774

 Score =   198 bits (503),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 155/229 (68%), Gaps = 16/229 (7%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V + FN +IYD++++LKGLP+LDA  EP+MR +TV ++  +  P+    G+EKVG I
Sbjct  539  SKTVAETFNANIYDMMVKLKGLPYLDARAEPYMRQLTVSDV--LAGPLQIFNGVEKVGNI  596

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHer------rrteew  505
            V VLK T ++GFPVVD    ++   L G+VLR HLL++LKKK F+H           +  
Sbjct  597  VHVLKTTGHHGFPVVDGPPFSSSPVLFGLVLRAHLLVLLKKKEFLHACTLSGVDASKQFS  656

Query  504  evrEKFSWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMV  337
            +  ++FS  D A+R       IED+ +T +EME  +DLHP TNT+P TV E++S+AKA++
Sbjct  657  DASKQFSADDFAKRGSGRCDSIEDIELTGEEMETCIDLHPFTNTSPHTVVETMSLAKALI  716

Query  336  LFRQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LFR+VGLRH+L+VPK  ++   PVVG+LTR D    +IL ++P L KS+
Sbjct  717  LFREVGLRHLLVVPKSSSS--PPVVGMLTRHDFMPEHILGLYPLLLKSR  763



>ref|XP_002447212.1| hypothetical protein SORBIDRAFT_06g030530 [Sorghum bicolor]
 gb|EES11540.1| hypothetical protein SORBIDRAFT_06g030530 [Sorghum bicolor]
Length=814

 Score =   198 bits (503),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K V D FN ++YD+++ LKG P L+   EP+MR ++V ++  V  P+ T  GIEKVG I
Sbjct  582  SKVVADAFNANVYDLLVRLKGFPHLEGYAEPYMRQLSVSDV--VTGPLQTFNGIEKVGHI  639

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE   +    L+G++LR HLL++L+KK F+H    +        F
Sbjct  640  VHVLKTTGHNGFPVVDEPPFSDTPTLYGLILRDHLLVLLRKKDFIHSCSASTLKASN-HF  698

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  + A+R      +IED+ +  +E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  699  SHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVG  758

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  759  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHILGLHPFLFKSR  799



>ref|XP_011017857.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Populus euphratica]
 ref|XP_011017859.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Populus euphratica]
Length=775

 Score =   197 bits (502),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 154/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D F+ +I+D+I++ KG P+L+++ EP+MR  TVG++  V  P+    GIEKVG I
Sbjct  543  SKTVADAFDGNIFDLIMKAKGFPYLESHAEPYMRQFTVGDV--VTGPLQVFQGIEKVGNI  600

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L+G++LR HL+ +LKKK FM     T    ++  F
Sbjct  601  VHVLRTTRHNGFPVIDEPPLSESPVLYGLILRAHLIELLKKKAFMSAPVPTSIDALKL-F  659

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D AER      KIE++  T +EMEM++DLHP TN +P++V E++S+AKA++LFR+VG
Sbjct  660  SAGDFAERRSGNGDKIEELRFTEEEMEMFLDLHPFTNASPYSVVETMSLAKALILFREVG  719

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+ PK   +G SPVVGILTR D    +IL + P L +S+
Sbjct  720  LRHLLVTPKI--SGRSPVVGILTRHDFMPEHILGLHPLLIRSR  760



>ref|XP_002454002.1| hypothetical protein SORBIDRAFT_04g022890 [Sorghum bicolor]
 gb|EES06978.1| hypothetical protein SORBIDRAFT_04g022890 [Sorghum bicolor]
Length=817

 Score =   197 bits (502),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 155/223 (70%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLPF++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  591  SKTIADNFNKGVYDQIVVMKGLPFMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNI  648

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  +  A EL G+V R+HLL++L  K FM ER +T    V  +F
Sbjct  649  VHALRLTGHNGFPVVDEPPITEAPELVGLVTRSHLLVLLNSKNFMKERFKTSGSFVLRRF  708

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+  T++EM+MYVDLHP+TNT+P+TV E++S+AKA +LFR++G
Sbjct  709  GAFDFAKPGSGKGLKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAILFRELG  768

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK       P+VGILTR D    +I ++FP+L   K
Sbjct  769  LRHLLVVPK--TPDRPPIVGILTRHDFMPEHIHSLFPNLNPHK  809



>ref|XP_008354360.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=773

 Score =   197 bits (501),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 155/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+  D FN +IYD+I++ KGLP+L+++ EP+MR +TV ++  V  P+    GIEKVG I
Sbjct  541  SKTTADAFNGNIYDLIMKAKGLPYLESHVEPYMRQLTVADV--VIGPLQLFQGIEKVGNI  598

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L+G+VLR HL+ +LKKK F+    RT     +  F
Sbjct  599  VHVLRTTGHNGFPVIDEPPLSETPVLYGLVLRAHLIELLKKKAFVSTPVRTSTNSFKL-F  657

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S VD A+R      KIED+ +T +E EM++DLHP TN +P+TV E++S+AKA+ LFR+VG
Sbjct  658  SSVDFAKRGSGNGDKIEDIELTEEEKEMFIDLHPFTNASPYTVVETMSLAKALTLFREVG  717

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +  SPVVGILTR D    +IL++ P L +S+
Sbjct  718  LRHLLVIPKL--SNRSPVVGILTRHDFXPEHILSLHPMLVRSR  758



>ref|XP_006359489.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Solanum tuberosum]
Length=767

 Score =   197 bits (501),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+  KG P+L+ + EP++R ++V ++  V  P+    GIEKVG I
Sbjct  535  SKTVADAFNGNIYDLIMRAKGFPYLERHAEPYLRQLSVSDV--VTGPLQFFNGIEKVGNI  592

Query  660  VEVLKNTTYNGFPVVDE--ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE    VA  L G+VLR HL+ +LKKK F+             +F
Sbjct  593  VHVLKTTGHNGFPVVDEPPHSVAPVLFGLVLRAHLVTLLKKKAFLQNPVPAGVDTFA-QF  651

Query  486  SWVDLAERW----GKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A++      ++ED+ + ++EM+M++DLHP  NT+PFTV E++S+AKA++LFR+VG
Sbjct  652  SADDFAKKGLDHGDRVEDIQLADEEMDMFIDLHPFCNTSPFTVVETMSLAKALMLFREVG  711

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +G  PVVGI+TR D    ++L++ P LAKSK
Sbjct  712  LRHLLVIPK--VSGRIPVVGIITRHDFMPEHVLSLHPSLAKSK  752



>ref|XP_007152471.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
 gb|ESW24465.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
Length=807

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 154/225 (68%), Gaps = 11/225 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD+IL++KGLP+L+A+ EP+M+N+  G++  V  P++T  GIEKVG I
Sbjct  570  SKTVADSFNKGVYDLILQIKGLPYLEAHAEPYMKNLVAGDV--VSGPLITFSGIEKVGII  627

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
               L  T +NGFPV+DE     A EL G+VLR+HLL++LK+K F +++   ++   + + 
Sbjct  628  WHALSATGHNGFPVIDEPPFTDAPELCGLVLRSHLLVLLKEKIFSNDKNFIDQSSFQ-RI  686

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S +D  +       K+ED+ +  ++M+MYVDLHP+TN +P+TV E++ +AKA ++FRQ G
Sbjct  687  SALDFGKAGSGKGIKLEDLDIDEEDMDMYVDLHPITNASPYTVVETMPLAKAAIIFRQHG  746

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGS  184
            LRHM +VPK Q  G  PVVGILTR D    ++L ++PH+   K S
Sbjct  747  LRHMCVVPKSQ--GRPPVVGILTRHDFMPEHVLGLYPHIKSQKQS  789



>ref|XP_003609433.1| hypothetical protein MTR_4g115640 [Medicago truncatula]
 gb|AES91630.1| ClC chloride channel family protein [Medicago truncatula]
Length=776

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 153/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +KSV + FN ++YD+I++ KGLP+L+ + EP+MR +TVG++  V  P+    GIEKV  I
Sbjct  541  SKSVANVFNANVYDLIMKAKGLPYLETHAEPYMRQLTVGDV--VTGPLQMFNGIEKVRNI  598

Query  660  VEVLKNTTYNGFPVVDEE--RVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V +L+ T +NGFPV+DE     A  L G++LR HL  +LKKK F+        ++V  KF
Sbjct  599  VFILRTTAHNGFPVIDEPPGSEAPILFGIILRHHLTTLLKKKAFL-PSPVANSYDVVRKF  657

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+++     KIED+ +T +EM M+VDLHP TN +P+TV E++S+AKA++LFR+VG
Sbjct  658  SSDDFAKKYSVERVKIEDIQLTEEEMGMFVDLHPFTNASPYTVVETMSLAKALILFREVG  717

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK    G SPVVGILTR D    +IL + P L KS+
Sbjct  718  LRHLLVIPKIP--GRSPVVGILTRHDFTPEHILGMHPFLVKSR  758



>ref|XP_010529978.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
 ref|XP_010529986.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
 ref|XP_010529994.1| PREDICTED: chloride channel protein CLC-c [Tarenaya hassleriana]
Length=779

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 150/217 (69%), Gaps = 11/217 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I+++KGLPFL+A+ EP+MRN+   ++  V  P+V+   +EKVG I
Sbjct  562  SKTVADCFNKGVYDQIVKMKGLPFLEAHAEPYMRNLVAQDV--VSGPLVSFPRVEKVGVI  619

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
             + LK TT+NGFPV+DE     A EL G+VLR+HLL++L+ K F  +R       +   F
Sbjct  620  WQALKMTTHNGFPVIDEPPFTEAPELCGIVLRSHLLVLLQGKKFSKQRTVCSSRILTI-F  678

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    R  KIED+ ++ +EMEMYVDLHP+TNT+P+TV E++S+AKA +LFRQ+G
Sbjct  679  KARDFAKPGLGRGLKIEDLEISEEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLG  738

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFP  208
            LRH+ +VPK    G  P+VGILTR D    ++L ++P
Sbjct  739  LRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYP  773



>ref|XP_008806106.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
 ref|XP_008806107.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=765

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 149/219 (68%), Gaps = 10/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+ +KGLP+++A+ EP+MRN+  G++  V  P++T  G+EKVG I
Sbjct  547  SKTVADSFNRGVYDQIVTMKGLPYMEAHAEPYMRNLVAGDV--VSGPLITFSGVEKVGNI  604

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE     A EL G+VLR+HLL++LK + F  +R  T   EV  +F
Sbjct  605  VHALRLTGHNGFPVVDEPPFSDAPELCGLVLRSHLLVLLKGRRFTKDRVLTGPAEVFRRF  664

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K++D+ +  +EMEMYVD+HP+TN +P+TV E++S+AKA VLFR++G
Sbjct  665  GAFDFAKAGSGKGVKLQDLDINGEEMEMYVDIHPITNRSPYTVVETMSLAKAAVLFRELG  724

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRH+ +VPK    G  P+VGILTR D    +IL +FP  
Sbjct  725  LRHLCVVPK--TPGRPPIVGILTRHDFMPEHILGLFPQF  761



>ref|XP_007204268.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
 gb|EMJ05467.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
Length=777

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+  D FN +IYD+I++ KGLP+L+A+ EP+MR +TV ++  V  P+    GIEKVG I
Sbjct  545  SKTTADAFNGNIYDLIMKAKGLPYLEAHVEPYMRQLTVADV--VTGPLQLFYGIEKVGNI  602

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPV+DE  ++    L G+VLR HL+ +LKKK F+     T     + +F
Sbjct  603  VHVLRTTGHNGFPVIDELPLSESPVLFGIVLRAHLIELLKKKAFVSTPVPTSTDSFK-RF  661

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A+R      KIED+ +  +E+EM++DLHP TN +P+TV E++S+AKA++LFR+VG
Sbjct  662  SSEDFAKRGSGNGDKIEDIKLNEEELEMFIDLHPFTNASPYTVVETMSLAKALILFREVG  721

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK      SPVVGILTR D    +IL++ P L  S+
Sbjct  722  LRHLLVIPKISTR--SPVVGILTRHDFMPEHILSLNPMLVNSR  762



>ref|XP_004242745.2| PREDICTED: putative chloride channel-like protein CLC-g [Solanum 
lycopersicum]
Length=788

 Score =   197 bits (500),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 151/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+  KG P+L+ + EP++R + V ++  V  P+    GIEKVG I
Sbjct  556  SKTVADAFNGNIYDLIMRAKGFPYLERHAEPYLRQLAVSDV--VTGPLQLFNGIEKVGNI  613

Query  660  VEVLKNTTYNGFPVVDE--ERVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE     A  L+G+VLR HL+ +LKKK F+       +     +F
Sbjct  614  VHVLKTTGHNGFPVVDEPPHSAAPVLYGLVLRAHLITLLKKKAFLQNPAPAGDDAFE-QF  672

Query  486  SWVDLA----ERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A    E   ++ED+ + ++EM+M++DLHP  NT+PFTV E++S+AKA++LFR+VG
Sbjct  673  SADDFAKKGLEHVDRVEDIQLKDEEMDMFIDLHPFCNTSPFTVVETMSLAKALMLFREVG  732

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +G  PVVGI+TR D    ++L++ P LAKSK
Sbjct  733  LRHLLVIPK--VSGRIPVVGIITRHDFMPEHVLSLHPSLAKSK  773



>ref|XP_006389435.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP48349.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score =   197 bits (500),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 155/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +I+D+I++ KG P+L+++ EP+MR +TVG++  V  P+    GIEKVG I
Sbjct  543  SKTVADAFNGNIFDLIMKAKGFPYLESHAEPYMRQLTVGDV--VTGPLQVFQGIEKVGNI  600

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPVVDE  ++    L+G++LR HL+ +LKKK FM     T    ++  F
Sbjct  601  VHVLRTTRHNGFPVVDEPPLSEPPVLYGLILRAHLIELLKKKAFMSAPVPTSIDALKL-F  659

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D AER      KIE++  T +EMEM++DLHP TN +P+TV E++S+AKA++LFR+VG
Sbjct  660  SAGDSAERGSGNGDKIEELRFTEEEMEMFLDLHPFTNASPYTVVETMSLAKALILFREVG  719

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++ +   +G SPVVGILTR D    +IL + P L +S+
Sbjct  720  LRHLLVMSRI--SGRSPVVGILTRHDFMPEHILGLHPLLIRSR  760



>ref|XP_010274995.1| PREDICTED: chloride channel protein CLC-c [Nelumbo nucifera]
Length=773

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 153/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLPF++++ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  556  SKTVADNFNKGVYDQIVKMKGLPFMESHAEPYMRHLVAGDV--VSGPLITFNGVEKVGNI  613

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  LK T +NGFPV+DE  +  A EL G+VLR+HLL++LK K F    R     EV ++F
Sbjct  614  LHALKTTGHNGFPVIDEPPISEAPELCGLVLRSHLLVLLKGKKF-SSERVLTGDEVLQRF  672

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+ED+ +  DEME+YVDLHP+TN +P+TV E++S+AKA +LFR++G
Sbjct  673  DAFDFAKAGSGKGVKLEDLHIEEDEMELYVDLHPITNASPYTVVETMSLAKAALLFRELG  732

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G  P+VGILTR D    +IL ++P+L   K
Sbjct  733  LRHLCVVPK--TPGRPPIVGILTRHDFTPEHILGIYPNLKAQK  773



>gb|KHG08138.1| Chloride channel CLC-c -like protein [Gossypium arboreum]
Length=708

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 154/219 (70%), Gaps = 11/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++GD FN  +YD I++LKGLP+++A+PEP+M+++   ++  V  P++T  G+EKVG I
Sbjct  491  SKTMGDMFNKGVYDQIVKLKGLPYMEAHPEPYMKHLIARDV--VTGPLITFSGVEKVGNI  548

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  LKNT +NGFPV+DE     A EL G+VLR+ LL++LK K F  + R     +V  K 
Sbjct  549  LLALKNTGHNGFPVIDEPPFSDAPELCGLVLRSQLLVLLKGKAF-SKDRVLAGNKVLRKI  607

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S +D A+       K+ED+ +  +E +MYVDLHP+ NT+P+TV E++S+AKA VLFR++G
Sbjct  608  SELDFAKAGSGKGLKLEDLDIQEEEWDMYVDLHPIANTSPYTVVETMSLAKAAVLFRELG  667

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRHM +VPK Q  G  P+VGILTR D +  +IL ++PH+
Sbjct  668  LRHMCVVPKSQ--GRPPIVGILTRHDFQPEHILGLYPHV  704



>gb|EPS68170.1| hypothetical protein M569_06601 [Genlisea aurea]
Length=782

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 151/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I+ +KGLP+L+A+ EP+MR+++ G++     P++T  G+EKVG I
Sbjct  565  SKTVADCFNKGVYDQIVRMKGLPYLEAHAEPYMRHLSAGDVC--SGPLITFSGVEKVGNI  622

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L+ T +NGFPVVDE     A EL G+V R+HLL++LK   F   R  +    +R  F
Sbjct  623  LHALQMTRHNGFPVVDEPPFSDAPELCGLVSRSHLLVLLKANKFTKNRTISGSEVLR-TF  681

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+ED+ V  +EMEM+VDLHP+TNT+P+TV E++S+AKA +LFR++G
Sbjct  682  HAYDFAKAGSGKGLKVEDLDVKEEEMEMFVDLHPITNTSPYTVVETMSLAKAALLFRELG  741

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK   +G SP+VGILTR D    ++L ++P L   K
Sbjct  742  LRHLCVVPK--TSGRSPIVGILTRHDFMPEHVLGLYPQLQHQK  782



>gb|KJB46914.1| hypothetical protein B456_008G001200 [Gossypium raimondii]
Length=761

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 154/219 (70%), Gaps = 11/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++GD FN  +YD I++LKGLP+++A+PEP+M+++   ++  V  P++T  G+EKVG I
Sbjct  544  SKTMGDMFNKGVYDQIVKLKGLPYMEAHPEPYMKHLIARDV--VTGPLITFSGVEKVGNI  601

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  LKNT +NGFPV+DE     A EL G+VLR+ LL++LK K F  + R     +V  K 
Sbjct  602  LHALKNTGHNGFPVIDEPPFSDAPELCGLVLRSKLLVLLKGKAF-SKDRVLAGNKVLRKI  660

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S +D A+       K+ED+ +  +E +MYVDLHP+ NT+P+TV E++S+AKA VLFR++G
Sbjct  661  SELDFAKAGSGKGLKLEDLDIQEEEWDMYVDLHPIANTSPYTVVETMSLAKAAVLFRELG  720

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRHM +VPK Q  G  P+VGILTR D +  +IL ++PH+
Sbjct  721  LRHMCVVPKSQ--GRPPIVGILTRHDFQPEHILGLYPHI  757



>ref|XP_002527858.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF34561.1| chloride channel clc, putative [Ricinus communis]
Length=754

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 151/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLP+++A+ EP+MR +   ++  V  P+V+  G+EKVG I
Sbjct  537  SKTVADSFNKGVYDQIVKMKGLPYMEAHAEPYMRQLVASDV--VSGPLVSFSGVEKVGNI  594

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  LK T +NGFPV+DE     A+EL G+VLR+HLL++LK K F   R  +    +   F
Sbjct  595  LHALKTTGHNGFPVIDEPPFSDASELCGLVLRSHLLVLLKGKKFTKLRIMSGSGILTI-F  653

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+ED+ +T +EM+MYVDLHP+TNT+P+TV ES+S+AKA VLFR++G
Sbjct  654  KAHDFAKAGSGKGIKLEDLDITAEEMDMYVDLHPITNTSPYTVVESMSLAKAAVLFRELG  713

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G  P+VGILTR D    +IL ++PH+   K
Sbjct  714  LRHLCVVPK--TPGRPPIVGILTRHDFVPEHILGLYPHINPHK  754



>ref|XP_008379004.1| PREDICTED: chloride channel protein CLC-c [Malus domestica]
Length=597

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 149/219 (68%), Gaps = 11/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +KSV DCFN  +YD I+++KGLP+++A+ EP+MRN+   ++  V  P+ +  G+EKVG I
Sbjct  380  SKSVADCFNKGVYDQIIKMKGLPYMEAHAEPYMRNLVASDV--VSWPLFSFSGVEKVGNI  437

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            ++ LK T +NGFPV+DE   +   +L G+VLR+HLL++LK+K F  +R          +F
Sbjct  438  LQELKTTAHNGFPVIDEPPFSNSADLCGLVLRSHLLVLLKRKNFTKQRVLIGSDVTS-RF  496

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D  +    +  K+ED+ +  +EMEMY+DLHP+TNT+P+TV E++S+AKA + FR +G
Sbjct  497  RAHDFGKAGLGKGIKLEDLDIQEEEMEMYLDLHPITNTSPYTVVETMSLAKAAIFFRALG  556

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRH+L+VPK    G  P+VGILTR D    +IL +FP L
Sbjct  557  LRHLLVVPK--TPGRPPIVGILTRHDFMPEHILELFPQL  593



>ref|XP_011078419.1| PREDICTED: putative chloride channel-like protein CLC-g [Sesamum 
indicum]
Length=834

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 153/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+VGD F+ +IYDII+ LKGLP+L  + EP+MR +TVG++  V  P+    GIEKVG I
Sbjct  608  SKTVGDVFDANIYDIIMTLKGLPYLKPHAEPYMRQLTVGDV--VTGPLQIFHGIEKVGNI  665

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPVVDE  ++    L+G++LR+HL+ +L+KK F              +F
Sbjct  666  VHVLRTTGHNGFPVVDEPPLSLSPLLYGLILRSHLVTLLRKKLFFKTPTPVGLDAFL-QF  724

Query  486  SWVDLAER----WGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D   +      +I+D+ ++ +EMEM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  725  SADDFTTKDLGHCDQIDDIELSEEEMEMFVDLHPFTNTSPYTVVETMSLAKALILFREVG  784

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +G  PVVGILTR D    ++  + P L++++
Sbjct  785  LRHLLVIPK--VSGRLPVVGILTRHDFMLEHVQNLHPRLSRNR  825



>ref|NP_001047143.2| Os02g0558100 [Oryza sativa Japonica Group]
 dbj|BAF09057.2| Os02g0558100, partial [Oryza sativa Japonica Group]
Length=659

 Score =   195 bits (495),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 154/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLP+++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  433  SKTIADNFNKGVYDQIVVMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNI  490

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  +  A EL G+V R+HLL++L  K FM ++ +T    V ++F
Sbjct  491  VHALRFTGHNGFPVVDEPPLTEAPELVGLVTRSHLLVLLNGKMFMKDQLKTSGSFVLQRF  550

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KI+D+  T++EMEMYVDLHP+TNT+P+TV E++S+AKA +LFR +G
Sbjct  551  GAFDFAKPGSGKGLKIQDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRALG  610

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK       P+VGILTR D    +I  +FP+L   K
Sbjct  611  LRHLLVVPK--TPDRPPIVGILTRHDFVEEHIHGLFPNLNPHK  651



>ref|XP_003575152.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=808

 Score =   196 bits (497),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 154/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLP+++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  582  SKTIADNFNKGVYDQIVVMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNI  639

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L+ T +NGFPVVDE  +A   EL G+V+R+HLL++LK K FM ER +T    + E+F
Sbjct  640  ITALRITGHNGFPVVDEPPLAEAPELVGLVIRSHLLVLLKGKMFMKERVKTSGSFILERF  699

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+  T++EMEMYVDLHP+ NT+P+TV E++S+AKA +LFR +G
Sbjct  700  GAFDFAKPGSGKGLKIEDLNFTDEEMEMYVDLHPIANTSPYTVVETMSLAKAAILFRALG  759

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK       P+VGILTR D    +I  +FP L   K
Sbjct  760  LRHLLVVPK--TPDRPPIVGILTRHDFVPEHIHGLFPSLNPHK  800



>ref|XP_010025693.1| PREDICTED: chloride channel protein CLC-c-like [Eucalyptus grandis]
 gb|KCW62414.1| hypothetical protein EUGRSUZ_H05062 [Eucalyptus grandis]
Length=783

 Score =   196 bits (497),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 155/223 (70%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I++LKGLP+++A+ EP+MR +   ++  V  P+V   GIEKVG I
Sbjct  564  SKTVADSFNKGVYDQIVKLKGLPYMEAHAEPYMRQLVARDV--VTGPIVMFSGIEKVGTI  621

Query  660  VEVLKNTTYNGFPVVDEE--RVATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L+ T +NGFPV+DE     + EL G+VLR+HLL++LK K F  ER  + E  ++ K+
Sbjct  622  LHALRTTGHNGFPVIDEPPFSESAELCGIVLRSHLLVLLKGKNFSRERVISGEEILQ-KY  680

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            +  D A+    +  K+ED+ + ++EM++Y+DLHP+TN +P+TV E++S+AKA +LFRQ+G
Sbjct  681  AAFDFAKPGSGKGIKLEDLDIDDEEMDLYIDLHPVTNASPYTVVETMSLAKAAILFRQLG  740

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRHM +VPK Q  G  P+VGILTR D    +IL ++PH+   K
Sbjct  741  LRHMCVVPKSQ--GRPPIVGILTRHDFMPEHILGLYPHIKPHK  781



>ref|NP_001105216.1| LOC542114 [Zea mays]
 gb|AAP04392.2| chloride channel [Zea mays]
Length=786

 Score =   196 bits (497),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 153/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLP+++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  560  SKTIADSFNKGVYDQIVVMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNI  617

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPV+DE  +    EL G+V R+HLL++L  K FM  R +T    V  +F
Sbjct  618  VHALRLTGHNGFPVIDEPPITETPELVGLVTRSHLLVLLNSKNFMKGRVKTSGSFVLRRF  677

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+  T++EM+MYVDLHP+TNT+P+TV E++S+AKA +LFR++G
Sbjct  678  GAFDFAKPGSGKGLKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAILFRELG  737

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK       P+VGILTR D    +I ++FP+L   K
Sbjct  738  LRHLLVVPK--TPDRPPIVGILTRHDFMPEHIHSLFPNLNPHK  778



>ref|XP_010927804.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=761

 Score =   195 bits (496),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 148/223 (66%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+ +KGLP+++A+ EP+MRN+   ++  V  P++T   +EKVG I
Sbjct  543  SKTVADSFNKGVYDQIVTMKGLPYMEAHAEPYMRNLVASDV--VSGPLITFSAVEKVGNI  600

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE   A   EL G+VLR+HLL++LK K F  +R  T   EV  +F
Sbjct  601  VHALRLTGHNGFPVVDEPPFADAPELCGLVLRSHLLVLLKGKRFTQDRVLTGPAEVFRRF  660

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+ED+ +  +EMEMYVD+HP+TN +P+TV E++S+AKA VLFR++G
Sbjct  661  GAFDFAKAGSGKGVKLEDLDINEEEMEMYVDIHPITNRSPYTVVETMSLAKAAVLFRELG  720

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G  P+VGILTR D    ++L +FP     K
Sbjct  721  LRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLFPQFKHHK  761



>gb|EMS56861.1| Putative chloride channel-like protein CLC-g [Triticum urartu]
Length=700

 Score =   194 bits (494),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 155/224 (69%), Gaps = 11/224 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN SIYD+I+ LKGLP+LD + EP+MR ++VG++  V  P+ +  G+EKVG I
Sbjct  455  SKTVADSFNASIYDLIVRLKGLPYLDGHAEPYMRQLSVGDV--VVGPLRSFNGVEKVGHI  512

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrt-eewevrEK  490
            + VL+ T ++ FPV+DE   AT   L+G+VLR HLL++L+K+ F+  + R  +E+ +  +
Sbjct  513  MHVLRTTGHHAFPVIDEPPFATAPVLYGLVLRAHLLVLLRKREFLPAQERYPKEYSIAAR  572

Query  489  FSWVDLAERWGKIED----VAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            F   D  +R    +D    V ++ +EMEMYVDLHP TN +P+TV E++S+AKA++LFR+V
Sbjct  573  FEAQDFDKRGSGKQDTVDGVELSPEEMEMYVDLHPFTNASPYTVVETMSLAKALILFREV  632

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            GLRH+L+VPK  A   SPVVGILTR D    +IL + P L   K
Sbjct  633  GLRHLLVVPK--ACDRSPVVGILTRHDFMPEHILGLHPVLLGGK  674



>ref|NP_001130407.2| chloride channel G [Zea mays]
 gb|ADF18550.1| chloride channel G [Zea mays]
Length=943

 Score =   196 bits (498),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 170/275 (62%), Gaps = 31/275 (11%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K V D FN ++YD+++ LKG P L+   EP+MR ++V ++  V  P+ T  GIEKVG I
Sbjct  576  SKVVADAFNANVYDLLVRLKGFPHLEGYAEPYMRQLSVSDV--VTGPLQTFNGIEKVGHI  633

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE   +    L+G++LR HLL++L+KK F+     +    +   F
Sbjct  634  VHVLKTTGHNGFPVVDEPPFSDTPTLYGLILRDHLLVLLRKKDFIRSCTASTLNALN-HF  692

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  + A+R      +IED+ +  +E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  693  SHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVG  752

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSKGSNKGH*E*KWLLGYLS  139
            LRH+L++PK  ++  +PVVGILTR D    +IL + P L KS+         K  LG + 
Sbjct  753  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHILGLHPFLFKSRWK-------KVRLGKVQ  803

Query  138  C----NILY---------IFLLICTCIPNSHSFSE  73
            C    N+ +         +FL +  C+  S +F E
Sbjct  804  CSCADNVCHFTQSSGKNTVFLDLLICLAESSAFEE  838



>gb|ADD09861.1| chloride channel C [Eutrema halophilum]
Length=775

 Score =   195 bits (495),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 148/219 (68%), Gaps = 11/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I+ +KGLP+++ + EP+MRN+   ++  V  P+++   +EKVG I
Sbjct  558  SKTVADCFNKGVYDQIVTMKGLPYMEDHAEPYMRNLVAKDV--VSGPLLSFSSVEKVGVI  615

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrtee----wev  499
             + LK T++NGFPV+DE     A+EL G+ LR+HLL +L+ K F  +R            
Sbjct  616  WQALKMTSHNGFPVIDEPPFTEASELCGIALRSHLLTLLQGKRFSKQRTAFGSQILRSCK  675

Query  498  rEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               F+   L +   KIED+ ++ +EMEMYVDLHP+TNT+P+TV ES+S+AKA +LFRQ+G
Sbjct  676  ARDFAKAGLGKGL-KIEDLDISEEEMEMYVDLHPITNTSPYTVLESLSLAKAAILFRQLG  734

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRH+ ++PK   AG  P+VGILTR D    ++L ++PH+
Sbjct  735  LRHLCVIPK--TAGRPPIVGILTRHDFMPEHVLGLYPHI  771



>ref|XP_006402220.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
 gb|ESQ43673.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
Length=775

 Score =   195 bits (495),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 148/219 (68%), Gaps = 11/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I+ +KGLP+++ + EP+MRN+   ++  V  P+++   +EKVG I
Sbjct  558  SKTVADCFNKGVYDQIVTMKGLPYMEDHAEPYMRNLVAKDV--VSGPLLSFSSVEKVGVI  615

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrtee----wev  499
             + LK T++NGFPV+DE     A+EL G+ LR+HLL +L+ K F  +R            
Sbjct  616  WQALKMTSHNGFPVIDEPPFTEASELCGIALRSHLLTLLQGKRFSKQRTAFGSQILRSCK  675

Query  498  rEKFSWVDLAERWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               F+   L +   KIED+ ++ +EMEMYVDLHP+TNT+P+TV ES+S+AKA +LFRQ+G
Sbjct  676  ARDFAKAGLGKGL-KIEDLDISEEEMEMYVDLHPITNTSPYTVLESLSLAKAAILFRQLG  734

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRH+ ++PK   AG  P+VGILTR D    ++L ++PH+
Sbjct  735  LRHLCVIPK--TAGRPPIVGILTRHDFMPEHVLGLYPHI  771



>gb|KJB64678.1| hypothetical protein B456_010G060300 [Gossypium raimondii]
Length=774

 Score =   195 bits (495),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 155/224 (69%), Gaps = 13/224 (6%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLC-GIEKVGR  664
            +K+V D FN ++YD+I+++KG P+L+ + EP+MR +TV   ADV +  + LC GIEKVG 
Sbjct  542  SKTVADAFNGNVYDLIMKVKGFPYLETHAEPYMRQLTV---ADVVSGPLQLCHGIEKVGN  598

Query  663  IVEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEK  490
            IV +LK T ++GFPV+DE   +    L+G++LR HL+ +LKKK F+         +    
Sbjct  599  IVHILKTTMHHGFPVIDESPHSESPVLYGLILRAHLIALLKKKAFL-CTPVQLGADAFRH  657

Query  489  FSWVDLAERW----GKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQV  322
            FS  D A++      KIED+ +T++EMEM++DLHP TN +P+TV +++S+AKA++LFR+V
Sbjct  658  FSSDDFAKKGLGNVDKIEDIELTDEEMEMFLDLHPFTNASPYTVVDTMSLAKALILFREV  717

Query  321  GLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            GLRH+L++PK  +   +PVVGILTR D    +IL + P L +S+
Sbjct  718  GLRHLLVIPKISSR--APVVGILTRHDFMPEHILGLHPSLVRSR  759



>dbj|BAB97268.1| chloride channel [Oryza sativa Japonica Group]
Length=756

 Score =   194 bits (494),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 154/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLP+++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  530  SKTIADNFNKGVYDQIVVMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNI  587

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  +  A EL G+V R+HLL++L  K FM ++ +T    V ++F
Sbjct  588  VHALRFTGHNGFPVVDEPPLTEAPELVGLVTRSHLLVLLNGKMFMKDQLKTSGSFVLQRF  647

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KI+D+  T++EMEMYVDLHP+TNT+P+TV E++S+AKA +LFR +G
Sbjct  648  GAFDFAKPGSGKGLKIQDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRALG  707

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK       P+VGILTR D    +I  +FP+L   K
Sbjct  708  LRHLLVVPK--TPDRPPIVGILTRHDFVEEHIHGLFPNLNPHK  748



>ref|XP_008644266.1| PREDICTED: LOC542114 isoform X1 [Zea mays]
 gb|AFW71856.1| chloride channel [Zea mays]
Length=813

 Score =   195 bits (495),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 153/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLP+++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  587  SKTIADSFNKGVYDQIVVMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNI  644

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPV+DE  +    EL G+V R+HLL++L  K FM  R +T    V  +F
Sbjct  645  VHALRLTGHNGFPVLDEPPITETPELVGLVTRSHLLVLLNSKNFMKGRVKTSGSFVLRRF  704

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KIED+  T++EM+MYVDLHP+TNT+P+TV E++S+AKA +LFR++G
Sbjct  705  GAFDFAKPGSGKGLKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAILFRELG  764

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK       P+VGILTR D    +I ++FP+L   K
Sbjct  765  LRHLLVVPK--TPDRPPIVGILTRHDFMPEHIHSLFPNLNPHK  805



>ref|XP_009777969.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Nicotiana sylvestris]
Length=776

 Score =   194 bits (494),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 154/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+ LKG P+L+++ EP++R + V ++  V  P+    GIEKVG I
Sbjct  544  SKTVADTFNGNIYDLIMRLKGFPYLESHAEPYLRQLAVCDV--VTGPLQLFSGIEKVGNI  601

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE  ++    L G++LR HL+ +LKKK F+ +            F
Sbjct  602  VHVLKTTGHNGFPVVDEPPLSHSPVLFGLILRAHLVELLKKKAFIRDPVPAGSDAFN-HF  660

Query  486  SWVDLAERW----GKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A++      ++E++ +T++EM+M++DLHP  NT+P+TV E++S+AKA+VLFR+VG
Sbjct  661  SADDFAKKGLDHGDRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVG  720

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +G  PVVGI+TR D    ++L++ P LAKSK
Sbjct  721  LRHLLVIPK--VSGRVPVVGIITRHDFMPEHVLSLHPSLAKSK  761



>ref|XP_009777968.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana sylvestris]
Length=788

 Score =   194 bits (494),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 154/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+ LKG P+L+++ EP++R + V ++  V  P+    GIEKVG I
Sbjct  556  SKTVADTFNGNIYDLIMRLKGFPYLESHAEPYLRQLAVCDV--VTGPLQLFSGIEKVGNI  613

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE  ++    L G++LR HL+ +LKKK F+ +            F
Sbjct  614  VHVLKTTGHNGFPVVDEPPLSHSPVLFGLILRAHLVELLKKKAFIRDPVPAGSDAFN-HF  672

Query  486  SWVDLAERW----GKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A++      ++E++ +T++EM+M++DLHP  NT+P+TV E++S+AKA+VLFR+VG
Sbjct  673  SADDFAKKGLDHGDRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVG  732

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +G  PVVGI+TR D    ++L++ P LAKSK
Sbjct  733  LRHLLVIPK--VSGRVPVVGIITRHDFMPEHVLSLHPSLAKSK  773



>dbj|BAD16425.1| chloride channel [Oryza sativa Japonica Group]
 gb|EEE57198.1| hypothetical protein OsJ_07147 [Oryza sativa Japonica Group]
Length=804

 Score =   194 bits (494),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 154/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLP+++A+ EP+MR++  G++  V  P++T  G+EKVG I
Sbjct  578  SKTIADNFNKGVYDQIVVMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVGNI  635

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  +  A EL G+V R+HLL++L  K FM ++ +T    V ++F
Sbjct  636  VHALRFTGHNGFPVVDEPPLTEAPELVGLVTRSHLLVLLNGKMFMKDQLKTSGSFVLQRF  695

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  KI+D+  T++EMEMYVDLHP+TNT+P+TV E++S+AKA +LFR +G
Sbjct  696  GAFDFAKPGSGKGLKIQDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRALG  755

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK       P+VGILTR D    +I  +FP+L   K
Sbjct  756  LRHLLVVPK--TPDRPPIVGILTRHDFVEEHIHGLFPNLNPHK  796



>ref|XP_009586705.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Nicotiana tomentosiformis]
Length=732

 Score =   194 bits (493),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 153/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+ LKG P+L+ + EP++R + V ++  V  P+    GIEKVG I
Sbjct  500  SKTVADTFNGNIYDLIMRLKGFPYLECHAEPYLRQLAVCDV--VTGPLQLFSGIEKVGNI  557

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE  ++    L G++LR HL+ +LKKK F+ +            F
Sbjct  558  VHVLKTTGHNGFPVVDEPPLSHSPVLFGLILRAHLVELLKKKAFIRDPVPAGSDAFN-HF  616

Query  486  SWVDLAERW----GKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A++      ++E++ +T++EM+M++DLHP  NT+P+TV E++S+AKA+VLFR+VG
Sbjct  617  SADDFAKKGLDHGDRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVG  676

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +G  PVVGI+TR D    ++L++ P LAKSK
Sbjct  677  LRHLLVIPK--VSGRVPVVGIITRHDFMPEHVLSLHPSLAKSK  717



>tpg|DAA35720.1| TPA: chloride channel G, partial [Zea mays]
Length=823

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K V D FN ++YD+++ LKG P L+   EP+MR ++V ++  V  P+ T  GIEKVG I
Sbjct  576  SKVVADAFNANVYDLLVRLKGFPHLEGYAEPYMRQLSVSDV--VTGPLQTFNGIEKVGHI  633

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE   +    L+G++LR HLL++L+KK F+     +    +   F
Sbjct  634  VHVLKTTGHNGFPVVDEPPFSDTPTLYGLILRDHLLVLLRKKDFIRSCTASTLNALN-HF  692

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  + A+R      +IED+ +  +E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  693  SHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVG  752

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  753  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHILGLHPFLFKSR  793



>ref|XP_006836849.1| PREDICTED: chloride channel protein CLC-c [Amborella trichopoda]
 gb|ERM99702.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
Length=772

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 150/223 (67%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLPFL+ + EP+MR +   ++  V  P++   GIEKVG +
Sbjct  554  SKTVADVFNRGVYDQIVKMKGLPFLEDHAEPYMRQLAASDV--VSGPLMGFSGIEKVGNV  611

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  L+ T +NGFPVVDE  ++   +L G+VLR HL+++LK K F    R     E   +F
Sbjct  612  VHTLRATGHNGFPVVDEPPLSEVPKLCGLVLRAHLVVLLKGKMFTEGSRSVGMEEFGRRF  671

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  +IEDV +++ EMEMYVDLHP+TN++P+TV E++S+AKA +LFRQ+G
Sbjct  672  GASDFAKAGLGKGLRIEDVELSDKEMEMYVDLHPITNSSPYTVVETMSLAKAAMLFRQLG  731

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ ++PK    G +P+VGILTR D    +I+ ++PHL   K
Sbjct  732  LRHLCVMPK--TPGGAPIVGILTRHDFMPEHIIGLYPHLRPHK  772



>ref|XP_007048601.1| Chloride channel C [Theobroma cacao]
 gb|EOX92758.1| Chloride channel C [Theobroma cacao]
Length=771

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 150/219 (68%), Gaps = 11/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I++LKGLP+++A+ EP+M+++   ++  V  P++T  GIEKVG I
Sbjct  554  SKTVADVFNKGVYDQIVKLKGLPYMEAHAEPYMKHLVARDV--VSGPLITFSGIEKVGNI  611

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L+ T +NGFPV+DE     A  L G+VLR+HLL++LK K F  +     +  +  +F
Sbjct  612  LHALRTTGHNGFPVIDEPPFSDAPALCGLVLRSHLLVLLKGKIFSRDMVPAGDEILH-RF  670

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            +  D A+       K+ED+ +  +EM+MYVDLHP+TN +P+TV E++S+AKA VLFRQ+G
Sbjct  671  AAFDFAKAGSGKGIKVEDLDIEQEEMDMYVDLHPITNASPYTVVETMSLAKAAVLFRQLG  730

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRHM +VPK Q  G  P+VGILTR D    ++L ++PH+
Sbjct  731  LRHMCVVPKSQ--GRPPIVGILTRHDFMPEHVLGLYPHI  767



>tpg|DAA35721.1| TPA: hypothetical protein ZEAMMB73_781870 [Zea mays]
Length=810

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K V D FN ++YD+++ LKG P L+   EP+MR ++V ++  V  P+ T  GIEKVG I
Sbjct  578  SKVVADAFNANVYDLLVRLKGFPHLEGYAEPYMRQLSVSDV--VTGPLQTFNGIEKVGHI  635

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE   +    L+G++LR HLL++L+KK F+     +    +   F
Sbjct  636  VHVLKTTGHNGFPVVDEPPFSDTPTLYGLILRDHLLVLLRKKDFIRSCTASTLNALN-HF  694

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  + A+R      +IED+ +  +E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  695  SHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVG  754

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  755  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHILGLHPFLFKSR  795



>ref|XP_009586704.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana tomentosiformis]
Length=788

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 153/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN +IYD+I+ LKG P+L+ + EP++R + V ++  V  P+    GIEKVG I
Sbjct  556  SKTVADTFNGNIYDLIMRLKGFPYLECHAEPYLRQLAVCDV--VTGPLQLFSGIEKVGNI  613

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE  ++    L G++LR HL+ +LKKK F+ +            F
Sbjct  614  VHVLKTTGHNGFPVVDEPPLSHSPVLFGLILRAHLVELLKKKAFIRDPVPAGSDAFN-HF  672

Query  486  SWVDLAERW----GKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  D A++      ++E++ +T++EM+M++DLHP  NT+P+TV E++S+AKA+VLFR+VG
Sbjct  673  SADDFAKKGLDHGDRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFREVG  732

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK   +G  PVVGI+TR D    ++L++ P LAKSK
Sbjct  733  LRHLLVIPK--VSGRVPVVGIITRHDFMPEHVLSLHPSLAKSK  773



>tpg|DAA35719.1| TPA: hypothetical protein ZEAMMB73_781870, partial [Zea mays]
Length=827

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K V D FN ++YD+++ LKG P L+   EP+MR ++V ++  V  P+ T  GIEKVG I
Sbjct  580  SKVVADAFNANVYDLLVRLKGFPHLEGYAEPYMRQLSVSDV--VTGPLQTFNGIEKVGHI  637

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE   +    L+G++LR HLL++L+KK F+     +    +   F
Sbjct  638  VHVLKTTGHNGFPVVDEPPFSDTPTLYGLILRDHLLVLLRKKDFIRSCTASTLNALN-HF  696

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  + A+R      +IED+ +  +E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  697  SHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVG  756

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  757  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHILGLHPFLFKSR  797



>gb|KDO42565.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=642

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 152/219 (69%), Gaps = 11/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I++LKGLP+L+A+ EP+M+N+   ++  V  P++T  G+EKVG I
Sbjct  424  SKTVADSFNQGVYDQIVKLKGLPYLEAHAEPYMKNLVASDV--VSGPLITFSGVEKVGNI  481

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L+ T +NGFPV+DE  +  A EL G+VLR+HLL++LK K F  ++  T    +R +F
Sbjct  482  MHALRLTRHNGFPVIDEPPLTPAPELCGLVLRSHLLVLLKGKKFTKQKTMTGSDIMR-RF  540

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+ED+ +  +EMEM+VDLHP+TNT+P+TV E++S+AKA VLFRQ+ 
Sbjct  541  KAHDFAKAGSGKGVKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLA  600

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRH+ +VPK    G  P+VGILTR D    ++L ++PH+
Sbjct  601  LRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPHI  637



>ref|XP_008667038.1| PREDICTED: chloride channel G isoform X1 [Zea mays]
Length=812

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K V D FN ++YD+++ LKG P L+   EP+MR ++V ++  V  P+ T  GIEKVG I
Sbjct  580  SKVVADAFNANVYDLLVRLKGFPHLEGYAEPYMRQLSVSDV--VTGPLQTFNGIEKVGHI  637

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VLK T +NGFPVVDE   +    L+G++LR HLL++L+KK F+     +    +   F
Sbjct  638  VHVLKTTGHNGFPVVDEPPFSDTPTLYGLILRDHLLVLLRKKDFIRSCTASTLNALN-HF  696

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S  + A+R      +IED+ +  +E+EM+VDLHP TNT+P+TV E++S+AKA++LFR+VG
Sbjct  697  SHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVG  756

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    +IL + P L KS+
Sbjct  757  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHILGLHPFLFKSR  797



>ref|XP_010657886.1| PREDICTED: uncharacterized protein LOC100245380 isoform X2 [Vitis 
vinifera]
Length=630

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 150/223 (67%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I+ +KG P+++A+ EP+MR++   ++  V  P++T   IEKVG I
Sbjct  413  SKTVADCFNKGVYDQIVRMKGFPYMEAHAEPYMRHLVAKDV--VSGPLITFSSIEKVGNI  470

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  LK T ++GFPV+DE     A EL G+VL++HLL++LK K F  + R     E+ + F
Sbjct  471  LHALKTTGHHGFPVIDEPPFTDAPELCGLVLKSHLLVLLKGKKF-SKTRMLVGSEILKTF  529

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+ED+ +T +EMEMYVDLHP+TNT+P+TV E++S+AKA VLFR++G
Sbjct  530  EANDFAKAGSGKGVKLEDLDITAEEMEMYVDLHPITNTSPYTVVETMSLAKAAVLFRELG  589

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK  A    P+VGILTR D    +I  ++PH   SK
Sbjct  590  LRHLCVVPKTHAR--PPIVGILTRHDFMPGHIRGLYPHFNSSK  630



>ref|XP_006431488.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 ref|XP_006431489.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44728.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44729.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=642

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 152/219 (69%), Gaps = 11/219 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I++LKGLP+L+A+ EP+M+N+   ++  V  P++T  G+EKVG I
Sbjct  424  SKTVADSFNQGVYDQIVKLKGLPYLEAHAEPYMKNLVASDV--VSGPLITFSGVEKVGNI  481

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L+ T +NGFPV+DE  +  A EL G+VLR+HLL++LK K F  ++  T    +R +F
Sbjct  482  MHALRLTRHNGFPVIDEPPLTPAPELCGLVLRSHLLVLLKGKKFTKQKTMTGSDIMR-RF  540

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+       K+ED+ +  +EMEM+VDLHP+TNT+P+TV E++S+AKA VLFRQ+ 
Sbjct  541  KAHDFAKAGSGKGVKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAVLFRQLA  600

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHL  202
            LRH+ +VPK    G  P+VGILTR D    ++L ++PH+
Sbjct  601  LRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPHI  637



>emb|CDO97645.1| unnamed protein product [Coffea canephora]
Length=816

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 153/222 (69%), Gaps = 11/222 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN  +YD I+++KGLP+L+A+ EP+MR +  G++     P++T  G+EKVG I
Sbjct  596  SKTVADSFNKGVYDQIVKMKGLPYLEAHAEPYMRQLVAGDVCS--GPLITFSGVEKVGNI  653

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L+ T +NGFPV+DE  +  A EL G+VLR+HLL++LK K F+     T    ++ +F
Sbjct  654  LHALRLTRHNGFPVIDEPPLSDAPELCGLVLRSHLLVLLKGKNFLKHPVSTGLEILK-RF  712

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K+ED+ +T +E EMYVDL P+TNT+P+TV E++S+AKA +LFR++G
Sbjct  713  HAFDFAKPGLGKGLKVEDLEITAEETEMYVDLRPITNTSPYTVVETMSLAKAALLFRELG  772

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKS  193
            LRH+ +VPK    G  P+VGILTR D    ++L ++PHL ++
Sbjct  773  LRHLCVVPK--KPGRPPIVGILTRHDFMPEHVLGLYPHLTRA  812



>gb|KEH26640.1| chloride channel ClC1 protein [Medicago truncatula]
Length=649

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 150/223 (67%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +KSV D FN  +YD IL++KGLP+L+A+ EP+MRNI   ++  V  P++T  GIEKVG I
Sbjct  430  SKSVADIFNKGVYDQILKIKGLPYLEAHAEPYMRNIATRDV--VSGPLMTFSGIEKVGNI  487

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            + VL  T +NGFPV+DE     A EL G+VLR++LL++LK K F  E+       +    
Sbjct  488  LHVLNTTGHNGFPVIDEPPFVDAPELCGLVLRSYLLVLLKAKNFTREKVYANPSILE-NI  546

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S +D  +       K+ED+ + +++++MYVDLHP+TNT+P+TV E++S+AKA +LFRQ G
Sbjct  547  SVLDFGKAGSGKGVKLEDLDIQDEDLDMYVDLHPITNTSPYTVVETMSLAKAAILFRQHG  606

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRHM +VPK Q  G  P+VGILTR D    ++L ++P +   K
Sbjct  607  LRHMCVVPKSQ--GRPPIVGILTRHDFMPEHVLGLYPDIKHHK  647



>ref|XP_004512645.1| PREDICTED: chloride channel protein CLC-c-like isoform X3 [Cicer 
arietinum]
Length=649

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 149/223 (67%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +KSV DCFN  +YD IL++KGLP+L+A  EP+MRNI   ++  V  P++T  GIEKVG I
Sbjct  430  SKSVADCFNKGVYDQILKIKGLPYLEAYAEPYMRNIATRDV--VSGPLMTFSGIEKVGNI  487

Query  660  VEVLKNTTYNGFPVVDEERVAT--ELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            + VL  T +NGFPV+DE   +   EL G+VLR++LL++LK K F  ER       +  K 
Sbjct  488  LHVLNTTRHNGFPVIDEPPFSETPELCGLVLRSYLLVLLKAKNFTRERTFANPSILE-KV  546

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
            S +D  +       K+ED+ + +++++MYVDLHP+ NT+P TV E++S+AKA ++FRQ G
Sbjct  547  SSLDFGKAGSGKGVKLEDLDIQDEDLDMYVDLHPIANTSPHTVVETMSLAKAAIIFRQHG  606

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRHM +VPK Q  G  P+VGILTR D    ++L ++P +   K
Sbjct  607  LRHMCVVPKSQ--GRPPIVGILTRHDFMPEHVLGLYPDIKHHK  647



>gb|EYU35026.1| hypothetical protein MIMGU_mgv1a001577mg [Erythranthe guttata]
Length=791

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 152/223 (68%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V DCFN  +YD I++LKGLP+L+A+ EP+MR+++ G++     P++    +EKVG I
Sbjct  574  SKTVADCFNKGVYDQIVKLKGLPYLEAHGEPYMRHLSAGDVC--SGPLIVFSSVEKVGNI  631

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            +  L  T +NGFPVVDE     A EL G+VLR+HLL++L++K F   R  +    +   F
Sbjct  632  MHALTMTRHNGFPVVDEPPFVEAPELSGLVLRSHLLVLLQRKKFTKNRVLSGSELLTV-F  690

Query  486  SWVDLAE----RWGKIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+    +  K+ED+ ++ +EMEMYVDLHP+TNT+P+ V++++S+AKA VLFR++G
Sbjct  691  HAFDFAKPGSGKGLKVEDLDLSEEEMEMYVDLHPVTNTSPYMVADTMSLAKAAVLFRELG  750

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+ +VPK    G  P+VGILTR D    ++L ++P +A  K
Sbjct  751  LRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPQIAHQK  791



>ref|XP_006652911.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Oryza brachyantha]
Length=808

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 154/223 (69%), Gaps = 11/223 (5%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K+V D FN ++YD++++LKG P+L+   EP+MR ++V ++  V  P+    GIEKVG I
Sbjct  576  SKTVADAFNANVYDLLVKLKGFPYLEGYVEPYMRQLSVSDV--VAGPLQMFSGIEKVGHI  633

Query  660  VEVLKNTTYNGFPVVDEERVATE--LHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V VL+ T +NGFPVVDE   +    L+G+VLR HLL++L+KK F+H R  +     +  F
Sbjct  634  VHVLQTTGHNGFPVVDEPPFSDSPVLYGLVLRAHLLVLLRKKDFIHNRTASGLDASK-HF  692

Query  486  SWVDLAERWG----KIEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+R      +IE++ ++  EMEM+VDLHP TNT+P+TV E++S+AKA VLFR+VG
Sbjct  693  LPDDFAKRGSGKHDRIEEIELSAGEMEMFVDLHPFTNTSPYTVVETMSLAKAHVLFREVG  752

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L++PK  ++  +PVVGILTR D    +IL + P L K++
Sbjct  753  LRHLLVLPK--SSKRAPVVGILTRHDFMPEHILGLHPFLFKTR  793



>ref|XP_006647383.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=804

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 154/223 (69%), Gaps = 10/223 (4%)
 Frame = -3

Query  840  AKSVGDCFNPSIYDIILELKGLPFLDANPEPWMRNITVGELADVKAPVVTLCGIEKVGRI  661
            +K++ D FN  +YD I+ +KGLP+++A+ EP+MR++  G++  V  P++T  G+EKV  I
Sbjct  578  SKTIADIFNKGVYDQIVVMKGLPYMEAHAEPYMRHLVAGDV--VSGPLITFSGVEKVANI  635

Query  660  VEVLKNTTYNGFPVVDEERV--ATELHGVVLRTHLLLVLKKKYFMHerrrteewevrEKF  487
            V  LK T +NGFPVVDE  +  A EL G+V R+HLL++LK K FM ++ +T    V ++F
Sbjct  636  VHALKITGHNGFPVVDEPPLTEAPELVGLVTRSHLLVLLKSKMFMKDQVKTSGSFVLQRF  695

Query  486  SWVDLAE-RWGK---IEDVAVTNDEMEMYVDLHPLTNTTPFTVSESISVAKAMVLFRQVG  319
               D A+   GK   I+D+  T++EMEMYVDLHP+TNT+P+TV E++S+AKA +LFR +G
Sbjct  696  GAFDFAKPGSGKGLTIQDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRALG  755

Query  318  LRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILAVFPHLAKSK  190
            LRH+L+VPK       P+VGILTR D    +I  +FP+L   K
Sbjct  756  LRHLLVVPK--TPDRPPIVGILTRHDFVEEHIHGLFPNLNPHK  796



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2077268246224