BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1865

Length=870
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010322561.1|  PREDICTED: serine carboxypeptidase-like 46 i...    190   2e-53   
ref|XP_010322533.1|  PREDICTED: serine carboxypeptidase-like 45 i...    190   6e-53   
ref|XP_006363923.1|  PREDICTED: serine carboxypeptidase-like 45-like    191   8e-53   Solanum tuberosum [potatoes]
ref|XP_004228838.1|  PREDICTED: serine carboxypeptidase-like 45 i...    190   2e-52   
ref|XP_006363924.1|  PREDICTED: serine carboxypeptidase-like 45-like    188   7e-52   Solanum tuberosum [potatoes]
ref|XP_006363922.1|  PREDICTED: serine carboxypeptidase-like 45-like    187   3e-51   Solanum tuberosum [potatoes]
ref|XP_004228389.1|  PREDICTED: serine carboxypeptidase-like 45         184   2e-50   Solanum lycopersicum
ref|XP_009762845.1|  PREDICTED: serine carboxypeptidase-like 45         183   4e-50   Nicotiana sylvestris
gb|KDO72510.1|  hypothetical protein CISIN_1g039529mg                   179   2e-48   Citrus sinensis [apfelsine]
ref|XP_006431097.1|  hypothetical protein CICLE_v10013776mg             177   8e-48   Citrus clementina [clementine]
ref|XP_006482672.1|  PREDICTED: serine carboxypeptidase-like 46-like    176   1e-47   Citrus sinensis [apfelsine]
ref|XP_010068797.1|  PREDICTED: serine carboxypeptidase-like 46         176   1e-47   Eucalyptus grandis [rose gum]
gb|KCW64994.1|  hypothetical protein EUGRSUZ_G02536                     172   5e-46   Eucalyptus grandis [rose gum]
ref|XP_010068795.1|  PREDICTED: serine carboxypeptidase-like 45         172   5e-46   
ref|XP_007046208.1|  Serine carboxypeptidase 46 isoform 1               172   7e-46   
ref|XP_010265020.1|  PREDICTED: serine carboxypeptidase-like 45         172   8e-46   
ref|XP_002277201.1|  PREDICTED: serine carboxypeptidase-like 45 i...    171   9e-46   Vitis vinifera
ref|XP_010661029.1|  PREDICTED: serine carboxypeptidase-like 45 i...    171   9e-46   Vitis vinifera
emb|CBI22166.3|  unnamed protein product                                172   1e-45   Vitis vinifera
ref|XP_009627244.1|  PREDICTED: serine carboxypeptidase-like 46         170   4e-45   Nicotiana tomentosiformis
ref|XP_003633850.1|  PREDICTED: serine carboxypeptidase-like 46         169   8e-45   Vitis vinifera
ref|XP_010068798.1|  PREDICTED: serine carboxypeptidase-like 45         168   1e-44   
gb|KCW64996.1|  hypothetical protein EUGRSUZ_G02538                     168   1e-44   Eucalyptus grandis [rose gum]
ref|XP_010256545.1|  PREDICTED: serine carboxypeptidase-like 45         167   2e-44   
ref|XP_006838780.1|  PREDICTED: serine carboxypeptidase-like 45         162   3e-42   Amborella trichopoda
ref|XP_007046207.1|  Serine carboxypeptidase 46                         160   1e-41   
gb|KHG07552.1|  Serine carboxypeptidase-like 45                         159   3e-41   Gossypium arboreum [tree cotton]
gb|KDO72509.1|  hypothetical protein CISIN_1g037032mg                   159   4e-41   Citrus sinensis [apfelsine]
ref|XP_006431096.1|  hypothetical protein CICLE_v10013839mg             159   4e-41   
gb|KJB11409.1|  hypothetical protein B456_001G257100                    157   1e-40   Gossypium raimondii
ref|XP_007099702.1|  Serine carboxypeptidase 46                         147   6e-37   
ref|XP_006482671.1|  PREDICTED: serine carboxypeptidase-like 44-like    143   3e-35   
emb|CBI32800.3|  unnamed protein product                                139   2e-34   Vitis vinifera
ref|XP_002282978.2|  PREDICTED: serine carboxypeptidase-like 45         139   4e-34   Vitis vinifera
gb|ABK26025.1|  unknown                                                 138   5e-34   Picea sitchensis
emb|CBI32795.3|  unnamed protein product                                139   6e-34   Vitis vinifera
ref|XP_002277400.2|  PREDICTED: serine carboxypeptidase-like 45         139   7e-34   Vitis vinifera
emb|CAN72076.1|  hypothetical protein VITISV_041583                     137   2e-33   Vitis vinifera
emb|CBI32802.3|  unnamed protein product                                139   5e-33   Vitis vinifera
gb|ABR16719.1|  unknown                                                 135   9e-33   Picea sitchensis
ref|XP_006584695.1|  PREDICTED: serine carboxypeptidase-like 45-l...    134   3e-32   Glycine max [soybeans]
gb|AFK47648.1|  unknown                                                 125   2e-31   Medicago truncatula
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...    131   2e-31   Prunus mume [ume]
ref|XP_009143848.1|  PREDICTED: serine carboxypeptidase-like 46         131   3e-31   Brassica rapa
gb|KEH35690.1|  serine carboxypeptidase-like protein                    131   3e-31   Medicago truncatula
ref|XP_004501743.1|  PREDICTED: serine carboxypeptidase-like 45-like    131   4e-31   Cicer arietinum [garbanzo]
gb|KFK44681.1|  hypothetical protein AALP_AA1G289600                    126   4e-31   Arabis alpina [alpine rockcress]
gb|ABK25202.1|  unknown                                                 130   5e-31   Picea sitchensis
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...    130   6e-31   Prunus mume [ume]
ref|XP_008777393.1|  PREDICTED: serine carboxypeptidase-like 45 i...    130   7e-31   Phoenix dactylifera
tpg|DAA42024.1|  TPA: hypothetical protein ZEAMMB73_711830              127   8e-31   
ref|XP_003532390.1|  PREDICTED: serine carboxypeptidase-like 45-l...    130   8e-31   Glycine max [soybeans]
ref|XP_007223033.1|  hypothetical protein PRUPE_ppa005360mg             130   9e-31   Prunus persica
gb|KJB40056.1|  hypothetical protein B456_007G044700                    129   1e-30   Gossypium raimondii
emb|CDY19500.1|  BnaC04g10990D                                          129   1e-30   Brassica napus [oilseed rape]
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45         129   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_008777392.1|  PREDICTED: serine carboxypeptidase-like 45 i...    129   1e-30   Phoenix dactylifera
gb|AIC80774.1|  serine carboxypeptidase                                 129   1e-30   Cicer arietinum [garbanzo]
ref|XP_008392759.1|  PREDICTED: serine carboxypeptidase-like 45         127   1e-30   
ref|XP_010942380.1|  PREDICTED: serine carboxypeptidase-like 45         129   1e-30   Elaeis guineensis
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...    129   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010271865.1|  PREDICTED: serine carboxypeptidase-like 45 i...    129   1e-30   Nelumbo nucifera [Indian lotus]
gb|KGN63441.1|  hypothetical protein Csa_1G000650                       127   1e-30   Cucumis sativus [cucumbers]
ref|XP_004492026.1|  PREDICTED: serine carboxypeptidase-like 45-like    129   2e-30   Cicer arietinum [garbanzo]
ref|XP_008798399.1|  PREDICTED: serine carboxypeptidase-like 42         127   2e-30   
ref|XP_006415698.1|  hypothetical protein EUTSA_v10007573mg             129   2e-30   Eutrema salsugineum [saltwater cress]
gb|KGN59521.1|  hypothetical protein Csa_3G824180                       126   2e-30   Cucumis sativus [cucumbers]
gb|KEH37845.1|  serine carboxypeptidase-like protein                    129   2e-30   Medicago truncatula
gb|ACN31969.1|  unknown                                                 127   2e-30   Zea mays [maize]
ref|XP_006438865.1|  hypothetical protein CICLE_v10031451mg             126   2e-30   
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like    129   2e-30   
ref|XP_007223032.1|  hypothetical protein PRUPE_ppa005360mg             128   3e-30   Prunus persica
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...    128   3e-30   Nelumbo nucifera [Indian lotus]
gb|ERN14540.1|  hypothetical protein AMTR_s00038p00085900               128   3e-30   Amborella trichopoda
ref|NP_001140326.1|  hypothetical protein                               125   3e-30   
gb|KHG09716.1|  Serine carboxypeptidase-like 45                         128   3e-30   Gossypium arboreum [tree cotton]
ref|XP_011626549.1|  PREDICTED: serine carboxypeptidase II-3            128   4e-30   
ref|XP_010271866.1|  PREDICTED: serine carboxypeptidase-like 45 i...    128   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g             128   4e-30   
gb|AES77859.2|  serine carboxypeptidase-like protein                    128   4e-30   Medicago truncatula
ref|XP_009359890.1|  PREDICTED: serine carboxypeptidase-like 45         128   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_009380118.1|  PREDICTED: serine carboxypeptidase-like 45 i...    128   4e-30   
gb|AFK47012.1|  unknown                                                 126   5e-30   Lotus japonicus
ref|XP_009380117.1|  PREDICTED: serine carboxypeptidase-like 45 i...    127   5e-30   
ref|XP_003621641.1|  Serine carboxypeptidase-like protein               127   5e-30   
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45         127   5e-30   Vitis vinifera
ref|XP_008369640.1|  PREDICTED: serine carboxypeptidase-like 45         127   6e-30   Malus domestica [apple tree]
gb|KJB35835.1|  hypothetical protein B456_006G130200                    126   6e-30   Gossypium raimondii
gb|KHN31265.1|  Serine carboxypeptidase-like 45                         127   7e-30   Glycine soja [wild soybean]
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like    127   7e-30   Citrus sinensis [apfelsine]
gb|EPS65711.1|  hypothetical protein M569_09067                         121   7e-30   Genlisea aurea
ref|XP_007043816.1|  Serine carboxypeptidase-like 45 isoform 1          127   8e-30   Theobroma cacao [chocolate]
ref|XP_010044871.1|  PREDICTED: serine carboxypeptidase-like 45         127   8e-30   
ref|XP_008390188.1|  PREDICTED: serine carboxypeptidase-like 45         127   8e-30   
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                   127   9e-30   Citrus sinensis [apfelsine]
ref|XP_009113703.1|  PREDICTED: serine carboxypeptidase-like 45         127   9e-30   Brassica rapa
ref|XP_007209121.1|  hypothetical protein PRUPE_ppa005457mg             127   9e-30   
ref|XP_006438863.1|  hypothetical protein CICLE_v10031451mg             125   9e-30   
ref|XP_007028221.1|  Serine carboxypeptidase 45                         127   9e-30   
ref|XP_010100042.1|  Serine carboxypeptidase-like 45                    127   1e-29   
gb|AFK49319.1|  unknown                                                 123   1e-29   Lotus japonicus
gb|KJB31552.1|  hypothetical protein B456_005G196500                    125   1e-29   Gossypium raimondii
ref|XP_008239549.1|  PREDICTED: serine carboxypeptidase-like 45         126   1e-29   Prunus mume [ume]
gb|AAB80670.1|  putative serine carboxypeptidase II                     126   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like    126   1e-29   Glycine max [soybeans]
ref|XP_010250555.1|  PREDICTED: serine carboxypeptidase-like 45         127   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_006304410.1|  hypothetical protein CARUB_v10010972mg             126   1e-29   Capsella rubella
ref|XP_007139316.1|  hypothetical protein PHAVU_008G019100g             126   1e-29   Phaseolus vulgaris [French bean]
ref|XP_009334311.1|  PREDICTED: serine carboxypeptidase-like 45         126   1e-29   
gb|KHN08897.1|  Serine carboxypeptidase-like 45                         126   1e-29   Glycine soja [wild soybean]
gb|AAG51475.1|AC069471_6  serine carboxypeptidase II, putative          126   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337518.1|  PREDICTED: serine carboxypeptidase-like 45         126   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_003630573.1|  Serine carboxypeptidase                            126   2e-29   Medicago truncatula
ref|NP_850212.1|  serine carboxypeptidase-like 46                       126   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137891.1|  hypothetical protein PHAVU_009G164600g             126   2e-29   Phaseolus vulgaris [French bean]
gb|KJB35837.1|  hypothetical protein B456_006G130200                    125   2e-29   Gossypium raimondii
ref|XP_003554111.1|  PREDICTED: serine carboxypeptidase-like 45-like    125   2e-29   Glycine max [soybeans]
tpg|DAA38063.1|  TPA: hypothetical protein ZEAMMB73_252249              123   2e-29   
ref|XP_010549304.1|  PREDICTED: serine carboxypeptidase-like 45 i...    125   2e-29   Tarenaya hassleriana [spider flower]
ref|XP_008670742.1|  PREDICTED: serine carboxypeptidase-like 45         125   2e-29   Zea mays [maize]
ref|XP_006410496.1|  hypothetical protein EUTSA_v10016623mg             125   2e-29   Eutrema salsugineum [saltwater cress]
gb|KHG30064.1|  Serine carboxypeptidase-like 45                         125   2e-29   Gossypium arboreum [tree cotton]
gb|KDP37688.1|  hypothetical protein JCGZ_06345                         125   3e-29   Jatropha curcas
ref|XP_003551804.1|  PREDICTED: serine carboxypeptidase-like 45-like    125   3e-29   Glycine max [soybeans]
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg             125   3e-29   Citrus clementina [clementine]
ref|XP_007162064.1|  hypothetical protein PHAVU_001G120600g             125   3e-29   Phaseolus vulgaris [French bean]
ref|XP_012072731.1|  PREDICTED: serine carboxypeptidase-like 45         125   3e-29   Jatropha curcas
gb|KJB35838.1|  hypothetical protein B456_006G130200                    125   3e-29   Gossypium raimondii
gb|KJB35831.1|  hypothetical protein B456_006G130200                    125   3e-29   Gossypium raimondii
ref|XP_007145476.1|  hypothetical protein PHAVU_007G242200g             125   3e-29   Phaseolus vulgaris [French bean]
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1          125   3e-29   
ref|XP_011652217.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    125   3e-29   Cucumis sativus [cucumbers]
ref|XP_004310134.1|  PREDICTED: serine carboxypeptidase-like 45         125   4e-29   Fragaria vesca subsp. vesca
ref|XP_002881286.1|  hypothetical protein ARALYDRAFT_482299             125   4e-29   
ref|XP_011075459.1|  PREDICTED: serine carboxypeptidase-like 45         125   4e-29   Sesamum indicum [beniseed]
ref|XP_006294161.1|  hypothetical protein CARUB_v10023154mg             125   4e-29   Capsella rubella
gb|ACF83745.1|  unknown                                                 123   5e-29   Zea mays [maize]
ref|XP_006652227.1|  PREDICTED: serine carboxypeptidase-like 45-like    125   5e-29   Oryza brachyantha
gb|KJB31548.1|  hypothetical protein B456_005G196500                    125   5e-29   Gossypium raimondii
ref|XP_010549305.1|  PREDICTED: serine carboxypeptidase-like 45 i...    124   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_010929656.1|  PREDICTED: serine carboxypeptidase-like 45         124   6e-29   Elaeis guineensis
gb|ERN06205.1|  hypothetical protein AMTR_s00016p00162700               124   6e-29   Amborella trichopoda
gb|ACF83470.1|  unknown                                                 123   7e-29   Zea mays [maize]
ref|XP_007159975.1|  hypothetical protein PHAVU_002G282700g             123   7e-29   Phaseolus vulgaris [French bean]
ref|XP_010509871.1|  PREDICTED: serine carboxypeptidase-like 46         124   7e-29   Camelina sativa [gold-of-pleasure]
emb|CDY61693.1|  BnaC05g51120D                                          124   7e-29   Brassica napus [oilseed rape]
ref|XP_006844530.2|  PREDICTED: serine carboxypeptidase-like 45         124   7e-29   Amborella trichopoda
ref|NP_564298.1|  serine carboxypeptidase-like 45                       124   7e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EAY93940.1|  hypothetical protein OsI_15713                          124   7e-29   Oryza sativa Indica Group [Indian rice]
emb|CBI32794.3|  unnamed protein product                                124   8e-29   Vitis vinifera
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249              124   8e-29   
ref|XP_002280796.2|  PREDICTED: serine carboxypeptidase-like 45         124   8e-29   Vitis vinifera
gb|ACF83756.1|  unknown                                                 122   8e-29   Zea mays [maize]
ref|XP_007224935.1|  hypothetical protein PRUPE_ppa021576mg             124   9e-29   
ref|XP_002893504.1|  SCPL45                                             124   9e-29   
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45         124   9e-29   Vitis vinifera
ref|XP_004298533.1|  PREDICTED: serine carboxypeptidase-like 45         124   9e-29   Fragaria vesca subsp. vesca
ref|XP_006585840.1|  PREDICTED: serine carboxypeptidase-like 45-l...    123   1e-28   Glycine max [soybeans]
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45         124   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_003531913.1|  PREDICTED: serine carboxypeptidase-like 45-l...    124   1e-28   Glycine max [soybeans]
ref|XP_011088288.1|  PREDICTED: serine carboxypeptidase II-3-like       124   1e-28   
gb|KHN47533.1|  Serine carboxypeptidase-like 45                         123   1e-28   Glycine soja [wild soybean]
ref|XP_006662960.1|  PREDICTED: serine carboxypeptidase-like 45-like    123   1e-28   Oryza brachyantha
ref|XP_004238587.1|  PREDICTED: putative serine carboxypeptidase-...    123   1e-28   Solanum lycopersicum
ref|XP_002990798.1|  serine carboxypeptidase-like enzyme                123   1e-28   
ref|XP_002974500.1|  serine carboxypeptidase-like enzyme                123   2e-28   
gb|KHN08898.1|  Serine carboxypeptidase-like 45                         123   2e-28   Glycine soja [wild soybean]
ref|XP_009404114.1|  PREDICTED: serine carboxypeptidase-like 45         123   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009355265.1|  PREDICTED: serine carboxypeptidase-like 45         123   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_010469459.1|  PREDICTED: serine carboxypeptidase-like 46         123   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009109757.1|  PREDICTED: serine carboxypeptidase-like 45         123   2e-28   Brassica rapa
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1         123   2e-28   
ref|XP_009368797.1|  PREDICTED: serine carboxypeptidase-like 45         123   2e-28   Pyrus x bretschneideri [bai li]
gb|KFK44682.1|  hypothetical protein AALP_AA1G289900                    123   2e-28   Arabis alpina [alpine rockcress]
emb|CDX90124.1|  BnaA08g18600D                                          123   2e-28   
ref|XP_003554110.2|  PREDICTED: serine carboxypeptidase-like 45-like    123   2e-28   
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580          123   2e-28   Sorghum bicolor [broomcorn]
gb|KHN09723.1|  Serine carboxypeptidase-like 45                         122   2e-28   Glycine soja [wild soybean]
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor          122   3e-28   
ref|XP_011020860.1|  PREDICTED: serine carboxypeptidase-like 45         122   3e-28   Populus euphratica
ref|XP_010413849.1|  PREDICTED: serine carboxypeptidase-like 46         122   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002304645.2|  hypothetical protein POPTR_0003s16250g             121   3e-28   
ref|XP_009415855.1|  PREDICTED: serine carboxypeptidase-like 45         122   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011086871.1|  PREDICTED: serine carboxypeptidase-like 45         122   3e-28   Sesamum indicum [beniseed]
ref|XP_007159978.1|  hypothetical protein PHAVU_002G282700g             122   3e-28   Phaseolus vulgaris [French bean]
ref|XP_011088747.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    122   3e-28   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2         122   3e-28   
ref|XP_002307963.1|  hypothetical protein POPTR_0006s03490g             122   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_002512656.1|  serine carboxypeptidase, putative                  122   4e-28   
ref|NP_001151474.1|  LOC100285107 precursor                             122   4e-28   
ref|XP_003528093.2|  PREDICTED: serine carboxypeptidase-like 45-like    122   4e-28   Glycine max [soybeans]
gb|EYU21824.1|  hypothetical protein MIMGU_mgv1a006099mg                122   4e-28   Erythranthe guttata [common monkey flower]
ref|XP_006589008.1|  PREDICTED: serine carboxypeptidase-like 45-like    122   5e-28   Glycine max [soybeans]
gb|KCW64995.1|  hypothetical protein EUGRSUZ_G02537                     122   5e-28   Eucalyptus grandis [rose gum]
gb|KHN07932.1|  Serine carboxypeptidase-like 45                         122   5e-28   Glycine soja [wild soybean]
ref|XP_012088729.1|  PREDICTED: serine carboxypeptidase-like 45         122   5e-28   Jatropha curcas
ref|XP_010460580.1|  PREDICTED: serine carboxypeptidase-like 45         122   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_008374178.1|  PREDICTED: serine carboxypeptidase-like 45         121   6e-28   
ref|XP_010499305.1|  PREDICTED: serine carboxypeptidase-like 45         121   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010478165.1|  PREDICTED: serine carboxypeptidase-like 45         121   7e-28   Camelina sativa [gold-of-pleasure]
gb|KHN13827.1|  Serine carboxypeptidase-like 45                         121   8e-28   Glycine soja [wild soybean]
ref|XP_011073181.1|  PREDICTED: serine carboxypeptidase-like 45         121   8e-28   Sesamum indicum [beniseed]
ref|XP_002449560.1|  hypothetical protein SORBIDRAFT_05g019090          121   9e-28   
gb|ERN14541.1|  hypothetical protein AMTR_s00038p00086160               120   1e-27   Amborella trichopoda
ref|NP_001176565.1|  Os11g0522900                                       121   1e-27   
ref|XP_008791046.1|  PREDICTED: serine carboxypeptidase-like 45         121   1e-27   Phoenix dactylifera
gb|EEC68261.1|  hypothetical protein OsI_36290                          121   1e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_009607740.1|  PREDICTED: serine carboxypeptidase-like 40         120   1e-27   
ref|XP_011036159.1|  PREDICTED: serine carboxypeptidase-like 45 i...    120   1e-27   Populus euphratica
ref|XP_002520628.1|  serine carboxypeptidase, putative                  120   1e-27   
ref|XP_009355272.1|  PREDICTED: serine carboxypeptidase-like 45 i...    120   2e-27   Pyrus x bretschneideri [bai li]
ref|NP_001052663.1|  Os04g0396800                                       120   2e-27   
emb|CDY11750.1|  BnaC03g58280D                                          120   2e-27   Brassica napus [oilseed rape]
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45         120   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_010234952.1|  PREDICTED: serine carboxypeptidase-like 34         120   2e-27   
ref|XP_009355267.1|  PREDICTED: serine carboxypeptidase-like 45 i...    120   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_007159976.1|  hypothetical protein PHAVU_002G282700g             119   2e-27   Phaseolus vulgaris [French bean]
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme                120   2e-27   Selaginella moellendorffii
ref|XP_010678341.1|  PREDICTED: serine carboxypeptidase-like 45         120   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006853074.2|  PREDICTED: serine carboxypeptidase II-3            120   2e-27   
ref|XP_012086498.1|  PREDICTED: serine carboxypeptidase-like 27         120   2e-27   Jatropha curcas
ref|XP_011040748.1|  PREDICTED: serine carboxypeptidase-like 45 i...    120   2e-27   Populus euphratica
ref|XP_002297872.2|  serine carboxypeptidase S10 family protein         120   2e-27   
ref|XP_003577529.1|  PREDICTED: serine carboxypeptidase-like 45         120   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_008357674.1|  PREDICTED: serine carboxypeptidase-like 45         119   3e-27   
ref|XP_002307961.1|  hypothetical protein POPTR_0006s03440g             119   3e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45         119   3e-27   Populus euphratica
gb|KEH35413.1|  serine carboxypeptidase-like protein                    119   3e-27   Medicago truncatula
ref|XP_002517289.1|  serine carboxypeptidase, putative                  119   3e-27   Ricinus communis
ref|XP_011036160.1|  PREDICTED: serine carboxypeptidase-like 45 i...    119   4e-27   Populus euphratica
ref|XP_010664883.1|  PREDICTED: serine carboxypeptidase-like 42 i...    119   4e-27   Vitis vinifera
gb|KCW78823.1|  hypothetical protein EUGRSUZ_C00253                     119   4e-27   Eucalyptus grandis [rose gum]
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme                119   4e-27   Selaginella moellendorffii
ref|XP_009592799.1|  PREDICTED: serine carboxypeptidase-like 40         120   4e-27   
ref|XP_007032750.1|  Serine carboxypeptidase-like 25 isoform 3          119   4e-27   
ref|XP_010682654.1|  PREDICTED: serine carboxypeptidase-like 45         119   5e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011009402.1|  PREDICTED: serine carboxypeptidase-like 25 i...    119   5e-27   Populus euphratica
ref|XP_004503800.1|  PREDICTED: serine carboxypeptidase-like 45-like    119   5e-27   
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    119   5e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    119   6e-27   Nelumbo nucifera [Indian lotus]
gb|EYU28449.1|  hypothetical protein MIMGU_mgv1a004999mg                119   6e-27   Erythranthe guttata [common monkey flower]
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g             119   6e-27   Populus trichocarpa [western balsam poplar]
gb|AFK38452.1|  unknown                                                 113   7e-27   Lotus japonicus
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    119   7e-27   Populus euphratica
ref|XP_009355269.1|  PREDICTED: serine carboxypeptidase-like 45         118   7e-27   Pyrus x bretschneideri [bai li]
ref|XP_008230880.1|  PREDICTED: serine carboxypeptidase-like 25         115   7e-27   
ref|XP_010099600.1|  Serine carboxypeptidase-like 45                    118   8e-27   Morus notabilis
ref|XP_007159977.1|  hypothetical protein PHAVU_002G282700g             118   8e-27   Phaseolus vulgaris [French bean]
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         118   8e-27   Eucalyptus grandis [rose gum]
ref|XP_002278193.1|  PREDICTED: serine carboxypeptidase-like 42 i...    118   8e-27   Vitis vinifera
ref|XP_006648043.1|  PREDICTED: serine carboxypeptidase 24-like         117   9e-27   
emb|CDP10248.1|  unnamed protein product                                118   9e-27   Coffea canephora [robusta coffee]
gb|EMT30771.1|  Serine carboxypeptidase-like 45                         118   9e-27   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          119   9e-27   
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         118   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007137531.1|  hypothetical protein PHAVU_009G134900g             118   1e-26   Phaseolus vulgaris [French bean]
ref|XP_006373742.1|  hypothetical protein POPTR_0016s04660g             117   1e-26   
ref|XP_004979352.1|  PREDICTED: serine carboxypeptidase-like 45-like    118   1e-26   Setaria italica
gb|KDO53634.1|  hypothetical protein CISIN_1g0128612mg                  117   1e-26   Citrus sinensis [apfelsine]
ref|XP_004513403.1|  PREDICTED: serine carboxypeptidase-like 45-like    117   1e-26   Cicer arietinum [garbanzo]
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42         118   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_006354958.1|  PREDICTED: serine carboxypeptidase-like 40-like    118   1e-26   Solanum tuberosum [potatoes]
ref|XP_012090606.1|  PREDICTED: serine carboxypeptidase-like 45 i...    117   1e-26   Jatropha curcas
gb|ABR16596.1|  unknown                                                 118   1e-26   Picea sitchensis
gb|EMS60816.1|  Serine carboxypeptidase-like 45                         118   1e-26   Triticum urartu
ref|NP_001152245.1|  lysosomal protective protein precursor             117   1e-26   
emb|CAN70439.1|  hypothetical protein VITISV_011900                     117   1e-26   Vitis vinifera
ref|XP_008454133.1|  PREDICTED: serine carboxypeptidase-like 45         117   1e-26   
gb|KEH21654.1|  serine carboxypeptidase-like protein                    117   1e-26   Medicago truncatula
ref|XP_011040747.1|  PREDICTED: serine carboxypeptidase-like 45 i...    117   1e-26   Populus euphratica
ref|XP_004152156.1|  PREDICTED: serine carboxypeptidase-like 45         117   1e-26   Cucumis sativus [cucumbers]
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         117   1e-26   Gossypium arboreum [tree cotton]
gb|KDP38690.1|  hypothetical protein JCGZ_04043                         115   2e-26   Jatropha curcas
ref|XP_009777076.1|  PREDICTED: putative serine carboxypeptidase-...    117   2e-26   Nicotiana sylvestris
ref|XP_012084825.1|  PREDICTED: serine carboxypeptidase-like 25         117   2e-26   Jatropha curcas
ref|XP_007218368.1|  hypothetical protein PRUPE_ppa011205mg             114   2e-26   
ref|XP_009355268.1|  PREDICTED: serine carboxypeptidase-like 45 i...    117   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_006430527.1|  hypothetical protein CICLE_v10011695mg             117   2e-26   Citrus clementina [clementine]
ref|XP_006482059.1|  PREDICTED: serine carboxypeptidase-like 45-like    117   2e-26   Citrus sinensis [apfelsine]
gb|KHN30340.1|  Serine carboxypeptidase-like 45                         117   2e-26   
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45         117   2e-26   
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like    117   2e-26   
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45         117   2e-26   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          117   2e-26   
gb|EMS58238.1|  Serine carboxypeptidase-like 45                         117   2e-26   
gb|EMT32671.1|  Serine carboxypeptidase-like 34                         117   2e-26   
gb|ABK21145.1|  unknown                                                 116   2e-26   
gb|KJB78938.1|  hypothetical protein B456_013G026200                    117   2e-26   
ref|XP_004230572.1|  PREDICTED: serine carboxypeptidase-like 42 i...    117   2e-26   
ref|XP_012090605.1|  PREDICTED: serine carboxypeptidase-like 45 i...    117   2e-26   
ref|XP_006351861.1|  PREDICTED: serine carboxypeptidase-like 42-like    117   2e-26   
ref|XP_011027377.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    117   3e-26   
ref|XP_008441654.1|  PREDICTED: serine carboxypeptidase-like 42         116   3e-26   
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    117   3e-26   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    117   3e-26   
gb|ABR16997.1|  unknown                                                 117   3e-26   
ref|XP_011040386.1|  PREDICTED: serine carboxypeptidase-like 45         115   3e-26   
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    116   3e-26   
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         116   3e-26   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    116   3e-26   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               116   3e-26   
emb|CDO98312.1|  unnamed protein product                                116   3e-26   
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    116   3e-26   
ref|XP_009767155.1|  PREDICTED: serine carboxypeptidase-like 42 i...    116   4e-26   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         116   4e-26   
gb|KJB07561.1|  hypothetical protein B456_001G032600                    116   4e-26   
ref|XP_009767156.1|  PREDICTED: serine carboxypeptidase-like 42 i...    116   4e-26   
ref|XP_002972012.1|  serine carboxypeptidase-like enzyme                116   4e-26   
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                116   4e-26   
ref|XP_011040753.1|  PREDICTED: serine carboxypeptidase-like 45         116   4e-26   
ref|XP_002307164.2|  hypothetical protein POPTR_0005s09410g             113   5e-26   
gb|KJB07563.1|  hypothetical protein B456_001G032600                    116   5e-26   
gb|ACU21427.1|  unknown                                                 113   5e-26   
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         116   5e-26   
dbj|BAD19262.1|  putative carboxypeptidase D                            115   5e-26   
gb|KHN30341.1|  Serine carboxypeptidase-like 45                         115   6e-26   
gb|KJB07564.1|  hypothetical protein B456_001G032600                    116   6e-26   
gb|KJB07559.1|  hypothetical protein B456_001G032600                    116   6e-26   
ref|XP_006373361.1|  hypothetical protein POPTR_0017s12960g             114   6e-26   
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like    115   6e-26   
ref|XP_009355271.1|  PREDICTED: serine carboxypeptidase-like 45 i...    116   6e-26   
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45         115   6e-26   
ref|XP_009355270.1|  PREDICTED: serine carboxypeptidase-like 45 i...    115   6e-26   
ref|XP_002511104.1|  serine carboxypeptidase, putative                  115   7e-26   
ref|XP_012072734.1|  PREDICTED: serine carboxypeptidase-like 45 i...    115   7e-26   
ref|XP_004136792.1|  PREDICTED: serine carboxypeptidase-like 45         115   7e-26   
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45         115   7e-26   
ref|XP_002300939.1|  serine carboxypeptidase S10 family protein         115   7e-26   
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...    115   8e-26   
ref|XP_010062160.1|  PREDICTED: serine carboxypeptidase-like 42         115   8e-26   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         115   9e-26   
ref|XP_008460256.1|  PREDICTED: serine carboxypeptidase-like 25 i...    115   9e-26   
ref|XP_002865553.1|  hypothetical protein ARALYDRAFT_494807             115   9e-26   
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         115   1e-25   
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         115   1e-25   
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like    115   1e-25   
gb|EAY87844.1|  hypothetical protein OsI_09265                          115   1e-25   
ref|NP_001048377.1|  Os02g0794500                                       115   1e-25   
ref|XP_008810326.1|  PREDICTED: serine carboxypeptidase 24              115   1e-25   
ref|XP_010315077.1|  PREDICTED: serine carboxypeptidase-like 42 i...    115   1e-25   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    115   1e-25   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         115   1e-25   
ref|XP_012072739.1|  PREDICTED: serine carboxypeptidase-like 45         115   1e-25   
ref|XP_008645971.1|  PREDICTED: serine carboxypeptidase-like 34         110   1e-25   
ref|XP_011088748.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    115   1e-25   
ref|XP_012071521.1|  PREDICTED: serine carboxypeptidase 24 isofor...    115   1e-25   
ref|XP_002517286.1|  serine carboxypeptidase, putative                  115   1e-25   
ref|XP_003520486.1|  PREDICTED: serine carboxypeptidase-like 45-l...    115   1e-25   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         115   1e-25   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             115   1e-25   
ref|XP_002459313.1|  hypothetical protein SORBIDRAFT_02g002260          115   1e-25   
gb|KJB75608.1|  hypothetical protein B456_012G048700                    115   1e-25   
gb|KDO59486.1|  hypothetical protein CISIN_1g0120681mg                  114   1e-25   
ref|XP_007219042.1|  hypothetical protein PRUPE_ppa004618mg             114   1e-25   
ref|XP_006482750.1|  PREDICTED: serine carboxypeptidase-like 25-l...    115   1e-25   
ref|XP_002972549.1|  serine carboxypeptidase-like enzyme                115   1e-25   
ref|XP_004515138.1|  PREDICTED: serine carboxypeptidase-like 42-like    115   1e-25   
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             115   1e-25   
ref|XP_011653364.1|  PREDICTED: serine carboxypeptidase-like 25 i...    114   1e-25   
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme                115   1e-25   
gb|ACF87497.1|  unknown                                                 113   1e-25   
ref|XP_004148827.1|  PREDICTED: serine carboxypeptidase-like 42         115   2e-25   
ref|XP_008812782.1|  PREDICTED: serine carboxypeptidase-like 34         115   2e-25   
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45         114   2e-25   
gb|AAO41950.1|  putative serine-type carboxypeptidase                   114   2e-25   
gb|KDO52736.1|  hypothetical protein CISIN_1g0420602mg                  113   2e-25   
ref|XP_006482749.1|  PREDICTED: serine carboxypeptidase-like 25-l...    114   2e-25   
ref|XP_010679983.1|  PREDICTED: serine carboxypeptidase-like 42         114   2e-25   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              114   2e-25   
tpg|DAA46115.1|  TPA: hypothetical protein ZEAMMB73_496779              114   2e-25   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             114   2e-25   
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...    114   2e-25   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             114   2e-25   
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         114   2e-25   
ref|NP_190769.1|  serine carboxypeptidase-like 37                       114   2e-25   
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    114   2e-25   
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    114   2e-25   
ref|XP_011620351.1|  PREDICTED: serine carboxypeptidase-like 44         114   2e-25   
ref|XP_006482748.1|  PREDICTED: serine carboxypeptidase-like 25-l...    114   2e-25   
ref|XP_007219043.1|  hypothetical protein PRUPE_ppa004618mg             114   2e-25   
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42         114   2e-25   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         114   2e-25   
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1          114   2e-25   
ref|XP_007019398.1|  Serine carboxypeptidase-like 42 isoform 2          114   2e-25   
ref|XP_010673054.1|  PREDICTED: serine carboxypeptidase-like 45         114   2e-25   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          114   2e-25   
ref|XP_008378883.1|  PREDICTED: serine carboxypeptidase-like 45         114   2e-25   
ref|XP_008803196.1|  PREDICTED: serine carboxypeptidase-like 34         114   2e-25   
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         114   2e-25   
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    114   2e-25   
ref|XP_009586680.1|  PREDICTED: serine carboxypeptidase-like 42         114   2e-25   
ref|XP_007161488.1|  hypothetical protein PHAVU_001G0732000g            112   2e-25   
ref|XP_008373913.1|  PREDICTED: serine carboxypeptidase-like 42         114   2e-25   
ref|XP_006581614.1|  PREDICTED: serine carboxypeptidase-like 42-l...    114   2e-25   
ref|XP_011040750.1|  PREDICTED: serine carboxypeptidase-like 45         114   2e-25   
emb|CAN72075.1|  hypothetical protein VITISV_041582                     113   2e-25   
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         114   2e-25   
gb|ERM97972.1|  hypothetical protein AMTR_s00117p00106310               114   3e-25   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             114   3e-25   
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25 i...    114   3e-25   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         114   3e-25   
gb|EMT20638.1|  Serine carboxypeptidase-like 34                         114   3e-25   
dbj|BAK06862.1|  predicted protein                                      111   3e-25   
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    114   3e-25   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         114   3e-25   
gb|KEH33274.1|  serine carboxypeptidase-like protein                    114   3e-25   
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          114   3e-25   
gb|AES71588.2|  serine carboxypeptidase-like protein                    114   3e-25   
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             114   3e-25   
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               114   3e-25   
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               114   3e-25   
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    114   3e-25   
ref|XP_009351730.1|  PREDICTED: serine carboxypeptidase-like 35         114   3e-25   
ref|XP_011101717.1|  PREDICTED: serine carboxypeptidase-like 42         114   3e-25   
gb|EMS58878.1|  Serine carboxypeptidase-like 34                         113   3e-25   
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme                114   4e-25   
ref|XP_002862434.1|  hypothetical protein ARALYDRAFT_497456             113   4e-25   
ref|XP_010468548.1|  PREDICTED: serine carboxypeptidase-like 43         113   4e-25   
gb|ADN33978.1|  serine carboxypeptidase                                 113   4e-25   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    113   4e-25   
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45         113   4e-25   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         113   4e-25   
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         113   4e-25   
ref|XP_010108549.1|  Serine carboxypeptidase 24                         114   4e-25   
ref|XP_011652151.1|  PREDICTED: serine carboxypeptidase-like 45 i...    113   4e-25   
ref|NP_199038.1|  serine carboxypeptidase-like 41                       113   5e-25   
ref|XP_011652150.1|  PREDICTED: serine carboxypeptidase-like 45 i...    113   5e-25   
ref|XP_003527966.2|  PREDICTED: serine carboxypeptidase-like 42-l...    113   5e-25   
ref|XP_008443182.1|  PREDICTED: serine carboxypeptidase-like 45 i...    113   5e-25   
ref|XP_008443181.1|  PREDICTED: serine carboxypeptidase-like 45 i...    113   5e-25   
ref|XP_010933315.1|  PREDICTED: serine carboxypeptidase-like 34         113   5e-25   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    113   5e-25   
ref|XP_003592367.1|  Serine carboxypeptidase-like protein               113   5e-25   
gb|KHN23425.1|  Serine carboxypeptidase-like 42                         113   5e-25   
ref|XP_006423055.1|  hypothetical protein CICLE_v10028330mg             113   5e-25   
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    113   5e-25   
gb|AES62618.2|  serine carboxypeptidase-like protein                    113   5e-25   
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    113   5e-25   
emb|CBI21207.3|  unnamed protein product                                113   5e-25   
ref|NP_001150705.1|  LOC100284338 precursor                             113   6e-25   
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         113   6e-25   
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27         113   6e-25   
ref|XP_002529402.1|  serine carboxypeptidase, putative                  113   6e-25   
ref|NP_175046.1|  serine carboxypeptidase-like 44                       113   6e-25   
gb|KDO49122.1|  hypothetical protein CISIN_1g044068mg                   113   6e-25   
ref|XP_007154876.1|  hypothetical protein PHAVU_003G155400g             112   6e-25   
emb|CAN63486.1|  hypothetical protein VITISV_017087                     113   6e-25   
ref|XP_002281988.1|  PREDICTED: serine carboxypeptidase II-3-like       113   7e-25   
emb|CDP12019.1|  unnamed protein product                                113   7e-25   
ref|XP_006434837.1|  hypothetical protein CICLE_v10003343mg             112   7e-25   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         113   7e-25   
emb|CBI32446.3|  unnamed protein product                                113   7e-25   
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         112   7e-25   
ref|XP_012066078.1|  PREDICTED: serine carboxypeptidase-like 42         113   7e-25   
ref|XP_003592242.1|  Serine carboxypeptidase-like protein               113   7e-25   
ref|XP_009377698.1|  PREDICTED: serine carboxypeptidase-like 42         112   7e-25   
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg             112   7e-25   
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         113   7e-25   
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   112   7e-25   
gb|KEH17668.1|  serine carboxypeptidase-like protein                    113   7e-25   
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              112   7e-25   
ref|XP_010055765.1|  PREDICTED: serine carboxypeptidase-like 45         112   8e-25   
ref|XP_002465006.1|  hypothetical protein SORBIDRAFT_01g030370          112   8e-25   
gb|EYU18606.1|  hypothetical protein MIMGU_mgv1a004861mg                113   8e-25   
gb|KCW90021.1|  hypothetical protein EUGRSUZ_A02221                     112   8e-25   
ref|XP_004490638.1|  PREDICTED: serine carboxypeptidase-like 42-l...    112   8e-25   
ref|XP_008340442.1|  PREDICTED: serine carboxypeptidase-like 35         113   8e-25   
ref|XP_011074776.1|  PREDICTED: serine carboxypeptidase-like 42         112   8e-25   
ref|XP_004490637.1|  PREDICTED: serine carboxypeptidase-like 42-l...    113   9e-25   
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              112   9e-25   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   112   9e-25   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          112   9e-25   
ref|XP_001776058.1|  predicted protein                                  112   9e-25   
gb|EMS47606.1|  Serine carboxypeptidase-like 27                         112   9e-25   
ref|XP_007028219.1|  Serine carboxypeptidase-like 45                    114   9e-25   
ref|XP_002527614.1|  serine carboxypeptidase, putative                  112   1e-24   
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              112   1e-24   
ref|XP_010279510.1|  PREDICTED: serine carboxypeptidase-like 40         112   1e-24   
emb|CDY39224.1|  BnaA03g50360D                                          112   1e-24   
ref|XP_004241645.1|  PREDICTED: serine carboxypeptidase-like 45         112   1e-24   
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         112   1e-24   
ref|XP_009600050.1|  PREDICTED: serine carboxypeptidase-like 42         112   1e-24   
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                112   1e-24   
ref|XP_010112533.1|  Serine carboxypeptidase-like 34                    112   1e-24   
ref|XP_010653632.1|  PREDICTED: serine carboxypeptidase-like 45         112   1e-24   
ref|XP_008352213.1|  PREDICTED: serine carboxypeptidase 24-like         111   1e-24   
ref|XP_009792171.1|  PREDICTED: serine carboxypeptidase-like 40         112   1e-24   
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         112   1e-24   
ref|XP_010432964.1|  PREDICTED: serine carboxypeptidase 24 isofor...    112   1e-24   
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    112   1e-24   
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             112   1e-24   
ref|XP_008797239.1|  PREDICTED: serine carboxypeptidase-like 34         113   1e-24   
ref|XP_010279513.1|  PREDICTED: serine carboxypeptidase-like 40 i...    111   1e-24   
ref|XP_002272961.1|  PREDICTED: serine carboxypeptidase-like 40 i...    112   1e-24   
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                112   1e-24   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         112   2e-24   
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179             112   2e-24   
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         111   2e-24   
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                111   2e-24   
gb|KCW90016.1|  hypothetical protein EUGRSUZ_A02215                     112   2e-24   



>ref|XP_010322561.1| PREDICTED: serine carboxypeptidase-like 46 isoform X3 [Solanum 
lycopersicum]
Length=394

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 145/226 (64%), Gaps = 16/226 (7%)
 Frame = -1

Query  861  ELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY--LAT----------ET  718
            E S  C+ +  + +EE+G+D+ K +++   C SSS +   +    L T          + 
Sbjct  164  ETSNECAKVIELRTEEMGNDIVKYDVLLPKCVSSSAAGRLKALGNLTTVHGKFDKKVGKV  223

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTS-PGKTSDVILHNFAIDILPTLSA  541
            ADPCL +W+  Y+N+P+VQKALHANTT   Y W   S P +     + + AIDI+P LS 
Sbjct  224  ADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCSGPLQYK---MEDAAIDIIPLLSN  280

Query  540  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  361
            +L   IP+L++SGDQD  +P++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ++G
Sbjct  281  ILKQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYG  340

Query  360  NSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                   +  LTFATVRG AH VP +SPSQALTLF+AFL+G PPPR
Sbjct  341  GVREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPPR  386



>ref|XP_010322533.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Solanum 
lycopersicum]
Length=447

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 145/226 (64%), Gaps = 16/226 (7%)
 Frame = -1

Query  861  ELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY--LAT----------ET  718
            E S  C+ +  + +EE+G+D+ K +++   C SSS +   +    L T          + 
Sbjct  217  ETSNECAKVIELRTEEMGNDIVKYDVLLPKCVSSSAAGRLKALGNLTTVHGKFDKKVGKV  276

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTS-PGKTSDVILHNFAIDILPTLSA  541
            ADPCL +W+  Y+N+P+VQKALHANTT   Y W   S P +     + + AIDI+P LS 
Sbjct  277  ADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCSGPLQYK---MEDAAIDIIPLLSN  333

Query  540  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  361
            +L   IP+L++SGDQD  +P++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ++G
Sbjct  334  ILKQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYG  393

Query  360  NSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                   +  LTFATVRG AH VP +SPSQALTLF+AFL+G PPPR
Sbjct  394  GVREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPPR  439



>ref|XP_006363923.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=480

 Score =   191 bits (484),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 144/228 (63%), Gaps = 20/228 (9%)
 Frame = -1

Query  861  ELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY--LAT----------ET  718
            E S  C+ +    +EE+G+D+ + +++   C SSS +   +    LAT          + 
Sbjct  250  ETSNECAKVMEHKTEEMGNDIVRYDILLPKCVSSSAAGQLKALGNLATVHEKFDKKVGKV  309

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTS---PGKTSDVILHNFAIDILPTL  547
            ADPCL++W+  Y+N+P+VQKALHANTT   Y W   S     K  DV     A DI+P L
Sbjct  310  ADPCLKEWINLYLNKPEVQKALHANTTNLPYSWEVCSGPLQYKMEDV-----ATDIIPLL  364

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
            S +L   IP+L++SGDQD  +P++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ+
Sbjct  365  SNILKQHIPILLFSGDQDSILPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQS  424

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            +G       V  LTFATVRG AH VP +SPSQALTLF+AFL+G PPPR
Sbjct  425  YGGVREGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPPR  472



>ref|XP_004228838.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=482

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 143/225 (64%), Gaps = 14/225 (6%)
 Frame = -1

Query  861  ELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY--LAT----------ET  718
            E S  C+ +  + +EE+G+D+ K +++   C SSS +   +    L T          + 
Sbjct  252  ETSNECAKVIELRTEEMGNDIVKYDVLLPKCVSSSAAGRLKALGNLTTVHGKFDKKVGKV  311

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  538
            ADPCL +W+  Y+N+P+VQKALHANTT   Y W   S        + + AIDI+P LS +
Sbjct  312  ADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCS--GPLQYKMEDAAIDIIPLLSNI  369

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            L   IP+L++SGDQD  +P++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ++G 
Sbjct  370  LKQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYGG  429

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                  +  LTFATVRG AH VP +SPSQALTLF+AFL+G PPPR
Sbjct  430  VREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPPR  474



>ref|XP_006363924.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=493

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 139/225 (62%), Gaps = 11/225 (5%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLV--FqscesssisssqQHYLAT-------ET  718
            +   +S  CS++  + +EE+G D D  +L+        ++        LAT       ++
Sbjct  247  IHNNMSNDCSEVWELTNEEMGSDTDMGDLLAPICVSSGAAGQLGVLGKLATIHEKDVRKS  306

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  538
             DPCL D +  Y+N+P+VQKALHANTT   Y W+F            + AI+++P LS +
Sbjct  307  GDPCLTDRIYMYLNKPEVQKALHANTTHLPYAWDFCLGHLQYQR--GDLAINVIPLLSNI  364

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            L  +I VL+YSGDQD +IPV+ TR++A +LA  LKL  L+  GPWYD  +IGGWSQ++G 
Sbjct  365  LKENIQVLLYSGDQDTKIPVTQTRKIAKLLARDLKLVALDKYGPWYDDLQIGGWSQSYGG  424

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                  V  LTFATVRG AH VP +SPSQALTLF+AFLKG PPPR
Sbjct  425  VREGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLKGQPPPR  469



>ref|XP_006363922.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=496

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 138/227 (61%), Gaps = 11/227 (5%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLV--FqscesssisssqQHYLAT-------ET  718
            +   +S  CS++  + +EE+G D D  +L+        ++        LAT       + 
Sbjct  250  IHNNMSNECSEVWELTNEEMGSDTDMGDLLAPICVSSGAAGQLGVLGTLATIHKKDVRKI  309

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  538
             DPCL D +  Y+N+P+VQKALHANTT   Y W+F            + AI+++P LS +
Sbjct  310  GDPCLTDRINMYLNKPEVQKALHANTTHLPYAWDFCLGHLQYQR--GDLAINVIPLLSNI  367

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            L  +I VL+YSGDQD +IP++ TR++A +LA  LKL  L+  GPWYD  +IGGWSQ++G 
Sbjct  368  LKENIQVLLYSGDQDTKIPLTQTRKIAKLLARDLKLVALDKYGPWYDDMQIGGWSQSYGG  427

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTN  217
                  V  LTFATVRG AH VP +SPSQALTLF+AFLKG PP R N
Sbjct  428  VIEGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLKGQPPSRRN  474



>ref|XP_004228389.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=490

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 134/223 (60%), Gaps = 11/223 (5%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLV--FqscesssisssqQHYLAT-------ETADPC  706
            +S  CS +  + +EE+G D D  +L+         +        LA+       E  DPC
Sbjct  251  MSNECSKVWDLTNEEMGSDTDTGDLLAPICVSSGVAGQLGVLGKLASIHEKDVREIGDPC  310

Query  705  LRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSD  526
            L D +  Y+N+P+VQKALHANTT   Y W+F            + AI+++P LS +L  +
Sbjct  311  LTDRIYMYLNKPEVQKALHANTTHLPYAWDFCLGHLQYQR--GDLAINVIPLLSNILKEN  368

Query  525  IPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRC  346
            I VL+YSGDQD +IP++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ+FG     
Sbjct  369  IQVLLYSGDQDTKIPLTQTRKIAKLLARDLKLVALDKYGPWYDGLQIGGWSQSFGGVREG  428

Query  345  NKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTN  217
              V  LTFAT+RG AH VP +SPSQALTLF+ FLKG  P R N
Sbjct  429  KNVTYLTFATIRGAAHEVPYTSPSQALTLFRTFLKGQSPSRKN  471



>ref|XP_009762845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=486

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 141/233 (61%), Gaps = 22/233 (9%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLAT-----------  724
            +   LS  C  +  +  EE+G D+D  +L+      SS ++ Q   LAT           
Sbjct  249  IHNNLSNECKKVSELTDEEMGSDIDMGDLL-APTCVSSGTAKQLGALATIHGKFVKKAVG  307

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAIDIL  556
            E ADPCL D +  Y+N+P+VQKALHANTT   Y W+F          LH    + A++ +
Sbjct  308  EVADPCLTDRINLYLNKPEVQKALHANTTYLPYAWDFCLGN------LHYRREDLAVNTI  361

Query  555  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  376
            P LS +L  +I VL++SGDQD +IP++ TR++A +LA  +KL  L+  G WYDG +IGGW
Sbjct  362  PLLSNILKENIQVLLFSGDQDSKIPLTQTRKIAKLLARDVKLVALDKYGSWYDGLQIGGW  421

Query  375  SQTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTN  217
            SQ+FG       +  LTFATVRG AH VP +SPSQALTLF+AFL+G PPP  N
Sbjct  422  SQSFGGLREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGHPPPPRN  474



>gb|KDO72510.1| hypothetical protein CISIN_1g039529mg [Citrus sinensis]
Length=477

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 133/224 (59%), Gaps = 15/224 (7%)
 Frame = -1

Query  855  SEYCSDIEIMLSEEIGHDMDKENLV-------------FqscesssisssqQHYLATETA  715
            S+ C+ +   +SEE+G D+D+++L+             F+  +               T 
Sbjct  253  SQGCNQVFDRISEEVGADIDRQDLLSPFCIPISTSTEQFKPIDKHGKIHKTMARRGASTG  312

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPC+   +  Y+N+P VQKALHANTT   + W+F            +F ++I+P +S LL
Sbjct  313  DPCIYGRIFTYLNKPKVQKALHANTTHLPFHWDFCDGPLVYQ--FEDFELNIIPLVSELL  370

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               IP+L+YSGDQD +IP++ TR +A  LA  LKL  +   GPWY+ K++GGWSQ+FG  
Sbjct  371  KEGIPILLYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTTYGPWYNDKQVGGWSQSFGAF  430

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                 V NLTFATVRGGAH VP +SPS+ALTLF++ L GSP PR
Sbjct  431  RDGKNVTNLTFATVRGGAHEVPFTSPSEALTLFRSLLTGSPLPR  474



>ref|XP_006431097.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
 gb|ESR44337.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
Length=477

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 132/224 (59%), Gaps = 15/224 (7%)
 Frame = -1

Query  855  SEYCSDIEIMLSEEIGHDMDKENLV-------------FqscesssisssqQHYLATETA  715
            S+ C+ +   +SEE+G D+D+++L+             F+  +               T 
Sbjct  253  SQGCNQVFDRISEEVGADIDRQDLLSPFCIPISTSTEQFKPIDKHGKIHKTMARRGASTG  312

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPC+   +  Y+N+P VQKALHANTT   + W+F            +F ++I+P +S LL
Sbjct  313  DPCIYGRIFTYLNKPKVQKALHANTTHLPFHWDFCDGPLVYQ--FEDFELNIIPLVSELL  370

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               IP+L+YSGDQD +IP++ TR +A  LA  LKL  +   GPWY+ K++GGWSQ+FG  
Sbjct  371  KEGIPILLYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTTYGPWYNDKQVGGWSQSFGAF  430

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                 V NLTFAT RGGAH VP +SPS+ALTLF++ L GSP PR
Sbjct  431  RDGKNVTNLTFATARGGAHEVPFTSPSEALTLFRSLLTGSPLPR  474



>ref|XP_006482672.1| PREDICTED: serine carboxypeptidase-like 46-like [Citrus sinensis]
Length=477

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 133/224 (59%), Gaps = 15/224 (7%)
 Frame = -1

Query  855  SEYCSDIEIMLSEEIGHDMDKENLV-------------FqscesssisssqQHYLATETA  715
            S+ C+ +   +SEE+G D+D+++L+             F+  +               T 
Sbjct  253  SQGCNQVFDRISEEVGADIDRQDLLSPFCVPISTSTEQFKPIDKHGKIHKTMARRGASTG  312

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPC+   +  Y+N+P VQKALHANTT   + W+F            +F ++I+P +S LL
Sbjct  313  DPCIYGRIFTYLNKPKVQKALHANTTHLPFHWDFCDGPLVYQ--FEDFELNIIPLVSELL  370

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               IP+L+YSGDQD +IP++ TR +A  LA  LKL  + + GPWY+ K++GGWSQ+FG  
Sbjct  371  KEGIPILLYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTIYGPWYNDKQVGGWSQSFGAF  430

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                 V NLTFATVRGGAH VP +SPS+ALTLF++ L  SP PR
Sbjct  431  RDGKNVTNLTFATVRGGAHEVPFTSPSEALTLFRSLLTRSPLPR  474



>ref|XP_010068797.1| PREDICTED: serine carboxypeptidase-like 46 [Eucalyptus grandis]
Length=481

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTS-PGKTSDVILHNFAIDILPTLSAL  538
            DPCL D++  Y+N P VQKALHAN T     WNF S P    DV   +  IDI+P LSAL
Sbjct  315  DPCLGDFIFSYLNNPQVQKALHANITKLPSVWNFCSGPLSYHDV---DIGIDIIPLLSAL  371

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            +   + VL++SGDQD ++P+  TR +A ++A  LK T+L    PWYD  ++GGW+Q+FG+
Sbjct  372  IEKHLRVLLFSGDQDSKVPLMQTRMIANMIAQDLKFTSLGKYAPWYDKMQVGGWTQSFGS  431

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            S     V +LTFATVRG AH VP +SPSQALTLFKAFL+GS PP+ 
Sbjct  432  SREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSPPKV  477



>gb|KCW64994.1| hypothetical protein EUGRSUZ_G02536 [Eucalyptus grandis]
Length=480

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPCL +++  Y+N P VQKALHANTT     W F S   +   +  +  IDI P LSAL+
Sbjct  314  DPCLWEYIFSYLNNPRVQKALHANTTKLPSVWQFCSGLLSYHDV--DIGIDITPLLSALI  371

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               + VL++SGDQD +IP++ TR +A+++A  LK T+L    PWYD  ++GGW+Q+FG+S
Sbjct  372  KKHLRVLLFSGDQDSKIPLTQTRMIASMIARYLKFTSLGKYAPWYDNMQVGGWTQSFGSS  431

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                 V +LTFATVRG AH VP +SPSQALTLFKAFL+GS PP+ 
Sbjct  432  REGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSPPKV  476



>ref|XP_010068795.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPCL +++  Y+N P VQKALHANTT     W F S   +   +  +  IDI P LSAL+
Sbjct  315  DPCLWEYIFSYLNNPRVQKALHANTTKLPSVWQFCSGLLSYHDV--DIGIDITPLLSALI  372

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               + VL++SGDQD +IP++ TR +A+++A  LK T+L    PWYD  ++GGW+Q+FG+S
Sbjct  373  KKHLRVLLFSGDQDSKIPLTQTRMIASMIARYLKFTSLGKYAPWYDNMQVGGWTQSFGSS  432

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                 V +LTFATVRG AH VP +SPSQALTLFKAFL+GS PP+ 
Sbjct  433  REGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSPPKV  477



>ref|XP_007046208.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
 gb|EOY02040.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
Length=488

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 134/228 (59%), Gaps = 14/228 (6%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY---------LATET  718
            L   LS+ C D+     EEIG   D  +L+   C SS++     +          LA  +
Sbjct  256  LHRNLSKQCIDVLNKEQEEIGSYTDPGDLILPICLSSTVLGQTVYQGALNRLHAKLAMTS  315

Query  717  A---DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
            A   DPCL D + +Y+N P VQ+ALHANTT     W F   G        +  I+I+P L
Sbjct  316  AVASDPCLGDRIYQYLNTPKVQEALHANTTHLPSDWEFC--GGHLVYQRESLEINIIPLL  373

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
            S LL   IP+L+++GDQD +IP++ TR +A +LA  LKL       PWYD  ++GGW+Q+
Sbjct  374  SKLLRRSIPILLFNGDQDSKIPLTQTRIIANMLAEELKLVPFGSYAPWYDKTQVGGWTQS  433

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            FG + +   V  LTFATVRG AH VP +SPSQALTLF+AFL+GSP PR
Sbjct  434  FGQARKGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGSPLPR  481



>ref|XP_010265020.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=474

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 134/228 (59%), Gaps = 23/228 (10%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVF------qscesssisssqQHY---LATETADPC  706
            LS+ CSD+   +++E+G ++D+ +L+          E    + +  H    L     DPC
Sbjct  256  LSKECSDVFDRINKEVGDELDRNDLLSLQCLPSTEAEQFRAAKAIMHSNIGLLRGAGDPC  315

Query  705  LRDWVGEYINRPDVQKALHANTTGWQY---PWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            L D +  Y+N+P VQKALHA  T W +   P  +          + + A +++P +S LL
Sbjct  316  LPDRILAYLNKPVVQKALHAVPTNWSFCAGPLQYQ---------MESLATNMIPIISDLL  366

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             SDIP++ YSGDQD +IP++ TR +A  +A  LKL  L   GPWYD K++GGW+Q+FG  
Sbjct  367  KSDIPIMFYSGDQDTKIPLTQTRIIANAMAKSLKLVPLTSYGPWYDNKQVGGWAQSFGKQ  426

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGS--PPPRTN  217
                 V  LTFATVRGG+H VP +SPSQ LTLF+ FL GS  P P+ +
Sbjct  427  REGKNVTYLTFATVRGGSHEVPYTSPSQTLTLFRVFLSGSLLPAPKVS  474



>ref|XP_002277201.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Vitis 
vinifera]
Length=479

 Score =   171 bits (434),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 133/227 (59%), Gaps = 15/227 (7%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQ-------------HYLAT  724
            G+LS+ C D+   + +EI  D++K +L+   C SS+ +   +                  
Sbjct  252  GQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFRLKGLQGKIYAEIDRRTRG  311

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
               DPCL D +  Y+N P VQKALHANTT   Y W+F S      V   N  +D+LP ++
Sbjct  312  TIPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGPLVYQV--DNLDMDLLPLIA  369

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             LL  +I +L+YSGDQD ++P++ TR +   LA  LKL      G WYD +++GGWSQ+F
Sbjct  370  YLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVGGWSQSF  429

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            G       +  LTFATVRG AH VP +SPSQALTLFK+FL GSPPPR
Sbjct  430  GRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPPR  476



>ref|XP_010661029.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Vitis 
vinifera]
Length=481

 Score =   171 bits (434),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 133/227 (59%), Gaps = 15/227 (7%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQ-------------HYLAT  724
            G+LS+ C D+   + +EI  D++K +L+   C SS+ +   +                  
Sbjct  254  GQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFRLKGLQGKIYAEIDRRTRG  313

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
               DPCL D +  Y+N P VQKALHANTT   Y W+F S      V   N  +D+LP ++
Sbjct  314  TIPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGPLVYQV--DNLDMDLLPLIA  371

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             LL  +I +L+YSGDQD ++P++ TR +   LA  LKL      G WYD +++GGWSQ+F
Sbjct  372  YLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVGGWSQSF  431

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            G       +  LTFATVRG AH VP +SPSQALTLFK+FL GSPPPR
Sbjct  432  GRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPPR  478



>emb|CBI22166.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 133/227 (59%), Gaps = 15/227 (7%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQ-------------HYLAT  724
            G+LS+ C D+   + +EI  D++K +L+   C SS+ +   +                  
Sbjct  323  GQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFRLKGLQGKIYAEIDRRTRG  382

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
               DPCL D +  Y+N P VQKALHANTT   Y W+F S      V   N  +D+LP ++
Sbjct  383  TIPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGPLVYQV--DNLDMDLLPLIA  440

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             LL  +I +L+YSGDQD ++P++ TR +   LA  LKL      G WYD +++GGWSQ+F
Sbjct  441  YLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVGGWSQSF  500

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            G       +  LTFATVRG AH VP +SPSQALTLFK+FL GSPPPR
Sbjct  501  GRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPPR  547



>ref|XP_009627244.1| PREDICTED: serine carboxypeptidase-like 46 [Nicotiana tomentosiformis]
Length=479

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 137/226 (61%), Gaps = 22/226 (10%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLAT-----------  724
            +   +S  C+ +  +  EE+G D+D  +L+      SS ++ Q   LAT           
Sbjct  249  IHNNVSNECTKVWELTDEEMGSDIDMGDLL-APTCVSSGTARQLGALATIHGKFVKHEVG  307

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAIDIL  556
            + A+ CL D +  Y+N+P+VQKALHANTT   Y W+F          LH    + A++ +
Sbjct  308  KVAETCLTDRINLYLNKPEVQKALHANTTYLPYAWDFCLG------YLHYRREDLAVNTI  361

Query  555  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  376
            P LS +L  +I VL +SGDQD +IP++ TR++A +LA  LKL  L+  GPWYDG +IGGW
Sbjct  362  PLLSNILKENIQVLFFSGDQDSKIPLTQTRKIAKLLARDLKLVALDKYGPWYDGLQIGGW  421

Query  375  SQTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKG  238
            SQ+FG       V  LTFATVRG AH VP +SPSQALTLF+AFL+G
Sbjct  422  SQSFGGLREGKNVTYLTFATVRGAAHEVPFTSPSQALTLFRAFLRG  467



>ref|XP_003633850.1| PREDICTED: serine carboxypeptidase-like 46 [Vitis vinifera]
 emb|CBI22165.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 133/229 (58%), Gaps = 15/229 (7%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLV------------FqscesssisssqQHYLA  727
            + G+LSE C+++   +  EIG+D+ +++L+            F+         +      
Sbjct  250  IHGQLSEGCNNVYNRVVNEIGNDVRQDDLLLPICLSSNSAQQFKLKGQRGTIHAAIARRT  309

Query  726  TETA-DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
             ET  DPCL D +  Y+N P VQKALHANTT   Y W F +     +  + N  ++++P 
Sbjct  310  RETIPDPCLSDRILTYLNNPQVQKALHANTTHLPYHWGFCA--GPLEYQIDNLDMNLIPL  367

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            +  L+   IP+L++SGDQD  IP++ TR +A  +A  LKL      G WYD K++GGW+Q
Sbjct  368  IEHLIKEGIPILLFSGDQDAIIPLTQTRIIANNVAKDLKLVPFTEYGTWYDKKQVGGWTQ  427

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            +FG       V  LTFATVRG AH VP +SPSQALT+FK+FL GSP PR
Sbjct  428  SFGGLREGKNVTLLTFATVRGAAHEVPFTSPSQALTMFKSFLSGSPLPR  476



>ref|XP_010068798.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 111/165 (67%), Gaps = 2/165 (1%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPCL D++  Y+N P VQKALHANTT     W F S   +   +  +  IDI P LSAL+
Sbjct  315  DPCLGDYIFSYLNNPQVQKALHANTTKLPSVWQFCSGLLSYHDV--DIGIDITPLLSALI  372

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               + VL++SGDQD +IP++ TR +A ++A  LK T+L    PWY+ K++GGW+++FG S
Sbjct  373  KKHLRVLLFSGDQDSKIPLTQTRIIANMIARELKFTSLGKYAPWYNKKQVGGWTESFGRS  432

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             +     +LTFATVRG AH VP +SP QALTLFKAFLKGS  P+ 
Sbjct  433  RKGKNATHLTFATVRGAAHEVPYTSPEQALTLFKAFLKGSSLPKV  477



>gb|KCW64996.1| hypothetical protein EUGRSUZ_G02538 [Eucalyptus grandis]
Length=480

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 111/165 (67%), Gaps = 2/165 (1%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPCL D++  Y+N P VQKALHANTT     W F S   +   +  +  IDI P LSAL+
Sbjct  314  DPCLGDYIFSYLNNPQVQKALHANTTKLPSVWQFCSGLLSYHDV--DIGIDITPLLSALI  371

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               + VL++SGDQD +IP++ TR +A ++A  LK T+L    PWY+ K++GGW+++FG S
Sbjct  372  KKHLRVLLFSGDQDSKIPLTQTRIIANMIARELKFTSLGKYAPWYNKKQVGGWTESFGRS  431

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             +     +LTFATVRG AH VP +SP QALTLFKAFLKGS  P+ 
Sbjct  432  RKGKNATHLTFATVRGAAHEVPYTSPEQALTLFKAFLKGSSLPKV  476



>ref|XP_010256545.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=471

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/220 (43%), Positives = 130/220 (59%), Gaps = 18/220 (8%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLV----FqscesssisssqQHYLA--TETADPCLRD  697
            LS+ C D+   ++ EIG D+D+ +L+      S  +    +   + +A  T  ADPCL D
Sbjct  256  LSKECIDVFDRINGEIGDDLDRNDLLSFKCLPSSRAEQFRARATNPMAKGTSAADPCLSD  315

Query  696  WVGEYINRPDVQKALHANTTGWQY---PWNFTSPGKTSDVILHNFAIDILPTLSALLMSD  526
             V  Y+NRP VQKALHA    W +   P  +          + N  I+I+P +S LL S+
Sbjct  316  RVLAYLNRPKVQKALHAIPVNWSFCSGPLQYQ---------MDNVDINIIPVVSDLLKSN  366

Query  525  IPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRC  346
            I +++Y+GDQD ++ +S TR +A  +A  LKL  L   GPWYD K++GGW+Q+FG     
Sbjct  367  ISIMLYNGDQDAKVSLSQTRIIANTIAKSLKLVPLTSYGPWYDNKQVGGWAQSFGKLRYG  426

Query  345  NKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
              V  LTFATVRGG+H  P +SPSQALTLF+AFL  S  P
Sbjct  427  KNVTYLTFATVRGGSHGAPYTSPSQALTLFRAFLSASSLP  466



>ref|XP_006838780.1| PREDICTED: serine carboxypeptidase-like 45 [Amborella trichopoda]
 gb|ERN01349.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
Length=478

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 131/226 (58%), Gaps = 20/226 (9%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVF--------qscesssisssqQHYLAT----E  721
            GE SE C     M++EE+G ++D+ +++              S   + + H   +     
Sbjct  258  GEYSEPCIYTFKMVAEEMGVNVDEGDILLPKCLTSVPSMQAVSRGLNGKIHAKISLSRMG  317

Query  720  TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTS-PGKTSDVILHNFAIDILPTLS  544
            + D C  + + +Y+NR DVQ+A HAN TG  Y W+  S P    D    N  IDI P + 
Sbjct  318  SGDLCSWERIFKYLNRADVQRAFHANATGLPYNWDSCSGPLVYQD---DNSEIDIRPLIL  374

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +LL  DIP+ +YSGDQD +IP++ TR +A  LA RLKL+ +    PWYD K++GGW Q F
Sbjct  375  SLLKEDIPIFLYSGDQDSKIPLTQTRIIANQLAKRLKLSPITKYAPWYDKKQVGGWVQAF  434

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            G   R      LTFATVRG AH VP +SPSQALTLF+AF+ GSP P
Sbjct  435  GRGNRT----LLTFATVRGAAHEVPFTSPSQALTLFRAFITGSPLP  476



>ref|XP_007046207.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY02039.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=478

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 114/171 (67%), Gaps = 8/171 (5%)
 Frame = -1

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH--NFAIDILPTLS  544
             DPC+ D + +Y+N+P+VQ+ALHANTT   Y W F +    +D++    N   +I+P L 
Sbjct  308  GDPCIEDRIHKYLNKPEVQEALHANTTHLPYRWEFCT---GTDLVYERKNLETNIIPLLL  364

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNG---PWYDGKEIGGWS  373
             LL S IP+L+Y+GDQD +IP++ TR +A +LA  + L      G   PW+D  ++GGW+
Sbjct  365  NLLRSGIPILLYNGDQDAKIPLTQTRIIANMLAKEMNLVPFGNFGNYAPWFDNMQVGGWT  424

Query  372  QTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            Q+FG +     +  LT+ATVRGGAH VP +SPS  LTLF+AF+KGSP PRT
Sbjct  425  QSFGQAKEGKNITFLTYATVRGGAHEVPYTSPSPGLTLFRAFVKGSPLPRT  475



>gb|KHG07552.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=476

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 124/223 (56%), Gaps = 14/223 (6%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLV----FqscesssisssqQH-----YLATETA---  715
            LS+ C  +   L EE+G   D  +L+    F             H      LA  +A   
Sbjct  252  LSKECIHVLNKLEEEMGSYTDPGDLILPICFSPTLLGQTFFQGTHNRLHWKLAMSSAVAT  311

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPC  D + +Y+N P VQ+ALHANTT     W F   G        +  I+I+P LS LL
Sbjct  312  DPCRVDEIRQYLNTPKVQEALHANTTHLSSVWEFC--GGHLSYQRESIGINIIPLLSKLL  369

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               IPVL+++GDQD +IP++ TR +A +LA  LKL       PWYD K++GGW+Q+FG  
Sbjct  370  KRSIPVLLFNGDQDSKIPLTQTRIIANMLAKELKLVPFGSYAPWYDKKQVGGWTQSFGKV  429

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             R   +  LTFATVRG AH VP +SP QALTLF+AFL+ S  P
Sbjct  430  RRGQNLTFLTFATVRGAAHEVPYTSPFQALTLFQAFLRRSLLP  472



>gb|KDO72509.1| hypothetical protein CISIN_1g037032mg [Citrus sinensis]
Length=473

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 110/171 (64%), Gaps = 3/171 (2%)
 Frame = -1

Query  720  TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSA  541
            + DPC+ D +  Y+N P VQ+ALHANTT   +PW F   G   D    +F ++I+P ++ 
Sbjct  306  SGDPCIGDRIFTYLNSPQVQEALHANTTHLPFPWEFC--GGPLDYQYKDFELNIIPQIAD  363

Query  540  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  361
            L+M  +P+L++SGDQD +IP++ TR +A  LA  LKL        WYD +++GGWSQ+FG
Sbjct  364  LIMEGVPILLFSGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFG  423

Query  360  NSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTNPNH  208
                   +  LT+ATVRG AH VP ++PS ALTLF++FL GSP P   P H
Sbjct  424  AFRDGKNITYLTYATVRGAAHEVPYTTPSPALTLFQSFLTGSPLPN-RPKH  473



>ref|XP_006431096.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
 gb|ESR44336.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
Length=473

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 110/171 (64%), Gaps = 3/171 (2%)
 Frame = -1

Query  720  TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSA  541
            + DPC+ D +  Y+N P VQ+ALHANTT   +PW F   G   D    +F ++I+P ++ 
Sbjct  306  SGDPCIGDRIFTYLNSPQVQEALHANTTHLPFPWEFC--GGPLDYQYKDFELNIIPQIAD  363

Query  540  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  361
            L+M  +P+L++SGDQD +IP++ TR +A  LA  LKL        WYD +++GGWSQ+FG
Sbjct  364  LIMEGVPILLFSGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFG  423

Query  360  NSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTNPNH  208
                   +  LT+ATVRG AH VP ++PS ALTLF++FL GSP P   P H
Sbjct  424  AFRDGKNITYLTYATVRGAAHEVPYTTPSPALTLFQSFLTGSPLPN-RPKH  473



>gb|KJB11409.1| hypothetical protein B456_001G257100 [Gossypium raimondii]
Length=420

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 111/169 (66%), Gaps = 5/169 (3%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFT-SPGKTSDVILHNFAIDILPTL  547
            +  DPCL   +  Y+N+P+VQKALHANTT   + W+F   P    +    N  ++++P +
Sbjct  252  KKGDPCLTGRIFTYLNKPEVQKALHANTTHLPFHWDFCLGPLVYQE---ENIDMNLIPLV  308

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
            S+L+   IPVL+YSGDQD +IP++ TR +A  +A  L L+     G WYD K++GGW+Q+
Sbjct  309  SSLIKKGIPVLLYSGDQDAKIPLTQTRIIANNIAKELNLSPFSNYGTWYDQKQVGGWTQS  368

Query  366  FGNSGRCNK-VGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            FG +    K V  LTFATVRG AH VP +SPSQALTLF +F+ G P PR
Sbjct  369  FGGADANGKNVTYLTFATVRGAAHEVPFTSPSQALTLFHSFVNGIPLPR  417



>ref|XP_007099702.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY20317.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=475

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 125/227 (55%), Gaps = 14/227 (6%)
 Frame = -1

Query  855  SEYCSDIEIMLSEEIGHDMDKENLV--------FqscesssisssqQHYLATETA---DP  709
            SE C+D+   + +E+G D+  ++L+        +           + H    + A   DP
Sbjct  251  SEGCNDVFNRVEDEVGVDVGLDDLLLPTCLSSSYAEQLKLKGKLGKIHSAVAKRAKKGDP  310

Query  708  CLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMS  529
            CL   +  Y+NR +VQKALH +TT     W F            N  ++++P +S L+  
Sbjct  311  CLEGRILTYLNRREVQKALHVSTTHHPSHWAFCEGPLVYQE--DNLDMNLIPLVSDLIKE  368

Query  528  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG-NSG  352
             IPVL+Y+GDQD +IP++ TR +A  +A  LKL  L   G WYD K++GGW+++FG    
Sbjct  369  AIPVLLYNGDQDAKIPLTQTRIIANNIAKDLKLVPLTEYGTWYDNKQVGGWTKSFGATED  428

Query  351  RCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTNPN  211
            R N    LTFATVRG AH VP +S SQALTLF +F+ G P PR   N
Sbjct  429  RKNYATYLTFATVRGAAHEVPFTSHSQALTLFHSFVNGIPLPRAPQN  475



>ref|XP_006482671.1| PREDICTED: serine carboxypeptidase-like 44-like [Citrus sinensis]
Length=552

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -1

Query  720  TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSA  541
            + DPC+ D +  Y+N P VQ+ALHANTT   +PW F   G   D    +F ++I+P ++ 
Sbjct  306  SGDPCIGDRIFTYLNSPQVQEALHANTTHLPFPWEFC--GGPLDYQYKDFELNIIPQIAD  363

Query  540  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  361
            L+M  +P+L++SGDQD +IP++ TR +A  LA  LKL        WYD +++GGWSQ+FG
Sbjct  364  LIMEGVPILLFSGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFG  423

Query  360  NSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKA  250
                   +  LT+ATVRG AH VP ++PS ALT    
Sbjct  424  AFRDGKNITYLTYATVRGAAHEVPYTTPSPALTFLSG  460



>emb|CBI32800.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 118/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVG  688
            SG LS  C  +    S+E+G  +D+    F    +S + S       TE  D C+ D V 
Sbjct  147  SGSLSPACLAVRSQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVN  202

Query  687  EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  508
            +Y NR DVQK+LHA   G    W+  S     ++   +  I ++P + +L+ S I   +Y
Sbjct  203  KYFNREDVQKSLHARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVY  259

Query  507  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNL  328
            SGDQD  IP+  TR +   LA  L+L T      W++G+++GGW+Q +G+         L
Sbjct  260  SGDQDSVIPLFGTRTLVDGLAKELRLNTTVPYRNWFEGEQVGGWTQVYGDI--------L  311

Query  327  TFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +FATVRGG+H VP + P++AL LF AFLKG PPP
Sbjct  312  SFATVRGGSHTVPGTQPARALVLFTAFLKGQPPP  345



>ref|XP_002282978.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=451

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 119/214 (56%), Gaps = 15/214 (7%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVG  688
            SG LS  C  +    S+E+G  +D+    F    +S + S       TE  D C+ D V 
Sbjct  251  SGSLSPACLAVRSQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVN  306

Query  687  EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  508
            +Y NR DVQK+LHA   G    W+  S     ++   +  I ++P + +L+ S I   +Y
Sbjct  307  KYFNREDVQKSLHARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVY  363

Query  507  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNL  328
            SGDQD  IP+  TR +   LA +L+L T      W++G+++GGW+Q +G+         L
Sbjct  364  SGDQDSVIPLFGTRTLVDGLAKKLRLNTTVPYRNWFEGEQVGGWTQVYGDI--------L  415

Query  327  TFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +FATVRGG+H VP + P++AL LF AFLKG PPP
Sbjct  416  SFATVRGGSHTVPGTQPARALVLFTAFLKGQPPP  449



>gb|ABK26025.1| unknown [Picea sitchensis]
Length=384

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 106/165 (64%), Gaps = 5/165 (3%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPC+   + +Y+N+ +V+K+LHANT+ +   W   S     D    N  I+++P LS LL
Sbjct  225  DPCIDFKINQYLNKQEVKKSLHANTSLY---WEACSGKLHYDQ--KNRGINVIPVLSDLL  279

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             + + + +YSGDQD ++P + TR +A  LA  L L T+   GPWYD K++ GW+Q++G++
Sbjct  280  KAGLRITLYSGDQDSKVPFTATRTIANNLAKELNLYTVIPYGPWYDNKQVAGWTQSYGHT  339

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             +      LT+ATVRGG H VP ++PS+AL L++AF++  P P +
Sbjct  340  VKGKNESILTYATVRGGGHEVPYTNPSEALNLYRAFIRALPLPSS  384



>emb|CBI32795.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 119/214 (56%), Gaps = 15/214 (7%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVG  688
            SG LS  C  +    S+E+G  +D+    F    +S + S       TE  D C+ D V 
Sbjct  249  SGSLSPACLAVRSQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVN  304

Query  687  EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  508
            +Y+NR DVQK+LHA   G    W+  S     ++   +  I ++P + +L+ S I   +Y
Sbjct  305  KYLNREDVQKSLHARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVY  361

Query  507  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNL  328
            SGDQD  IP+  TR +   LA  L+L T      W++G+++GGW+Q +G+         L
Sbjct  362  SGDQDSVIPLFGTRTLVDGLAKELRLNTTVPYRNWFEGEQVGGWTQVYGDI--------L  413

Query  327  TFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +FATVRGG+H VP + P++AL LF AFLKG PPP
Sbjct  414  SFATVRGGSHTVPGTQPARALVLFTAFLKGQPPP  447



>ref|XP_002277400.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=455

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 119/214 (56%), Gaps = 15/214 (7%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVG  688
            SG LS  C  +    S+E+G  +D+    F    +S + S       TE  D C+ D V 
Sbjct  255  SGSLSPACLAVRSQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVN  310

Query  687  EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  508
            +Y+NR DVQK+LHA   G    W+  S     ++   +  I ++P + +L+ S I   +Y
Sbjct  311  KYLNREDVQKSLHARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVY  367

Query  507  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNL  328
            SGDQD  IP+  TR +   LA  L+L T      W++G+++GGW+Q +G+         L
Sbjct  368  SGDQDSVIPLFGTRTLVDGLAKELRLNTTVPYRNWFEGEQVGGWTQVYGDI--------L  419

Query  327  TFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +FATVRGG+H VP + P++AL LF AFLKG PPP
Sbjct  420  SFATVRGGSHTVPGTQPARALVLFTAFLKGQPPP  453



>emb|CAN72076.1| hypothetical protein VITISV_041583 [Vitis vinifera]
Length=451

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 118/214 (55%), Gaps = 15/214 (7%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVG  688
            SG LS  C  +    S+E+G  +D+    F    +S + S       TE  D C+ D V 
Sbjct  251  SGSLSPACLAVRSQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVN  306

Query  687  EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  508
            +Y NR DVQK+LHA   G    W+  S     ++   +  I ++P + +L+ S I   +Y
Sbjct  307  KYXNREDVQKSLHARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVY  363

Query  507  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNL  328
            SGDQD  IP+  TR +   LA  L+L T      W++G+++GGW+Q +G+         L
Sbjct  364  SGDQDSVIPLFGTRTLVDGLAKXLRLNTTVPYRNWFEGEQVGGWTQVYGDI--------L  415

Query  327  TFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +FATVRGG+H VP + P++AL LF AFLKG PPP
Sbjct  416  SFATVRGGSHTVPGTQPARALVLFTAFLKGQPPP  449



>emb|CBI32802.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 119/214 (56%), Gaps = 15/214 (7%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVG  688
            SG LS  C  +    S+E+G  +D+    F    +S + S       TE  D C+ D V 
Sbjct  584  SGSLSPACLAVRSQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVN  639

Query  687  EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  508
            +Y NR DVQK+LHA   G    W+  S     ++   +  I ++P + +L+ S I   +Y
Sbjct  640  KYFNREDVQKSLHARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVY  696

Query  507  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNL  328
            SGDQD  IP+  TR +   LA +L+L T      W++G+++GGW+Q +G+         L
Sbjct  697  SGDQDSVIPLFGTRTLVDGLAKKLRLNTTVPYRNWFEGEQVGGWTQVYGDI--------L  748

Query  327  TFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +FATVRGG+H VP + P++AL LF AFLKG PPP
Sbjct  749  SFATVRGGSHTVPGTQPARALVLFTAFLKGQPPP  782



>gb|ABR16719.1| unknown [Picea sitchensis]
Length=460

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 119/223 (53%), Gaps = 21/223 (9%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYL-----ATETADPC  706
              G +S  C  I + +S EI   +DK ++  +SC SS +    +  +     AT   D C
Sbjct  247  FRGGVSSTCEHIYLTVSMEISKFIDKYDVTLESCLSSLLMQKSKMMIGVTRTATVKPDVC  306

Query  705  LRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH---NFAIDILPTLSALL  535
            ++D    Y+N  DVQKA HA   G    W        SDV+ +   N+ I  +P L  L+
Sbjct  307  VQDEATSYLNMADVQKAFHARLVGNVKTWE-----ACSDVLEYDDLNWEIPTIPLLGKLV  361

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             + I VLIYSGDQD  IP++ TR +   LA  L+L T      W+ GK++ GW Q +GN+
Sbjct  362  KAGIRVLIYSGDQDSIIPLTGTRTLVNNLAASLQLNTTVPYRVWFQGKQVAGWVQVYGNT  421

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                    L+FATVRG  H VP S P ++L LFKAFL+G PPP
Sbjct  422  --------LSFATVRGAGHEVPFSQPERSLVLFKAFLQGQPPP  456



>ref|XP_006584695.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=468

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 119/215 (55%), Gaps = 13/215 (6%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQ----HYLATETADPCLRDWV  691
            +S  CS +   +S E    +DK ++    C SS +S S+          E+ D C+ D V
Sbjct  260  ISPLCSKVMKQVSRETSKFVDKYDVTLDVCISSVLSQSKAICPQSQQTNESIDVCVDDKV  319

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G Q  WN  S     D  + N  +  LP + +L+ + + VLI
Sbjct  320  TNYLNRKDVQEALHAKLVGVQ-KWNVCSTNSILDYDMLNLEVPTLPIVGSLIKAGVRVLI  378

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L+L T      W++G+++GGW+Q +GN         
Sbjct  379  YSGDQDSVIPLTGSRTLVQKLARQLRLNTTIHYRVWFEGQQVGGWTQVYGNI--------  430

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H  P S P ++L LFK+FL+  P P
Sbjct  431  LSFATVRGASHEAPFSQPERSLVLFKSFLEDRPLP  465



>gb|AFK47648.1| unknown [Medicago truncatula]
Length=157

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 97/165 (59%), Gaps = 11/165 (7%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     DV+  N  +  LP +  L+
Sbjct  3    DVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWDVCSNVLDYDVL--NLEVPTLPVVGPLI  59

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             + + VLIYSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN 
Sbjct  60   KAGVKVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGNV  119

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                    L+FATVRG AH  P S P ++L LFK+FL+G P P  
Sbjct  120  --------LSFATVRGAAHEAPFSQPERSLVLFKSFLEGRPLPEV  156



>ref|XP_008222370.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Prunus 
mume]
Length=465

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 115/218 (53%), Gaps = 14/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +   +S E    +DK ++   V  S   S           TE  D C+ D 
Sbjct  258  GSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQQVTEAIDVCVEDE  317

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
            +  Y+NRPDVQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL
Sbjct  318  IVNYLNRPDVQKALHARLVGVR-QWAVCS--NILDYQLLDVEIPTITIVGKLIKAGIPVL  374

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN        
Sbjct  375  VYSGDQDSVIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNM-------  427

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  428  -LSFATIRGASHEAPFSQPERSLVLFKSFLEGQPLPEV  464



>ref|XP_009143848.1| PREDICTED: serine carboxypeptidase-like 46 [Brassica rapa]
 emb|CDY17183.1| BnaA05g10050D [Brassica napus]
Length=462

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 115/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            GE+S  CS +   +S E    +DK ++    C     S S         ET D C+ D  
Sbjct  256  GEVSSMCSKVMSQVSTETSRFVDKYDVTLDLCIPSVLSQSKVVSPQQVGETVDVCVEDET  315

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G +  W   S     D  L +  +  +  + +L+ + +PVL+
Sbjct  316  VNYLNRRDVQKALHARLVGTR-KWAVCS--NVLDYELLDVEVPTINVVGSLIKAGVPVLV  372

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L+T      W+ G+++GGW+Q +GN         
Sbjct  373  YSGDQDSVIPLTGSRTLVKRLAQQLGLSTTVPYRVWFAGQQVGGWTQVYGNV--------  424

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L FATVRG AH VP S P ++L LFKAFL G+P P
Sbjct  425  LAFATVRGAAHEVPFSQPERSLVLFKAFLGGNPLP  459



>gb|KEH35690.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=448

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 120/217 (55%), Gaps = 15/217 (7%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVF----qscesssisssqQHYLATETADPCLRDWV  691
            +S  CS +  ++S+E    +DK ++       S  S S   S Q   A E  D C+ D V
Sbjct  242  VSPLCSKVMGLVSKETSRFVDKYDVTLDVCISSVLSQSKVISPQPQQANEMIDVCVDDKV  301

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G +  W+  S     DV+  N  +  LP + +L+ + + VLI
Sbjct  302  TNYLNRRDVQEALHAKLVGVR-KWDVCSNVLDYDVL--NLEVPTLPVVGSLIKAGVKVLI  358

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN         
Sbjct  359  YSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGNV--------  410

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FATVRG AH  P S P ++L LFK+FL+G P P  
Sbjct  411  LSFATVRGAAHEAPFSQPERSLVLFKSFLEGRPLPEV  447



>ref|XP_004501743.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=470

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 100/170 (59%), Gaps = 11/170 (6%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            A E  D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     DV+  N  +  LP 
Sbjct  311  ANERIDVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWDVCSNILDYDVL--NLEVPTLPI  367

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ S + VLIYSGDQD  IP++ +R +   LA +L L T      W++ +++GGW+Q
Sbjct  368  VGSLIKSGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVSYRVWFESQQVGGWTQ  427

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             +GN         L+FATVRG AH VP S P ++L LFK+FL+G P P  
Sbjct  428  VYGNM--------LSFATVRGAAHEVPFSQPERSLVLFKSFLEGRPLPEV  469



>gb|KFK44681.1| hypothetical protein AALP_AA1G289600 [Arabis alpina]
Length=225

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 111/215 (52%), Gaps = 12/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  18   GSMSSMCSKVMSQVSTETTRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  77

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHA   G    W   S     D  L +     +  + +L+ + +PVL+
Sbjct  78   VSYLNRRDVQAALHARLIGGVREWTVCS--NVLDYELLDVEKPTINIVGSLVKAGVPVLV  135

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN         
Sbjct  136  YSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  187

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  188  LSFATVRGASHEVPFSQPERSLVLFKAFLDGHPLP  222



>gb|ABK25202.1| unknown [Picea sitchensis]
Length=462

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 111/220 (50%), Gaps = 17/220 (8%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKEN----LVFqscesssisssqQHYLATETA---DPC  706
            G +S  C D+   +S E+   +D+ +    +   S  +          + T  A   D C
Sbjct  249  GTVSSTCEDVYSTVSMELSQYIDRYDVTLDICLSSVGTQKSKMLGVKTIGTRLAVQPDVC  308

Query  705  LRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSD  526
            + +    Y+N  DVQKA HA   G    W+  S   T D   HN  I  +P L  L M+ 
Sbjct  309  VENEATAYLNMVDVQKAFHARLVGNVKRWDSCSDVLTYD--HHNLEIPTVPLLGKLAMTG  366

Query  525  IPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRC  346
            I VLIYSGDQD  IP++ TR +   LA  LKL +      W+ GK++ GW Q +GN    
Sbjct  367  IRVLIYSGDQDSVIPLTGTRTLVNNLAASLKLNSTVPYSVWFQGKQVAGWVQVYGNI---  423

Query  345  NKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                 L+FATVRG +H VP S P ++L LFKAFL+G  PP
Sbjct  424  -----LSFATVRGASHEVPFSQPERSLVLFKAFLQGQTPP  458



>ref|XP_008222371.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Prunus 
mume]
Length=464

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 118/217 (54%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY--LATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C SS  S S+       TE  D C+ D +
Sbjct  258  GSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQVTEAIDVCVEDEI  317

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NRPDVQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+
Sbjct  318  VNYLNRPDVQKALHARLVGVR-QWAVCS--NILDYQLLDVEIPTITIVGKLIKAGIPVLV  374

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN         
Sbjct  375  YSGDQDSVIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNM--------  426

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  427  LSFATIRGASHEAPFSQPERSLVLFKSFLEGQPLPEV  463



>ref|XP_008777393.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Phoenix 
dactylifera]
Length=463

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 113/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C+ +   +++E    +DK ++          S S        TE  D C+ D  
Sbjct  257  GSLSAVCARVMGQVTQETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHA   G    W+  S     +  L N  I  +  + +L+ S IPVL+
Sbjct  317  VNYLNRKDVQDALHARLAGVP-KWSVCS--SVLEYELLNLEIPTISVVGSLVRSGIPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  LKL T      W+ GK++GGW+Q +G+         
Sbjct  374  YSGDQDSVIPLTGSRTLVQRLAKELKLKTTVPYRVWFAGKQVGGWTQVYGDI--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            LTFAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  426  LTFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  462



>tpg|DAA42024.1| TPA: hypothetical protein ZEAMMB73_711830 [Zea mays]
Length=276

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 114/218 (52%), Gaps = 13/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G LS  C+ +   ++ E    +DK ++   VF S   S   +   H    +  D C+ D 
Sbjct  67   GALSPLCARVMNRVTRETSRFVDKYDVTLDVFLSSVLSQSKTLSPHEQVGQRVDVCVEDE  126

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G    W   S     +++  N  I  +  + +L+ S I VL
Sbjct  127  TVRYLNRRDVQAALHARLVGVD-KWAVCSSVLQYELL--NLQIPTINVVGSLVRSGIRVL  183

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  + L T      W++G+++GGW+Q +G        G
Sbjct  184  VYSGDQDSVIPLTGSRTLVQSLARGMGLKTTTPYRVWFEGQQVGGWTQVYGG-------G  236

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FATVRG +H  P S P ++L LF+AFL+G P P T
Sbjct  237  ALSFATVRGASHEAPFSQPGRSLVLFRAFLQGQPLPET  274



>ref|XP_003532390.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
 gb|KHN16877.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=466

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 120/215 (56%), Gaps = 15/215 (7%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQ----HYLATETADPCLRDWV  691
            +S  CS +   +S E    +DK ++    C SS +S S+          E+ D C+ D V
Sbjct  260  ISPLCSKVMKQVSRETSKFVDKYDVTLDVCISSVLSQSKAICPQSQQTNESIDVCVDDKV  319

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G Q  WN  S     D++  N  +  LP + +L+ + + VLI
Sbjct  320  TNYLNRKDVQEALHAKLVGVQ-KWNVCSTILDYDML--NLEVPTLPIVGSLIKAGVRVLI  376

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L+L T      W++G+++GGW+Q +GN         
Sbjct  377  YSGDQDSVIPLTGSRTLVQKLARQLRLNTTIHYRVWFEGQQVGGWTQVYGNI--------  428

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H  P S P ++L LFK+FL+  P P
Sbjct  429  LSFATVRGASHEAPFSQPERSLVLFKSFLEDRPLP  463



>ref|XP_007223033.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24232.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=465

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 114/218 (52%), Gaps = 14/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +   +S E    +DK ++   V  S   S           TE  D C+ D 
Sbjct  258  GSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQQVTEAIDVCVEDE  317

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
            +  Y+NRPDVQKALHA   G +  W   S     D  L +  I     +  L+ + IPVL
Sbjct  318  IVNYLNRPDVQKALHARLVGVR-QWAVCS--NILDYQLLDVEIPTTTIVGKLIKAGIPVL  374

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN        
Sbjct  375  VYSGDQDSVIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNI-------  427

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  428  -LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLPEV  464



>gb|KJB40056.1| hypothetical protein B456_007G044700 [Gossypium raimondii]
Length=462

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 99/170 (58%), Gaps = 11/170 (6%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
             +E  D C+ D +  Y+NR DVQKALHA   G +  W   S     D  L N  +  +  
Sbjct  303  VSERVDVCVEDKIVNYLNRKDVQKALHARLVGVRL-WTVCS--NILDYQLLNLEMPTISI  359

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ S IPVL+YSGDQD  IP++ +R + + LA  L+L T      W++GK++GGW+Q
Sbjct  360  VGSLIKSGIPVLVYSGDQDSVIPLTGSRSLVSRLAKELELETTVPYRVWFEGKQVGGWTQ  419

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             +GN         L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  420  VYGNI--------LSFATIRGASHEAPFSQPERSLMLFKSFLEGKPLPEV  461



>emb|CDY19500.1| BnaC04g10990D [Brassica napus]
Length=463

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 115/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G++S  CS +   +S E    +DK ++    C     S S         ET D C+ D  
Sbjct  257  GDVSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPQQVGETVDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G +  W   S     D  L +  +  +  + +L+ + +PVL+
Sbjct  317  VNYLNRRDVQKALHARLVGTR-KWAVCS--NVLDYELLDVEVPTINIVGSLIKAGVPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L+T      W+ G+++GGW+Q +GN         
Sbjct  374  YSGDQDSVIPLTGSRTLVKQLAQQLGLSTTVPYRVWFAGQQVGGWTQVYGNV--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L FATVRG AH VP S P ++L LFKAFL G+P P
Sbjct  426  LAFATVRGAAHEVPFSQPERSLVLFKAFLGGNPLP  460



>ref|XP_009378815.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 119/217 (55%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY--LATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C SS  S S+        ++ D C+ D V
Sbjct  256  GSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKALLPQQVADSIDVCVEDEV  315

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NRPDVQKALHA   G +  W   S     D  + +  I  +  +  L+ + IPVL+
Sbjct  316  VNYLNRPDVQKALHARLVGVR-QWAVCS--NILDYQVLDVEIPTITIVGKLIKAGIPVLV  372

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L+L T      W++G+++GGW+Q +GN         
Sbjct  373  YSGDQDSVIPLTGSRTLVHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNI--------  424

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FATVRG +H  P S P ++L LFK+FLKG P P  
Sbjct  425  LSFATVRGASHEAPFSQPERSLVLFKSFLKGRPLPEV  461



>ref|XP_008777392.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 113/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C+ +   +++E    +DK ++          S S        TE  D C+ D  
Sbjct  268  GSLSAVCARVMGQVTQETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDET  327

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHA   G    W+  S     +  L N  I  +  + +L+ S IPVL+
Sbjct  328  VNYLNRKDVQDALHARLAGVP-KWSVCS--SVLEYELLNLEIPTISVVGSLVRSGIPVLV  384

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  LKL T      W+ GK++GGW+Q +G+         
Sbjct  385  YSGDQDSVIPLTGSRTLVQRLAKELKLKTTVPYRVWFAGKQVGGWTQVYGDI--------  436

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            LTFAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  437  LTFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  473



>gb|AIC80774.1| serine carboxypeptidase [Cicer arietinum]
Length=430

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 116/216 (54%), Gaps = 13/216 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQH--YLATETADPCLRDW  694
            +G +S  CS +   +S E    +DK ++    C SS  S ++       TET D C+ D 
Sbjct  223  NGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTKILNPKQVTETIDVCVEDE  282

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G Q    +T      D  LH+  I  +  +  L+ + IPVL
Sbjct  283  TVNYLNRKDVQSALHARLVGVQ---RWTPCSNVLDYDLHDLEIPTITVVGKLVKAGIPVL  339

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L++ T      W+  +++GGW+Q +GN        
Sbjct  340  VYSGDQDSVIPLTGSRTLVHQLAKELRMNTTVPYRVWFQKQQVGGWTQVYGNI-------  392

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FATVRG +H  P S P ++L LFK+FL+G P P
Sbjct  393  -LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  427



>ref|XP_008392759.1| PREDICTED: serine carboxypeptidase-like 45, partial [Malus domestica]
Length=322

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 112/213 (53%), Gaps = 13/213 (6%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWVGE  685
            LS  CS +   +S+E    +DK ++          S S        TE  D C+ D    
Sbjct  118  LSPVCSRVMSQVSKETSKFVDKYDVTLDVCISSVLSQSKVISPNQMTERIDVCVEDKTVN  177

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQKALHA   G +  W+  S     D  + N  I  +  + +L+   IPVL+YS
Sbjct  178  YLNRKDVQKALHARLVGVR-RWDVCS--NILDYQVLNLEIPTIXLVRSLVKQGIPVLVYS  234

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA+ L L T      W++GK++GGW+Q +GN         L+
Sbjct  235  GDQDSVIPLTGSRRLVYRLAMELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LS  286

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            FAT+RG +H  P S P ++L LFK+FL G P P
Sbjct  287  FATIRGASHEAPFSQPERSLRLFKSFLAGRPLP  319



>ref|XP_010942380.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 113/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C+ +   +++E    +DK ++          S S        TE  D C+ D  
Sbjct  257  GSLSSVCARVMGQVTKETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHA  TG    W   S     +  L N  +  +  + +L+ S IP+L+
Sbjct  317  VNYLNRKDVQDALHARLTGVP-KWTVCS--SVLEYELLNLEVPTISVVGSLVRSGIPILV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  LKL T      W+ GK++GGW+Q +G+         
Sbjct  374  YSGDQDSVIPLTGSRTLVQRLAKELKLNTTVPYRVWFVGKQVGGWTQVYGDI--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            LTFAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  426  LTFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_010271867.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Nelumbo 
nucifera]
Length=504

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 115/216 (53%), Gaps = 12/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  C  +  +++ EI   +D+ ++   V  S   S   +        E+ D C+ D 
Sbjct  295  GSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQQKVVESTDVCVEDE  354

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQK+LHA+  G    W   +  +     + N  +  +P LS+L  S I +L
Sbjct  355  TYNYLNRDDVQKSLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKIL  413

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ TR +   LA  L L T      W++GK++GGW+Q +G+        
Sbjct  414  VYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI-------  466

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             LTFAT+RGG+H  P S P ++L LF +FLKG P P
Sbjct  467  -LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  501



>ref|XP_010271865.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=520

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 115/216 (53%), Gaps = 12/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  C  +  +++ EI   +D+ ++   V  S   S   +        E+ D C+ D 
Sbjct  311  GSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQQKVVESTDVCVEDE  370

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQK+LHA+  G    W   +  +     + N  +  +P LS+L  S I +L
Sbjct  371  TYNYLNRDDVQKSLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKIL  429

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ TR +   LA  L L T      W++GK++GGW+Q +G+        
Sbjct  430  VYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI-------  482

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             LTFAT+RGG+H  P S P ++L LF +FLKG P P
Sbjct  483  -LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  517



>gb|KGN63441.1| hypothetical protein Csa_1G000650 [Cucumis sativus]
Length=344

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 94/168 (56%), Gaps = 11/168 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            E  D C+ D   +YINR DV+KALHA   G       T   +  D  L N  I  +  + 
Sbjct  187  ERTDVCIEDETVKYINREDVRKALHARLVGVH---KLTVCSEVLDYELLNLEIPTISIVG  243

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ +DI +LIYSGDQD  IP+  +R +   LA +L L T    G W+ GK++ GWSQ +
Sbjct  244  SLVEADIRILIYSGDQDSVIPLMGSRLLVHRLATKLGLNTSVPYGAWFQGKQVAGWSQVY  303

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            GN         L+FAT+RG +H  P S P ++L LFK+FL   PPP+ 
Sbjct  304  GNV--------LSFATIRGDSHEAPFSQPQRSLVLFKSFLDNRPPPQV  343



>ref|XP_004492026.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 116/216 (54%), Gaps = 13/216 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQH--YLATETADPCLRDW  694
            +G +S  CS +   +S E    +DK ++    C SS  S ++       TET D C+ D 
Sbjct  255  NGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTKILNPKQVTETIDVCVEDE  314

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G Q    +T      D  LH+  I  +  +  L+ + IPVL
Sbjct  315  TVNYLNRKDVQSALHARLVGVQ---RWTPCSNVLDYDLHDLEIPTITVVGKLVKAGIPVL  371

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L++ T      W+  +++GGW+Q +GN        
Sbjct  372  VYSGDQDSVIPLTGSRTLVHQLAKELRMNTTVPYRVWFQKQQVGGWTQVYGNI-------  424

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FATVRG +H  P S P ++L LFK+FL+G P P
Sbjct  425  -LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  459



>ref|XP_008798399.1| PREDICTED: serine carboxypeptidase-like 42 [Phoenix dactylifera]
Length=335

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 96/169 (57%), Gaps = 15/169 (9%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFA---IDILP  553
            +  D C+   +  Y+N+PDVQKALHAN T   YPW        S ++ +N      D++P
Sbjct  176  DATDVCIDHEITRYLNKPDVQKALHANLTSLPYPWE-----ACSRIVNYNATDQLTDMIP  230

Query  552  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  373
             L+ L+   +PV I+SGDQD  +P++ TR     LA +LKL       PWY   ++GGWS
Sbjct  231  ILARLVKKGLPVWIFSGDQDSVVPLTGTRSQIAKLAQQLKLKPKSPYQPWYAHGQVGGWS  290

Query  372  QTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +T+GN       G L +ATVR G+H VP + P +AL LF  F++G   P
Sbjct  291  ETYGN-------GRLVYATVRDGSHMVPYAQPERALVLFTRFIEGKLLP  332



>ref|XP_006415698.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
 gb|ESQ34051.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
Length=463

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 115/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  257  GSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
             +Y+NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+
Sbjct  317  VKYLNRRDVQEALHARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVQAGVPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN         
Sbjct  374  YSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG AH VP S P ++L LFKAFL G P P
Sbjct  426  LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  460



>gb|KGN59521.1| hypothetical protein Csa_3G824180 [Cucumis sativus]
Length=271

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 95/162 (59%), Gaps = 8/162 (5%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            D C+ D V  Y+NR DVQKALHA+  G    W+F S     D    N  I  + TL +L+
Sbjct  118  DVCIADEVSSYLNREDVQKALHAHLLGGLSNWSFCSFVLKYDK--KNLLIPTIDTLGSLV  175

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             S I VL+YSGD+D  IP+  +R +   LA  L+L T     PW+   ++GGW +T+G  
Sbjct  176  HSGIRVLVYSGDEDAVIPLIGSRRLVNKLAKSLRLNTTLPYSPWFYNHQVGGWVETYGEK  235

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPP  229
                   +L+FATVRGGAH  P ++P ++LTL  AFL+G+ P
Sbjct  236  ------NSLSFATVRGGAHQAPYTAPQRSLTLITAFLQGTNP  271



>gb|KEH37845.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=464

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 114/216 (53%), Gaps = 17/216 (8%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVGE  685
            G +S  CSD+   +       +D  ++    C     +    H  + E  D CL D   +
Sbjct  261  GNISTICSDVYHEVVTSTSRFIDTFDVTSDVCLDFLQAHRLLHPHSGEKMDVCLEDHTAK  320

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS---ALLMSDIPVL  514
            Y+NR DVQKALH+   G  Y W+       + V+L++F     PTLS    L+ + + VL
Sbjct  321  YLNRQDVQKALHSRVVGMPY-WS-----TCTSVMLYDFQNLENPTLSLLGTLVKAGVRVL  374

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
             YSGDQD  IP++ TR +   LA  L L T E+   W+DGK++ GW++ +G        G
Sbjct  375  AYSGDQDSFIPLTGTRTLVKGLAKDLGLNTTEVYRVWFDGKQVAGWTEVYG--------G  426

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG AH  P S P + L LFK+F++G  PP
Sbjct  427  FLSFATIRGAAHAAPFSQPERLLVLFKSFVEGKSPP  462



>gb|ACN31969.1| unknown [Zea mays]
Length=319

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 114/218 (52%), Gaps = 13/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G LS  C+ +   ++ E    +DK ++   VF S   S   +   H    +  D C+ D 
Sbjct  110  GALSPLCARVMNRVTRETSRFVDKYDVTLDVFLSSVLSQSKTLSPHEQVGQRVDVCVEDE  169

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G    W   S     +++  N  I  +  + +L+ S I VL
Sbjct  170  TVRYLNRRDVQAALHARLVGVD-KWAVCSSVLQYELL--NLQIPTINVVGSLVRSGIRVL  226

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  + L T      W++G+++GGW+Q +G        G
Sbjct  227  VYSGDQDSVIPLTGSRTLVQSLARGMGLKTTTPYRVWFEGQQVGGWTQVYGG-------G  279

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FATVRG +H  P S P ++L LF+AFL+G P P T
Sbjct  280  ALSFATVRGASHEAPFSQPGRSLVLFRAFLQGQPLPET  317



>ref|XP_006438865.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52105.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=273

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 113/216 (52%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +  ++S E    +DK ++   V  S   S         +   T D C+ D 
Sbjct  66   GSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGETTVDVCVEDE  125

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPV+
Sbjct  126  TVNYLNRKDVQKALHARLVGVR-GWAVCS--NILDYELLDLEIPTITVVGKLVKAGIPVM  182

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R++   LA  LKL T      W++G+++GGW+Q +GN        
Sbjct  183  VYSGDQDSVIPLTGSRKLVNGLAKELKLETTVPYRVWFEGQQVGGWTQVYGNI-------  235

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG +H  P S P ++L LF+AFL   P P
Sbjct  236  -LSFATIRGASHEAPFSQPERSLVLFEAFLDSRPLP  270



>ref|XP_004975453.1| PREDICTED: serine carboxypeptidase-like 45-like [Setaria italica]
Length=522

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 115/217 (53%), Gaps = 11/217 (5%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssq--QHYLATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++    C SS +  SQ       +   D C+ D  
Sbjct  313  GSLSASCDRVMSQVTRETSRFVDKYDVTLDVCISSVLMQSQILSPQQGSRELDVCVEDET  372

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+A+HA  +G    W   S     +    +  I  + T+ AL+ S IPVL+
Sbjct  373  MSYLNRKDVQQAMHARLSGGVQRWTVCS--SVLEYKQLDLQIPTINTVGALVKSGIPVLV  430

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA RL+L        W+ GK++GGW++ FG        G 
Sbjct  431  YSGDQDSVIPLTGSRTLVSRLASRLRLNATAPYRAWFQGKQVGGWTRVFGG-------GA  483

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FATVRG +H  P S P ++L LF+AFL G P P +
Sbjct  484  LSFATVRGASHEAPFSQPERSLGLFRAFLAGRPLPES  520



>ref|XP_007223032.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24231.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=464

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 117/217 (54%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY--LATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C SS  S S+       TE  D C+ D +
Sbjct  258  GSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQVTEAIDVCVEDEI  317

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NRPDVQKALHA   G +  W   S     D  L +  I     +  L+ + IPVL+
Sbjct  318  VNYLNRPDVQKALHARLVGVR-QWAVCS--NILDYQLLDVEIPTTTIVGKLIKAGIPVLV  374

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN         
Sbjct  375  YSGDQDSVIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNI--------  426

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  427  LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLPEV  463



>ref|XP_010271868.1| PREDICTED: serine carboxypeptidase-like 45 isoform X4 [Nelumbo 
nucifera]
Length=503

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 114/215 (53%), Gaps = 11/215 (5%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  C  +  +++ EI   +D+ ++          S S +       E+ D C+ D  
Sbjct  295  GSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQKVVESTDVCVEDET  354

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQK+LHA+  G    W   +  +     + N  +  +P LS+L  S I +L+
Sbjct  355  YNYLNRDDVQKSLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILV  413

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ TR +   LA  L L T      W++GK++GGW+Q +G+         
Sbjct  414  YSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI--------  465

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            LTFAT+RGG+H  P S P ++L LF +FLKG P P
Sbjct  466  LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  500



>gb|ERN14540.1| hypothetical protein AMTR_s00038p00085900 [Amborella trichopoda]
Length=494

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 94/166 (57%), Gaps = 19/166 (11%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH--NFAIDILPTLSA  541
            DPC   +V  Y+N P+VQKA HAN T   YPW+       SD+I H  +    ILP L  
Sbjct  345  DPCTDYYVDNYLNLPEVQKAFHANVTRLNYPWS-----ACSDIITHWNDSPSTILPLLKD  399

Query  540  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  361
             + + I VL+YSGD D R+PV+ TR    +L + +K        PWY  KE+GG+S  + 
Sbjct  400  FMANGIRVLVYSGDTDGRVPVTGTRYSLNMLNLSVKTPWY----PWYTRKEVGGYSVIYN  455

Query  360  NSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                    G LTFATVRG  H VPS  P+++LTL  AFLKG P PR
Sbjct  456  --------GGLTFATVRGAGHEVPSYQPARSLTLVNAFLKGKPLPR  493



>ref|NP_001140326.1| hypothetical protein [Zea mays]
 gb|ACF83592.1| unknown [Zea mays]
 tpg|DAA38062.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=269

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 113/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVGE  685
            G LS  C  +   ++ E    +DK ++    C SS +  SQQ    +   D C+ D    
Sbjct  66   GSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQQ---GSRELDVCVEDETMR  122

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQ+A+HA   G Q  W   S     +    +  I  + T+ AL+ + IP L+YS
Sbjct  123  YLNRKDVQQAMHARLDGVQ-RWTVCSS--VLEYKQLDLQIPTVNTVGALVKAGIPALVYS  179

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA RL+L        W+ GK++GGW+Q FG        G L+
Sbjct  180  GDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFGG-------GALS  232

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            FATVRG +H  P S P ++L LF+AFL G   P +
Sbjct  233  FATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  267



>gb|KHG09716.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=462

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 99/170 (58%), Gaps = 11/170 (6%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
             +E  D C+ D +  Y+N+ DVQKALHA   G +    +T      D  L N  +  +  
Sbjct  303  VSERVDVCVEDKIVNYLNQKDVQKALHARLVGVR---RWTVCSNILDYQLLNLEMPTISI  359

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ S IPVL+YSGDQD  IP++ +R + + LA  L+L T      W++GK++GGW+Q
Sbjct  360  VGSLIKSGIPVLVYSGDQDSVIPLTGSRSLVSRLAKELELETTVPYRVWFEGKQVGGWTQ  419

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             +GN         L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  420  VYGNI--------LSFATIRGASHEAPFSQPERSLMLFKSFLEGKPLPEV  461



>ref|XP_011626549.1| PREDICTED: serine carboxypeptidase II-3 [Amborella trichopoda]
Length=477

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 94/166 (57%), Gaps = 19/166 (11%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH--NFAIDILPTLSA  541
            DPC   +V  Y+N P+VQKA HAN T   YPW+       SD+I H  +    ILP L  
Sbjct  328  DPCTDYYVDNYLNLPEVQKAFHANVTRLNYPWS-----ACSDIITHWNDSPSTILPLLKD  382

Query  540  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  361
             + + I VL+YSGD D R+PV+ TR    +L + +K        PWY  KE+GG+S  + 
Sbjct  383  FMANGIRVLVYSGDTDGRVPVTGTRYSLNMLNLSVKTPWY----PWYTRKEVGGYSVIYN  438

Query  360  NSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                    G LTFATVRG  H VPS  P+++LTL  AFLKG P PR
Sbjct  439  --------GGLTFATVRGAGHEVPSYQPARSLTLVNAFLKGKPLPR  476



>ref|XP_010271866.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nelumbo 
nucifera]
Length=519

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 114/215 (53%), Gaps = 11/215 (5%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  C  +  +++ EI   +D+ ++          S S +       E+ D C+ D  
Sbjct  311  GSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQKVVESTDVCVEDET  370

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQK+LHA+  G    W   +  +     + N  +  +P LS+L  S I +L+
Sbjct  371  YNYLNRDDVQKSLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILV  429

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ TR +   LA  L L T      W++GK++GGW+Q +G+         
Sbjct  430  YSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI--------  481

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            LTFAT+RGG+H  P S P ++L LF +FLKG P P
Sbjct  482  LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  516



>ref|XP_002322611.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
 gb|EEF04372.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
Length=442

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 113/213 (53%), Gaps = 14/213 (7%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWV  691
            +   LS  CS +   L+ EI   +DK ++    C S   S   +   A E  DPC+++  
Sbjct  242  IGNSLSASCSKVNDQLNAEIPDAIDKYDVTANVCLSFGASLLGK---AQENIDPCVQEET  298

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ++ HA   G    W F S     D  L N  I  +  + +L+ S + VL+
Sbjct  299  FVYLNRKDVQESFHAKLVGTP-KWTFCSGVVNYD--LRNLEIPTIDVVGSLVNSGVRVLV  355

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP + +R +   LA +L L       PW++ K++GGW+Q +GN         
Sbjct  356  YSGDQDSVIPFTGSRTLVEGLAKKLGLNATVPYTPWFEDKQVGGWTQVYGNI--------  407

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSP  232
            LTF+T+RGG+H  P SSP ++L LF AFL G P
Sbjct  408  LTFSTIRGGSHMAPFSSPGRSLALFAAFLSGKP  440



>gb|AES77859.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=460

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 119/217 (55%), Gaps = 13/217 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQH--YLATETADPCLRDW  694
            +G +S  CS +   +S E    +DK ++    C SS  S +        TET D C+ D 
Sbjct  253  NGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTNVLNPQQVTETIDVCVEDE  312

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA+  G  + W+  S     D  L +  I  +  +  L+ + IPVL
Sbjct  313  TVNYLNRKDVQSALHAHLIG-VHRWSPCS--SVLDYELRDLEIPTITVVGKLVKAGIPVL  369

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA +L++ T      W+ G+++GGW+Q +GN        
Sbjct  370  VYSGDQDSVIPLTGSRTLVHQLAKQLRMNTTVPYRVWFAGQQVGGWTQVYGNI-------  422

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
             L+FATVRG +H VP S P ++L LFK+FL+G P P 
Sbjct  423  -LSFATVRGASHEVPFSQPERSLVLFKSFLEGRPLPE  458



>ref|XP_009359890.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 125/221 (57%), Gaps = 21/221 (10%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY--LATETADPCLRDWV  691
            G LS  C+ +   +S E    +DK ++    C SS +S S+        +T D C+ D +
Sbjct  257  GSLSPICAMVMSQVSRETSKFVDKYDVTLDVCISSVVSQSKALLPQEVADTIDVCVDDEI  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLS---ALLMSDI  523
              Y+NRPDVQKALHA   G +  W   S       IL    +D+ +PT++    L+ + I
Sbjct  317  VNYLNRPDVQKALHARLVGVR-QWAVCS------TILDYQQLDVEIPTITIVGKLIKAGI  369

Query  522  PVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCN  343
            PVL+YSGDQD  IP++ +R++   LA +L+L+T      W+ G+++GGW+Q +GN     
Sbjct  370  PVLVYSGDQDSVIPLTGSRKLVNGLAEQLRLSTTVPYRVWFGGQQVGGWTQVYGNM----  425

Query  342  KVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  426  ----LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLPEV  462



>ref|XP_009380118.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=467

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 111/217 (51%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++          S S        TE  D C+ D  
Sbjct  257  GSLSSICQRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQQVTERVDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHAN  G    W   S     +  L N  +  +  + +L+ S IPVL+
Sbjct  317  VSYLNRKDVQAALHANLVGVT-KWTVCS--SVIEYELLNLEVPTISIVGSLVKSGIPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +G+         
Sbjct  374  YSGDQDSVIPLTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYGDV--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FATVRG +H  P S P ++L LF+AFL+G P P T
Sbjct  426  LSFATVRGASHEAPFSQPERSLVLFRAFLQGRPLPET  462



>gb|AFK47012.1| unknown [Lotus japonicus]
Length=344

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 121/215 (56%), Gaps = 15/215 (7%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssq----QHYLATETADPCLRDWV  691
            +S  CS +   +S+E    +DK ++    C SS +S S+    Q + A E  D C+ D V
Sbjct  138  VSPLCSKVMGQVSKETSKFVDKYDVTLDVCISSVLSQSKVISPQTHQANERIDVCVDDKV  197

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G +  W+  S     D++  N  +  LP +  L+ S + VLI
Sbjct  198  TNYLNRRDVQEALHAKLVGVR-KWDVCSNVLDYDML--NLEVPTLPIVGLLIKSGVRVLI  254

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +G+         
Sbjct  255  YSGDQDSVIPLTGSRTLVQKLATKLGLNTTVPYRVWFEGQQVGGWTQVYGSI--------  306

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H  P S P ++  LFK+FL+G P P
Sbjct  307  LSFATVRGASHEAPFSQPERSFVLFKSFLEGRPLP  341



>ref|XP_009380117.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 111/217 (51%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++          S S        TE  D C+ D  
Sbjct  279  GSLSSICQRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQQVTERVDVCVEDET  338

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHAN  G    W   S     +  L N  +  +  + +L+ S IPVL+
Sbjct  339  VSYLNRKDVQAALHANLVGVT-KWTVCS--SVIEYELLNLEVPTISIVGSLVKSGIPVLV  395

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +G+         
Sbjct  396  YSGDQDSVIPLTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYGDV--------  447

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FATVRG +H  P S P ++L LF+AFL+G P P T
Sbjct  448  LSFATVRGASHEAPFSQPERSLVLFRAFLQGRPLPET  484



>ref|XP_003621641.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=489

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 119/217 (55%), Gaps = 13/217 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQH--YLATETADPCLRDW  694
            +G +S  CS +   +S E    +DK ++    C SS  S +        TET D C+ D 
Sbjct  282  NGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTNVLNPQQVTETIDVCVEDE  341

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA+  G  + W+  S     D  L +  I  +  +  L+ + IPVL
Sbjct  342  TVNYLNRKDVQSALHAHLIG-VHRWSPCS--SVLDYELRDLEIPTITVVGKLVKAGIPVL  398

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA +L++ T      W+ G+++GGW+Q +GN        
Sbjct  399  VYSGDQDSVIPLTGSRTLVHQLAKQLRMNTTVPYRVWFAGQQVGGWTQVYGNI-------  451

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
             L+FATVRG +H VP S P ++L LFK+FL+G P P 
Sbjct  452  -LSFATVRGASHEVPFSQPERSLVLFKSFLEGRPLPE  487



>ref|XP_002268172.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI35664.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 111/217 (51%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +  E    +DK ++          S S        TET D C+ D  
Sbjct  257  GSVSSICSRVMSQVGRETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTETIDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G    W+  S     D  L +  I  +  +  L+ + IPVL+
Sbjct  317  ESYLNRRDVQKALHARLVGVN-KWSVCS--NILDYELLDLEIPTISIVGKLIKAGIPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW+Q +GN         
Sbjct  374  YSGDQDSVIPLTGSRTLVHGLAEELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FAT+RG +H  P S P ++L LF+AFL G P P+ 
Sbjct  426  LSFATIRGASHEAPFSQPERSLVLFRAFLGGRPLPQA  462



>ref|XP_008369640.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=463

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 125/221 (57%), Gaps = 23/221 (10%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADP---CLRDW  694
            G LS  C+ +   +S E    +DK ++    C SS  S S+   L  E AD    C+ D 
Sbjct  257  GSLSPICARVMSQVSTETSKFVDKYDVTLDVCISSVFSQSKA-LLPQEVADTIDVCVEDE  315

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLSA---LLMSD  526
            +  Y+NRPDVQKALHA   G +  W   S       IL    +D+ +PT++    L+ + 
Sbjct  316  IVNYLNRPDVQKALHARLVGVR-QWAVCS------TILDYQHLDVEIPTITIIGNLIKAG  368

Query  525  IPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRC  346
            IPVL+YSGDQD  IP++ +R++   LA +L+L+T      W+ G+++GGW+Q +GN    
Sbjct  369  IPVLVYSGDQDSVIPLTGSRKLVNGLAEQLRLSTTVPYRVWFGGQQVGGWTQVYGNM---  425

Query  345  NKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                 L+FAT+RG +H  P S P ++L LFK+FL+G P P 
Sbjct  426  -----LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLPE  461



>gb|KJB35835.1| hypothetical protein B456_006G130200 [Gossypium raimondii]
Length=336

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 94/165 (57%), Gaps = 12/165 (7%)
 Frame = -1

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  538
            ADPC+ D   +Y+NR DVQKALHA   G    WN  +        + +     + T+  +
Sbjct  183  ADPCIEDKTTKYLNRKDVQKALHAKLVGIT-SWNLCNKIVQ---YMDDLETPTIYTVGKI  238

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            + S IPV++YSGDQD  IP + TR +   LA  L L T     PW++GK++GGW+Q +G+
Sbjct  239  VKSGIPVMVYSGDQDSVIPFTGTRNLVYKLAKALGLKTTVPYRPWFEGKQVGGWTQVYGD  298

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                     L+FAT+RG +H  P+S P +++ LFKA L G P P 
Sbjct  299  I--------LSFATIRGASHTAPASQPERSMALFKAVLSGKPLPE  335



>gb|KHN31265.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 100/168 (60%), Gaps = 11/168 (7%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            A E+ D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     D  + N  +  LP 
Sbjct  298  ANESIDVCVDDKVTNYLNRRDVQEALHAKLVGIR-KWDVCS--NILDYDMLNLEVPTLPV  354

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ + + VLIYSGDQD  IP++ +R +   LA +L L +      W++G+++GGW+Q
Sbjct  355  VGSLIKAGVKVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQ  414

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             +GN         L+FATVRG +H  P S P ++L LFK+FL+G P P
Sbjct  415  VYGNI--------LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  454



>ref|XP_006483005.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=464

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 113/216 (52%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +  ++S E    +DK ++   V  S   S         +   T D C+ D 
Sbjct  257  GSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGETTVDVCVEDE  316

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPV+
Sbjct  317  TVNYLNRKDVQKALHARLVGVR-SWAVCS--NILDYELLDLEIPTITVVGKLVKAGIPVM  373

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R++   LA  LKL T      W++G+++GGW+Q +GN        
Sbjct  374  VYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPYRVWFEGQQVGGWTQVYGNI-------  426

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG +H  P S P ++L LFKAFL   P P
Sbjct  427  -LSFATIRGASHEAPFSQPERSLVLFKAFLDSRPLP  461



>gb|EPS65711.1| hypothetical protein M569_09067, partial [Genlisea aurea]
Length=167

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 96/170 (56%), Gaps = 11/170 (6%)
 Frame = -1

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  538
             D C+      Y+N P+VQKALHAN T   Y W+  S     D   ++  IDILP L  +
Sbjct  8    VDVCMTYERRFYLNLPEVQKALHANRTKLPYRWSMCSSVLNYD--YNDGNIDILPILRRI  65

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            L + IPV IYSGDQD  +P+  +R +   LA  +KL      G W+D  ++GG++  +GN
Sbjct  66   LQNGIPVWIYSGDQDSVVPLLGSRTLVRELAHDMKLPVTVPYGAWFDKHQVGGFATEYGN  125

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR-TNPN  211
                     LTFATVRG AH VP S PS+AL LF +F+ G   P  TNP+
Sbjct  126  M--------LTFATVRGAAHMVPYSQPSRALHLFSSFVNGRRLPNDTNPS  167



>ref|XP_007043816.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 ref|XP_007043817.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99647.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99648.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 96/166 (58%), Gaps = 11/166 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            ET D C+ D    Y+NR DVQKALHA   G +  W   S     D  L +  I  +  + 
Sbjct  306  ETIDVCVEDETANYLNRQDVQKALHARLVGVR-KWAVCS--NVLDYELLDLEIPTITIVG  362

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ + IPV++YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +
Sbjct  363  SLVKAGIPVMVYSGDQDSVIPLTGSRTLVNRLAKELGLKTTVTYRVWFEGQQVGGWTQVY  422

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            GN         L+FAT+RG +H  P S P ++L LFKAFL+G P P
Sbjct  423  GNI--------LSFATIRGASHEAPFSQPERSLVLFKAFLEGRPLP  460



>ref|XP_010044871.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW86989.1| hypothetical protein EUGRSUZ_B03549 [Eucalyptus grandis]
Length=473

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 96/168 (57%), Gaps = 11/168 (7%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
             T+T D C+ D    Y+NR DVQKALHA   G +  W   S     D  L N  I  +  
Sbjct  314  VTDTIDVCVEDETVNYLNRQDVQKALHARLVGVR-KWAVCS--DVLDYDLTNLEIPTITI  370

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            L  L+ + IPVL+YSGDQD  IP++ +R +   LA +L L T      W+ G+++GGW+Q
Sbjct  371  LGKLIKAGIPVLVYSGDQDSVIPLTGSRRLVHGLAEKLGLNTTIPYRVWFQGQQVGGWTQ  430

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             +GN         L+FAT+RG +H  P S P ++L LFK+FL+G P P
Sbjct  431  VYGNV--------LSFATIRGASHEAPFSQPQRSLVLFKSFLQGQPLP  470



>ref|XP_008390188.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 121/218 (56%), Gaps = 15/218 (7%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADP---CLRDW  694
            G +S  CS +   +S E    +DK ++    C SS  S S+   L  + AD    C+ D 
Sbjct  256  GSVSPICSRVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKA-LLPQQVADSIDVCVEDE  314

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
            V  Y+NRPDVQKALHA   G ++ W   S      V+  +  I  +  +  L+ + IPVL
Sbjct  315  VVNYLNRPDVQKALHARLVGVRH-WAVCSNILGYQVL--DVEIPTITIVGKLIKAGIPVL  371

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA +L+L T      W++G+++GGW+Q +GN        
Sbjct  372  VYSGDQDSVIPLTGSRTLIHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNM-------  424

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  425  -LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLPEV  461



>gb|KDO83181.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=464

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 113/216 (52%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +  ++S E    +DK ++   V  S   S         +   T D C+ D 
Sbjct  257  GSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGETTVDVCVEDE  316

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPV+
Sbjct  317  TVNYLNRKDVQKALHARLVGVR-SWAVCS--NILDYELLDLEIPTITIVGKLVKAGIPVM  373

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R++   LA  LKL T      W++G+++GGW+Q +GN        
Sbjct  374  VYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPYRVWFEGQQVGGWTQVYGNI-------  426

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG +H  P S P ++L LFKAFL   P P
Sbjct  427  -LSFATIRGASHEAPFSQPERSLVLFKAFLDSRPLP  461



>ref|XP_009113703.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
 emb|CDY46627.1| BnaA09g27540D [Brassica napus]
Length=454

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 114/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  248  GSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  307

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
             +Y+NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+
Sbjct  308  VKYLNRRDVQEALHARLVGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVQAGVPVLV  364

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA RL L T      W+ G+++GGW+Q +GN         
Sbjct  365  YSGDQDSVIPLTGSRTLVNRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  416

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  417  LSFATVRGASHEVPFSQPHRSLVLFKAFLDGHPLP  451



>ref|XP_007209121.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
 gb|EMJ10320.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
Length=460

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 98/169 (58%), Gaps = 11/169 (7%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
            TE  D C+ D +  Y+NR DVQKALHA   G +  W+  S     D  + N  I  +  +
Sbjct  302  TERIDVCVEDKIVNYLNRKDVQKALHARLVGVR-RWDVCS--NILDYQVLNLEIPTISLV  358

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
             +L+ + IPVL+YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW+Q 
Sbjct  359  GSLVKAGIPVLVYSGDQDSVIPLTGSRTLVYRLARELGLNTTVPYRVWFEGKQVGGWTQV  418

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            +GN         L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  419  YGNI--------LSFATIRGASHEAPFSQPERSLRLFKSFLEGRPLPEV  459



>ref|XP_006438863.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52103.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=343

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 113/216 (52%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +  ++S E    +DK ++   V  S   S         +   T D C+ D 
Sbjct  136  GSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGETTVDVCVEDE  195

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPV+
Sbjct  196  TVNYLNRKDVQKALHARLVGVR-GWAVCS--NILDYELLDLEIPTITVVGKLVKAGIPVM  252

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R++   LA  LKL T      W++G+++GGW+Q +GN        
Sbjct  253  VYSGDQDSVIPLTGSRKLVNGLAKELKLETTVPYRVWFEGQQVGGWTQVYGNI-------  305

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG +H  P S P ++L LF+AFL   P P
Sbjct  306  -LSFATIRGASHEAPFSQPERSLVLFEAFLDSRPLP  340



>ref|XP_007028221.1| Serine carboxypeptidase 45 [Theobroma cacao]
 gb|EOY08723.1| Serine carboxypeptidase 45 [Theobroma cacao]
Length=470

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 94/167 (56%), Gaps = 18/167 (11%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHAN---TTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            DPC++D   +Y+NR DVQKALHA    TT W     F          + N     +  + 
Sbjct  318  DPCIQDKTTKYLNRKDVQKALHAQLVGTTSWNLCNKFVQ-------YMDNLETPTIHIVG  370

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +++ S IPV++YSGDQD  IP + TR +   LA  L L T     PW++GK++GGW+Q +
Sbjct  371  SIVKSGIPVMVYSGDQDSVIPFTGTRTLVYKLAKALGLNTTVPYRPWFEGKQVGGWTQVY  430

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            G+         L+FAT+RG +H  P+S P ++L LFKA L G P P 
Sbjct  431  GDI--------LSFATIRGASHTAPASQPERSLALFKAVLAGKPLPE  469



>ref|XP_010100042.1| Serine carboxypeptidase-like 45 [Morus notabilis]
 gb|EXB81213.1| Serine carboxypeptidase-like 45 [Morus notabilis]
Length=443

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 111/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S+E    +DK ++          +           ET D C+ D  
Sbjct  237  GSVSSVCSKVMNQVSKETSRFVDKYDVTLDVCISSVFAQCQVLSPQQVAETIDVCVEDET  296

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G  + W   S     D  L +  I  +  +  L+ + +PVL+
Sbjct  297  VNYLNRQDVQKALHARLVG-VHRWAVCS--NVLDYELLDVEIPTITIVGKLIKAGVPVLV  353

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN         
Sbjct  354  YSGDQDSVIPLTGSRTLVHELAEKLALNTTVPYRVWFEGQQVGGWTQVYGNM--------  405

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L FAT+RG +H  P S P ++L LFK+FL+G P P
Sbjct  406  LAFATIRGASHEAPFSQPERSLVLFKSFLEGRPLP  440



>gb|AFK49319.1| unknown [Lotus japonicus]
Length=224

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 116/218 (53%), Gaps = 19/218 (9%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   ++ E    +DK ++          S +        TET D C+ D  
Sbjct  18   GSVSPICSRVMSQVTTETSRFVDKYDVTLDVCISSVFSQTKVLSPQQGTETIDVCVEDEA  77

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSA---LLMSDIP  520
              Y+NR DVQ ALHA+  G Q  W+  S     +V+ + F    +PT++A   L+ + +P
Sbjct  78   ANYLNRKDVQSALHAHLVGVQ-RWSVCS-----NVLNYEFRDLEIPTITAVSKLVKAGLP  131

Query  519  VLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNK  340
            VL+YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW+Q +GN      
Sbjct  132  VLVYSGDQDSVIPLTGSRTLVHQLAKELGLKTTVPYRVWFEGKQVGGWTQVYGNIP----  187

Query  339  VGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                +FAT+RG +H  P S P ++L LF++FL+G   P
Sbjct  188  ----SFATIRGASHEAPFSQPERSLVLFRSFLQGHALP  221



>gb|KJB31552.1| hypothetical protein B456_005G196500 [Gossypium raimondii]
Length=316

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 118/217 (54%), Gaps = 17/217 (8%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATE----TADPCLRD  697
            G +S  CS +   +S E    +DK ++    C SS +S S    L T+    T D C+ D
Sbjct  110  GNVSPICSRVMGQVSTETSRFVDKYDVTLDVCISSVLSQS--EILTTQQVGDTIDVCVED  167

Query  696  WVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPV  517
                Y+NR DVQKALHA   G  + W   S     D  L +  I  +  +  L+ + IPV
Sbjct  168  ETVNYLNRQDVQKALHARLVG-VHKWAVCS--SVLDYELLDLEIPTITIVGRLVKAGIPV  224

Query  516  LIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKV  337
            ++YSGDQD  IP++ +R++   LA  L L T      W++G+++GGW+Q +GN       
Sbjct  225  MVYSGDQDSVIPLTGSRKLVNQLAEELGLKTTVPYRVWFEGQQVGGWTQAYGNI------  278

Query  336  GNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
              L+FAT+RG +H  P S P ++L LFKAFL+G P P
Sbjct  279  --LSFATIRGASHEAPFSQPERSLVLFKAFLEGRPLP  313



>ref|XP_008239549.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=467

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 98/167 (59%), Gaps = 11/167 (7%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
            TE  D C+ D +  Y+NR DVQKALHA   G +  W+  S     D  + N  I  +  +
Sbjct  309  TERIDVCVEDKIVNYLNRKDVQKALHARLVGVR-RWDVCS--NILDYQVLNMEIPTISLV  365

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
             +L+ + IPVL+YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW+Q 
Sbjct  366  GSLVKAGIPVLVYSGDQDSVIPLTGSRTLVYRLARELGLNTTVPYRVWFEGKQVGGWTQV  425

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +GN         L+FAT+RG +H  P S P ++L LFK+FL+G P P
Sbjct  426  YGNI--------LSFATIRGASHEAPFSQPERSLRLFKSFLEGRPLP  464



>gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=458

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 116/213 (54%), Gaps = 14/213 (7%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVGE  685
            G +S  C+ +   +  E    +DK ++    C  S +S S+Q     ET D CL D    
Sbjct  257  GSVSSMCTKVLSQVGIETSRFIDKYDVTLDVCIPSVLSQSKQ---VGETVDVCLEDETVN  313

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQKALHA   G +  W   S     +V+  +  +  +  + +L+ + +PV +YS
Sbjct  314  YLNRRDVQKALHARLVGTR-KWTVCSDVLDYEVL--DVEVPTINIVGSLVKAGVPVFVYS  370

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +GN+        L 
Sbjct  371  GDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNT--------LA  422

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            FATVRG AH VP S P++AL LFKAFL G P P
Sbjct  423  FATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  455



>ref|XP_006578724.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=469

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 100/168 (60%), Gaps = 11/168 (7%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            A E+ D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     D  + N  +  LP 
Sbjct  310  ANESIDVCVDDKVTNYLNRRDVQEALHAKLVGIR-KWDVCS--NILDYDMLNLEVPTLPV  366

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ + + VLIYSGDQD  IP++ +R +   LA +L L +      W++G+++GGW+Q
Sbjct  367  VGSLIKAGVKVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQ  426

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             +GN         L+FATVRG +H  P S P ++L LFK+FL+G P P
Sbjct  427  VYGNI--------LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  466



>ref|XP_010250555.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=498

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 113/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S+E    +DK ++          S S        TE  D C+ D  
Sbjct  292  GSISSVCSRVMSRVSKETSRFVDKYDVTLDVCISSVLSQSKVLNPQQVTERIDVCVEDET  351

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G +  W   S     D  L N  I  +  + +L+ + IPVL+
Sbjct  352  VNYLNRRDVQKALHARLVGVRR-WAVCS--NILDYELLNLEIPTISIVGSLVKAGIPVLV  408

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA+ L L T      W+ G+++GGW+Q +GN         
Sbjct  409  YSGDQDSVIPLTGSRTLVHELAMELGLNTTVPYRVWFAGQQVGGWTQDYGNI--------  460

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FAT+RG +H  P S P ++L LFK+FL+G P P
Sbjct  461  LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLP  495



>ref|XP_006304410.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
 gb|EOA37308.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
Length=459

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 115/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  253  GSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  312

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
             +Y+NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+
Sbjct  313  VKYLNRRDVQEALHARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVRAGVPVLV  369

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA +L L T      W+ G+++GGW+Q +GN         
Sbjct  370  YSGDQDSVIPLTGSRTLVSRLAKQLGLRTTVPYRVWFAGQQVGGWTQVYGNV--------  421

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG AH VP S P ++L LFKAFL G P P
Sbjct  422  LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  456



>ref|XP_007139316.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
 gb|ESW11310.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
Length=461

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 113/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            +G +S  CS +   +S E    +DK ++          S +        TET D C+ D 
Sbjct  254  NGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDE  313

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G Q    +++     D  L +  I  +  +  L+   IPVL
Sbjct  314  TVNYLNRKDVQSALHARLVGVQ---RWSACSNVLDYELRDLEIPTITVVGKLVQEGIPVL  370

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA +L L T      W++ +++GGW+Q +G+        
Sbjct  371  VYSGDQDSVIPLTGSRTLVHKLAKKLGLKTTVPYRVWFEKQQVGGWTQVYGDI-------  423

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
             L+FAT+RG +H  P S P +AL LFK+FL+G P P+
Sbjct  424  -LSFATIRGASHEAPFSQPERALVLFKSFLEGRPMPQ  459



>ref|XP_009334311.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=459

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 112/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWVGE  685
            +S  CS +   +S+E    +DK ++          S S        TE  D C+ D    
Sbjct  255  MSPVCSRVMSQVSKETSKFVDKYDVTIDVCISSVLSQSKVISPNQMTERIDVCVEDKTVN  314

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQKALHA   G +  W+  S     D  + N  I  +  + +L+   IPVL+YS
Sbjct  315  YLNRKDVQKALHARLVGVR-RWDVCS--NILDYQVLNLEIPTISLVGSLVKQGIPVLVYS  371

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA  L L T      W++GK++GGW+Q +GN         L+
Sbjct  372  GDQDSVIPLTGSRSLVYRLATELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LS  423

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  424  FATIRGASHEAPFSQPGRSLRLFKSFLEGRPLPEV  458



>gb|KHN08897.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=451

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 114/221 (52%), Gaps = 21/221 (10%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRD  697
            + G LS+ C+ I  ++  E+ + +D+ ++        ++  S        T+  D C+ D
Sbjct  243  IHGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSSANQQSYELNQMQETQKIDVCVDD  302

Query  696  WVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAIDILPTLSALLMS  529
                Y+NR DVQKALHA   G        S   T   +LH    N  I  +  L AL+ S
Sbjct  303  KAVTYLNRKDVQKALHAKLVG-------VSKWSTCSRVLHYDRRNLEIPTISILGALVNS  355

Query  528  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGR  349
            +I VL+YSGDQD  IP+  +R +   LA  L L T      W++GK++ GW+Q +G    
Sbjct  356  NIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFEGKQVAGWTQVYG----  411

Query  348  CNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                G L++AT+RG +H  P + P ++L L KAFL+G P P
Sbjct  412  ----GMLSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLP  448



>gb|AAG51475.1|AC069471_6 serine carboxypeptidase II, putative [Arabidopsis thaliana]
Length=456

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 118/213 (55%), Gaps = 14/213 (7%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVGE  685
            G +S  CS +   +S E    +DK ++    C  S +S S+Q     E+ D C+ D    
Sbjct  255  GSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKQ---VGESVDVCVEDETVN  311

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+YS
Sbjct  312  YLNRRDVQEALHARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVKAGVPVLVYS  368

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R + + LA +L L T      W+ G+++GGW+Q +GN         L+
Sbjct  369  GDQDSVIPLTGSRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LS  420

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  421  FATVRGASHEVPFSQPERSLVLFKAFLDGHPLP  453



>ref|XP_009337518.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=468

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 112/213 (53%), Gaps = 13/213 (6%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWVGE  685
            +S  CS +   +S+E    +DK ++          S S        TE  D C+ D    
Sbjct  264  MSPVCSRVMSQVSKETSKFVDKYDVTLDVCISSVLSQSKVISPNQMTERIDVCVEDKTVN  323

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQKALHA   G +  W+  S     D  + N  I  +  + +L+   IPVL+YS
Sbjct  324  YLNRKDVQKALHARLVGVR-RWDVCS--NILDYQVLNLEIPTISLVGSLVKQGIPVLVYS  380

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA  L L T      W++GK++GGW+Q +GN         L+
Sbjct  381  GDQDSVIPLTGSRSLVYRLATELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LS  432

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            FAT+RG +H  P S P ++L LFK+FL+G P P
Sbjct  433  FATIRGASHEAPFSQPGRSLRLFKSFLEGRPLP  465



>ref|XP_003630573.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AET05049.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 122/217 (56%), Gaps = 15/217 (7%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssq----QHYLATETADPCLRDWV  691
            +S  CS +   +S E    +DK ++    C SS +S S+    Q++ A E+ D C+ D V
Sbjct  259  ISLLCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQNHHANESIDVCVDDEV  318

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G    WN  S     D  + N  +  L  + +++ + + VLI
Sbjct  319  TNYLNRRDVQKALHAELIGVP-KWNVCS--NILDYNMLNLEVPTLHVVGSIIKAGVRVLI  375

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L T      W++G ++GGW+Q +GN+        
Sbjct  376  YSGDQDSVIPLTGSRTLVHKLARQLALKTTIPYRVWFEGHQVGGWTQVYGNT--------  427

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            LTFAT+RG +H  P S P ++L LFK+FL+  P P++
Sbjct  428  LTFATIRGASHEAPFSQPERSLVLFKSFLENKPLPKS  464



>ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
 sp|Q8VY01.1|SCP46_ARATH RecName: Full=Serine carboxypeptidase-like 46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL67013.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC08849.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
Length=465

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 96/166 (58%), Gaps = 11/166 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            ET D CL D    Y+NR DVQKALHA   G +  W   S     +V+  +  +  +  + 
Sbjct  308  ETVDVCLEDETVNYLNRRDVQKALHARLVGTR-KWTVCSDVLDYEVL--DVEVPTINIVG  364

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ + +PV +YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +
Sbjct  365  SLVKAGVPVFVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVY  424

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            GN+        L FATVRG AH VP S P++AL LFKAFL G P P
Sbjct  425  GNT--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  462



>ref|XP_007137891.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
 gb|ESW09885.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
Length=467

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 101/170 (59%), Gaps = 11/170 (6%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            A+E+ D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     D++  N  +  LP 
Sbjct  308  ASESIDVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWDVCSNVLNYDML--NLEVPTLPV  364

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ + + VLIYSGDQD  IP++ +R +   L  +L L T      W++G+++GGW+Q
Sbjct  365  VGSLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLGRQLGLNTTVPYRVWFEGQQVGGWTQ  424

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
              GN+        L+FATVRG +H VP S P ++L LFK+FLKG   P  
Sbjct  425  VHGNT--------LSFATVRGASHEVPFSQPRRSLVLFKSFLKGISLPEV  466



>gb|KJB35837.1| hypothetical protein B456_006G130200 [Gossypium raimondii]
Length=438

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 94/166 (57%), Gaps = 12/166 (7%)
 Frame = -1

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  538
            ADPC+ D   +Y+NR DVQKALHA   G    WN  +        + +     + T+  +
Sbjct  285  ADPCIEDKTTKYLNRKDVQKALHAKLVGIT-SWNLCNKIVQ---YMDDLETPTIYTVGKI  340

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            + S IPV++YSGDQD  IP + TR +   LA  L L T     PW++GK++GGW+Q +G+
Sbjct  341  VKSGIPVMVYSGDQDSVIPFTGTRNLVYKLAKALGLKTTVPYRPWFEGKQVGGWTQVYGD  400

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                     L+FAT+RG +H  P+S P +++ LFKA L G P P  
Sbjct  401  I--------LSFATIRGASHTAPASQPERSMALFKAVLSGKPLPEA  438



>ref|XP_003554111.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=460

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/221 (34%), Positives = 114/221 (52%), Gaps = 21/221 (10%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRD  697
            + G LS+ C+ I  ++  E+ + +D+ ++        ++  +        T+  D C+ D
Sbjct  252  IHGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSSANQQAYELNQMQETQKIDVCVDD  311

Query  696  WVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAIDILPTLSALLMS  529
                Y+NR DVQKALHA   G        S   T   +LH    N  I  +  L AL+ S
Sbjct  312  KAVTYLNRKDVQKALHAKLVG-------VSKWSTCSRVLHYDRRNLEIPTISILGALVNS  364

Query  528  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGR  349
            +I VL+YSGDQD  IP+  +R +   LA  L L T      W++GK++ GW+Q +G    
Sbjct  365  NIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFEGKQVAGWTQVYG----  420

Query  348  CNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                G L++AT+RG +H  P + P ++L L KAFL+G P P
Sbjct  421  ----GMLSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLP  457



>tpg|DAA38063.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=274

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 112/217 (52%), Gaps = 12/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHY--LATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++    C SS +  SQ       +   D C+ D  
Sbjct  66   GSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSRELDVCVEDET  125

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+A+HA   G Q  W   S     +    +  I  + T+ AL+ + IP L+
Sbjct  126  MRYLNRKDVQQAMHARLDGVQ-RWTVCS--SVLEYKQLDLQIPTVNTVGALVKAGIPALV  182

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA RL+L        W+ GK++GGW+Q FG        G 
Sbjct  183  YSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFGG-------GA  235

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FATVRG +H  P S P ++L LF+AFL G   P +
Sbjct  236  LSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  272



>ref|XP_010549304.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Tarenaya 
hassleriana]
Length=467

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 111/216 (51%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +   +S E    +DK ++   V      S            ET D C+ D 
Sbjct  260  GTVSAMCSKVMSQVSVETSRFVDKYDVTLDVCIPSVLSQSKVVSPQQQVGETVDVCVEDE  319

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ++LHA   G +  W   S     D  L +  I  +  +  L+ + IPVL
Sbjct  320  TVSYLNRRDVQRSLHARLVGVR-KWAVCS--NVLDYELLDVEIPTITVVGNLVKAGIPVL  376

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L+L T      W+ G+++GGW+Q +GN        
Sbjct  377  VYSGDQDSVIPLTGSRTLVNRLAEELRLRTTVPYRVWFAGQQVGGWTQVYGNI-------  429

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FATVRG +H VP S P ++L LFKAF+ G P P
Sbjct  430  -LSFATVRGASHEVPFSQPQRSLVLFKAFINGHPLP  464



>ref|XP_008670742.1| PREDICTED: serine carboxypeptidase-like 45 [Zea mays]
 tpg|DAA42025.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=479

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 114/218 (52%), Gaps = 13/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G LS  C+ +   ++ E    +DK ++   VF S   S   +   H    +  D C+ D 
Sbjct  270  GALSPLCARVMNRVTRETSRFVDKYDVTLDVFLSSVLSQSKTLSPHEQVGQRVDVCVEDE  329

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G    W   S     +++  N  I  +  + +L+ S I VL
Sbjct  330  TVRYLNRRDVQAALHARLVGVD-KWAVCSSVLQYELL--NLQIPTINVVGSLVRSGIRVL  386

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  + L T      W++G+++GGW+Q +G        G
Sbjct  387  VYSGDQDSVIPLTGSRTLVQSLARGMGLKTTTPYRVWFEGQQVGGWTQVYGG-------G  439

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FATVRG +H  P S P ++L LF+AFL+G P P T
Sbjct  440  ALSFATVRGASHEAPFSQPGRSLVLFRAFLQGQPLPET  477



>ref|XP_006410496.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
 gb|ESQ51949.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
Length=462

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 111/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G++S  CS +   +S E    +DK ++    C     S S         ET D C+ D  
Sbjct  256  GQVSSMCSKVMTQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVNPQQVGETVDVCVEDET  315

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G +  W   S     D  L +  +  +  + +L+ + +PVL+
Sbjct  316  VNYLNRRDVQKALHARLVGTR-KWAVCS--NVLDYELLDVEVPTVNIVGSLVKAGVPVLV  372

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +G          
Sbjct  373  YSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGEI--------  424

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L FATVRG AH VP S P ++L LFKAFL G P P
Sbjct  425  LAFATVRGAAHEVPFSQPERSLVLFKAFLGGRPLP  459



>gb|KHG30064.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=472

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 94/166 (57%), Gaps = 12/166 (7%)
 Frame = -1

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  538
            ADPC+ D   +Y+NR DVQKALHA   G    WN  +        + +     + T+  +
Sbjct  319  ADPCIEDKTTKYLNRKDVQKALHAKLVGIT-SWNLCNKIVQ---YMDDLETPTIYTVGKI  374

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            + S IPV++YSGDQD  IP + TR +   LA  L L T     PW++GK++GGW+Q +G+
Sbjct  375  VKSGIPVMVYSGDQDSVIPFTGTRNLVYKLAKALGLKTTVPYRPWFEGKQVGGWTQVYGD  434

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                     L+FAT+RG +H  P+S P +++ LFKA L G P P  
Sbjct  435  I--------LSFATIRGASHTAPASQPKRSMALFKAVLSGKPLPEA  472



>gb|KDP37688.1| hypothetical protein JCGZ_06345 [Jatropha curcas]
Length=468

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 94/166 (57%), Gaps = 11/166 (7%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            A E  D C+ +   EY+N+ DVQ+ALHA   G    W F SP    D+   N  I ++  
Sbjct  312  APENIDLCVEEKALEYLNKKDVQEALHAKLVGVT-NWTFCSPVLQYDI--ENLEISMIDV  368

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ S I V++YSGDQD  +P + TR +   LA +L+L T      W + K++GGW+Q
Sbjct  369  VGSLVTSGIQVMVYSGDQDSVVPFTGTRTLVNDLAKKLRLNTTTTYRAWLEDKQVGGWTQ  428

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSP  232
             +G          L FAT+RGG+H  P SSP ++L LFK F+ G P
Sbjct  429  VYGEI--------LRFATIRGGSHMTPLSSPKRSLALFKTFVTGDP  466



>ref|XP_003551804.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 113/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            +G +S  CS +   +S E    +DK ++          S +        TET D C+ D 
Sbjct  254  NGAVSPICSSVMSQVSTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDE  313

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA+  G Q    +++     D  L +  I  +  +  L+   IPVL
Sbjct  314  TVNYLNRKDVQSALHAHLVGVQ---RWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVL  370

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++ +++GGW+Q +GN        
Sbjct  371  VYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI-------  423

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
             L+FAT+RG +H  P S P ++L LFK+FL+G P P+
Sbjct  424  -LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLPQ  459



>ref|XP_006438864.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52104.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=464

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 113/216 (52%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +  ++S E    +DK ++   V  S   S         +   T D C+ D 
Sbjct  257  GSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGETTVDVCVEDE  316

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPV+
Sbjct  317  TVNYLNRKDVQKALHARLVGVR-GWAVCS--NILDYELLDLEIPTITVVGKLVKAGIPVM  373

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R++   LA  LKL T      W++G+++GGW+Q +GN        
Sbjct  374  VYSGDQDSVIPLTGSRKLVNGLAKELKLETTVPYRVWFEGQQVGGWTQVYGNI-------  426

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG +H  P S P ++L LF+AFL   P P
Sbjct  427  -LSFATIRGASHEAPFSQPERSLVLFEAFLDSRPLP  461



>ref|XP_007162064.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
 gb|ESW34058.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
Length=459

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/221 (34%), Positives = 114/221 (52%), Gaps = 21/221 (10%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRD  697
            +SG LSE C +I  ++  E+ + +D+ ++        ++  +         +  D C+ D
Sbjct  251  ISGNLSEICDNINTLVFTELSNYIDQYDVTLDVCLSSANQQAYVLNQMQKIQKIDVCVDD  310

Query  696  WVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAIDILPTLSALLMS  529
                Y+NR DVQKALHA   G        S   T   +LH    N  I  +  L +L+ S
Sbjct  311  KAVNYLNRKDVQKALHAKLVG-------VSKWLTCSRVLHYDRTNLEIPTISILGSLVNS  363

Query  528  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGR  349
             I VL+YSGDQD  IP+  +R +   LA  L L T      W++GK++GGW+Q +G+   
Sbjct  364  KIRVLVYSGDQDSVIPLMGSRSLVNGLAKELGLNTTVAYRAWFEGKQVGGWTQVYGDI--  421

Query  348  CNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                  L++AT+RG +H  P + P ++L L KAFL+G P P
Sbjct  422  ------LSYATIRGASHEAPFNQPRRSLGLLKAFLEGKPLP  456



>ref|XP_012072731.1| PREDICTED: serine carboxypeptidase-like 45 [Jatropha curcas]
Length=477

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 94/166 (57%), Gaps = 11/166 (7%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            A E  D C+ +   EY+N+ DVQ+ALHA   G    W F SP    D+   N  I ++  
Sbjct  321  APENIDLCVEEKALEYLNKKDVQEALHAKLVGVT-NWTFCSPVLQYDI--ENLEISMIDV  377

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ S I V++YSGDQD  +P + TR +   LA +L+L T      W + K++GGW+Q
Sbjct  378  VGSLVTSGIQVMVYSGDQDSVVPFTGTRTLVNDLAKKLRLNTTTTYRAWLEDKQVGGWTQ  437

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSP  232
             +G          L FAT+RGG+H  P SSP ++L LFK F+ G P
Sbjct  438  VYGEI--------LRFATIRGGSHMTPLSSPKRSLALFKTFVTGDP  475



>gb|KJB35838.1| hypothetical protein B456_006G130200 [Gossypium raimondii]
Length=463

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 94/166 (57%), Gaps = 12/166 (7%)
 Frame = -1

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  538
            ADPC+ D   +Y+NR DVQKALHA   G    WN  +        + +     + T+  +
Sbjct  310  ADPCIEDKTTKYLNRKDVQKALHAKLVGIT-SWNLCNKIVQ---YMDDLETPTIYTVGKI  365

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            + S IPV++YSGDQD  IP + TR +   LA  L L T     PW++GK++GGW+Q +G+
Sbjct  366  VKSGIPVMVYSGDQDSVIPFTGTRNLVYKLAKALGLKTTVPYRPWFEGKQVGGWTQVYGD  425

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                     L+FAT+RG +H  P+S P +++ LFKA L G P P  
Sbjct  426  I--------LSFATIRGASHTAPASQPERSMALFKAVLSGKPLPEA  463



>gb|KJB35831.1| hypothetical protein B456_006G130200 [Gossypium raimondii]
Length=472

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 94/166 (57%), Gaps = 12/166 (7%)
 Frame = -1

Query  717  ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  538
            ADPC+ D   +Y+NR DVQKALHA   G    WN  +        + +     + T+  +
Sbjct  319  ADPCIEDKTTKYLNRKDVQKALHAKLVGIT-SWNLCNKIVQ---YMDDLETPTIYTVGKI  374

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            + S IPV++YSGDQD  IP + TR +   LA  L L T     PW++GK++GGW+Q +G+
Sbjct  375  VKSGIPVMVYSGDQDSVIPFTGTRNLVYKLAKALGLKTTVPYRPWFEGKQVGGWTQVYGD  434

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                     L+FAT+RG +H  P+S P +++ LFKA L G P P  
Sbjct  435  I--------LSFATIRGASHTAPASQPERSMALFKAVLSGKPLPEA  472



>ref|XP_007145476.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
 gb|ESW17470.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
Length=465

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 113/223 (51%), Gaps = 22/223 (10%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATE-----TADPCL  703
            SG+L+  CS +  ++S E+   +D  ++    C SS    +      T+       D C+
Sbjct  252  SGKLTPICSGVNKLVSTEVSRYVDTYDVTLDVCLSSVDQQAYVLNQLTQLQEGGKIDVCV  311

Query  702  RDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLM  532
             D    Y+NR DVQ+ALHA   G       TS    SD +   L N  I  +P L AL  
Sbjct  312  EDETTAYLNRKDVQEALHAKLEG------ITSWSVCSDTLGYDLQNLEIPTIPILGALAK  365

Query  531  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  352
            S I VL+YSGDQD  IP+  TR +   LA    L T      W++GK++ GW+Q +G+  
Sbjct  366  SGIRVLVYSGDQDSVIPLIGTRSLVNGLAKDFGLNTTVSYRTWFEGKQVAGWTQEYGDI-  424

Query  351  RCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                   L+FATVRG AH  P S P ++L L KAFL+G P P 
Sbjct  425  -------LSFATVRGAAHEAPFSQPERSLVLLKAFLEGKPLPE  460



>ref|XP_007038110.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOY22611.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 96/170 (56%), Gaps = 11/170 (6%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
             +E  D C+ D +  Y+NR DVQKALHA   G +  W   S     D  L N  I  +  
Sbjct  304  VSERVDVCVEDKIVNYLNRKDVQKALHALLVGVR-RWAVCS--NILDYQLLNLEIPTISI  360

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ + IPVL+YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW+Q
Sbjct  361  VGSLIKAGIPVLVYSGDQDSVIPLTGSRTLVRGLAKELGLETTVPYRVWFEGKQVGGWTQ  420

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             +GN         L FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  421  VYGNI--------LAFATIRGASHEAPFSQPERSLMLFKSFLEGKPLPEV  462



>ref|XP_011652217.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
45 [Cucumis sativus]
Length=468

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 95/162 (59%), Gaps = 8/162 (5%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            D C+ D V  Y+NR DVQKALHA+  G    W+F S     D    N  I  + TL +L+
Sbjct  315  DVCIADEVSSYLNREDVQKALHAHLLGGLSNWSFCSFVLKYDK--KNLLIPTIDTLGSLV  372

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             S I VL+YSGD+D  IP+  +R +   LA  L+L T     PW+   ++GGW +T+G  
Sbjct  373  HSGIRVLVYSGDEDAVIPLIGSRRLVNKLAKSLRLNTTLPYSPWFYNHQVGGWVETYGEK  432

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPP  229
                   +L+FATVRGGAH  P ++P ++LTL  AFL+G+ P
Sbjct  433  ------NSLSFATVRGGAHQAPYTAPQRSLTLITAFLQGTNP  468



>ref|XP_004310134.1| PREDICTED: serine carboxypeptidase-like 45 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 112/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++          S S        TE+ D C+ D  
Sbjct  252  GSVSPICSKVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLSPQQVTESIDVCVEDET  311

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G +  W   S     D  L +  I  +  +  L+ + I VL+
Sbjct  312  VNYLNRLDVQKALHARLVGVR-KWAVCS--NVLDYELLDLEIPTISIVGKLIKAGISVLV  368

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  LKL T      W++G+++GGW+Q +GN         
Sbjct  369  YSGDQDSVIPLTGSRTLVHGLAEELKLNTTVPYRVWFEGQQVGGWTQVYGNM--------  420

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FAT+RG +H  P S P ++L LFK+FL+G P P
Sbjct  421  LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLP  455



>ref|XP_002881286.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57545.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 96/166 (58%), Gaps = 11/166 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            ET D C+ D    Y+NR DVQ+ALHA   G +  W   S     D  + +  +  +  + 
Sbjct  299  ETVDVCVEDETVNYLNRRDVQRALHARLVGTR-KWAVCS--NVLDYEVLDVEVPTINIVG  355

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +
Sbjct  356  SLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVY  415

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            GN+        L FATVRG AH VP S P++AL LFKAFL G P P
Sbjct  416  GNT--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  453



>ref|XP_011075459.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=472

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 119/222 (54%), Gaps = 19/222 (9%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATE--TADPCLRDW  694
            SG L+  CS +  ++S EI   +D  ++    C SS +  ++      +    D C+ D 
Sbjct  252  SGALTPVCSRVIKLVSSEISRFIDTYDVTLDVCLSSVMLQAEVLNQVQDEPKIDVCVEDE  311

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDI  523
               Y+NR DVQ+ALHA   G    W+  S     D++   + N  I  +  L  L+ S +
Sbjct  312  ANAYLNRKDVQQALHARLVGVS-RWSICS-----DILHYEMQNLEIPTIGILGLLVKSGV  365

Query  522  PVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCN  343
             VL+YSGDQD  +P++ TR +   LA  LKL T E  G W++G+++ GW+Q++G      
Sbjct  366  RVLVYSGDQDSVLPLTGTRALVNGLAKDLKLNTSEPYGAWFEGRQVAGWTQSYGEF----  421

Query  342  KVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTN  217
                L+FAT+RG +H  P S P ++L LF +F+ G P PR N
Sbjct  422  ----LSFATIRGASHEAPFSQPERSLVLFSSFVGGKPLPRFN  459



>ref|XP_006294161.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
 gb|EOA27059.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
Length=465

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 95/166 (57%), Gaps = 11/166 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            ET D C+ D    Y+NR DVQKALHA   G +  W   S     D  + +  +  +  + 
Sbjct  308  ETVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWAVCS--NVLDYEVLDVEVPTINIVG  364

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +
Sbjct  365  SLVKARVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTGPYRVWFAGQQVGGWTQVY  424

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            GN         L FATVRG AH VP S P++AL LFKAFL G P P
Sbjct  425  GNI--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  462



>gb|ACF83745.1| unknown [Zea mays]
Length=322

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 111/218 (51%), Gaps = 13/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G LS  C+ +   ++ E    +DK ++   V  S   S       H    +  D C+ D 
Sbjct  113  GSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILSPHEQVGQRIDVCVEDE  172

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G    W   S     +  L N  I  +  + +L+ S I VL
Sbjct  173  TVRYLNRRDVQAALHARLVGVD-KWAVCS--SVLEYELLNLQIPTISVVGSLVKSGIRVL  229

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  + L T      W++G+++GGW+Q +G        G
Sbjct  230  VYSGDQDSVIPLTGSRTLVQNLARDMGLKTTTPYRVWFEGQQVGGWTQVYGG-------G  282

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  283  ALSFATIRGASHEAPFSQPGRSLVLFRAFLQGQPLPET  320



>ref|XP_006652227.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=467

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 91/163 (56%), Gaps = 8/163 (5%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            D C+ D    Y+NR DVQ+A+HA   G    W   S     +    +  I  + T+  L+
Sbjct  309  DVCVEDETMGYLNRKDVQEAMHARLDGGVAKWTVCS--SVLEYRQLDLQIPTINTVGGLV  366

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             S +PVL+YSGDQD  IP++ +R +   LA RL+L T      W+ G+++GGW+Q +G  
Sbjct  367  KSGVPVLVYSGDQDSVIPLTGSRTLVQRLAARLRLNTTAPYRVWFQGRQVGGWTQAYGGG  426

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                  G L FATVRG +H  P S P ++L LF+AFL G P P
Sbjct  427  ------GTLAFATVRGASHEAPFSQPERSLVLFRAFLAGRPLP  463



>gb|KJB31548.1| hypothetical protein B456_005G196500 [Gossypium raimondii]
Length=463

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 118/217 (54%), Gaps = 17/217 (8%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATE----TADPCLRD  697
            G +S  CS +   +S E    +DK ++    C SS +S S    L T+    T D C+ D
Sbjct  257  GNVSPICSRVMGQVSTETSRFVDKYDVTLDVCISSVLSQS--EILTTQQVGDTIDVCVED  314

Query  696  WVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPV  517
                Y+NR DVQKALHA   G  + W   S     D  L +  I  +  +  L+ + IPV
Sbjct  315  ETVNYLNRQDVQKALHARLVG-VHKWAVCS--SVLDYELLDLEIPTITIVGRLVKAGIPV  371

Query  516  LIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKV  337
            ++YSGDQD  IP++ +R++   LA  L L T      W++G+++GGW+Q +GN       
Sbjct  372  MVYSGDQDSVIPLTGSRKLVNQLAEELGLKTTVPYRVWFEGQQVGGWTQAYGNI------  425

Query  336  GNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
              L+FAT+RG +H  P S P ++L LFKAFL+G P P
Sbjct  426  --LSFATIRGASHEAPFSQPERSLVLFKAFLEGRPLP  460



>ref|XP_010549305.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 112/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         ET D C+ D  
Sbjct  260  GTVSAMCSKVMSQVSVETSRFVDKYDVTLDVCIPSVLSQSKVVSPQQVGETVDVCVEDET  319

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ++LHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+
Sbjct  320  VSYLNRRDVQRSLHARLVGVR-KWAVCS--NVLDYELLDVEIPTITVVGNLVKAGIPVLV  376

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  L+L T      W+ G+++GGW+Q +GN         
Sbjct  377  YSGDQDSVIPLTGSRTLVNRLAEELRLRTTVPYRVWFAGQQVGGWTQVYGNI--------  428

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P ++L LFKAF+ G P P
Sbjct  429  LSFATVRGASHEVPFSQPQRSLVLFKAFINGHPLP  463



>ref|XP_010929656.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 112/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C+ +   ++ E    +DK ++          S S         E  D C+ D  
Sbjct  257  GSLSPVCARVMGQVTRETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVPEHIDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ A+HA  TG    W+  S     +  L N  I  +  + +L+ S IPVL+
Sbjct  317  VNYLNRKDVQDAMHARLTGVP-KWSVCS--SVLEYELLNLEIPTISVVGSLVRSGIPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  LKL T      W++ K++GGW+Q +G+         
Sbjct  374  YSGDQDSVIPLTGSRTLVQRLAKELKLKTTVPYRVWFEDKQVGGWTQVYGDI--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            LTFAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  426  LTFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  462



>gb|ERN06205.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
Length=460

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 116/215 (54%), Gaps = 14/215 (7%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWVGE  685
            +S  CS +  ++S E    +DK ++            S + +    +E  D C+ D    
Sbjct  256  VSPICSRVMSLVSRETSKFVDKYDVTLDVCISSILMQSKALRPMQVSEPIDVCVEDETVN  315

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQ+ALHA  +G +  W+  S    + +   N  I  +  L  ++ S IPVL+YS
Sbjct  316  YLNRKDVQRALHARLSGDE-TWSVCSSMNYNRL---NLEIPTISLLGLVVKSGIPVLVYS  371

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN         L+
Sbjct  372  GDQDSVIPLTGSRTLVHGLAAKLHLNTTVPYRVWFEGEQVGGWTQVYGNI--------LS  423

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  424  FATIRGASHEAPFSQPQRSLGLFRAFLQGRPLPET  458



>gb|ACF83470.1| unknown [Zea mays]
Length=318

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 111/218 (51%), Gaps = 13/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G LS  C+ +   ++ E    +DK ++   V  S   S       H    +  D C+ D 
Sbjct  109  GSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILSPHEQVGQRIDVCVEDE  168

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G    W   S     +  L N  I  +  + +L+ S I VL
Sbjct  169  TVRYLNRRDVQAALHARLVGVD-KWAVCS--SVLEYELLNLQIPTISVVGSLVKSGIRVL  225

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  + L T      W++G+++GGW+Q +G        G
Sbjct  226  VYSGDQDSVIPLTGSRTLVQNLARDMGLKTTTPYRVWFEGQQVGGWTQVYGG-------G  278

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  279  ALSFATIRGASHEAPFSQPGRSLVLFRAFLQGQPLPET  316



>ref|XP_007159975.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31969.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=346

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 96/166 (58%), Gaps = 9/166 (5%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            E+ D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     D  + N     LP + 
Sbjct  187  ESIDVCVDDKVTNYLNRKDVQEALHAKLVGVR-KWDVCSNNSILDYDMLNLEKPTLPVVG  245

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ + + VLIYSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +
Sbjct  246  SLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVY  305

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            G+         L+FATVRG +H  P S P ++  LFK+FL+  P P
Sbjct  306  GSI--------LSFATVRGASHEAPFSQPERSFVLFKSFLEDRPLP  343



>ref|XP_010509871.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 95/166 (57%), Gaps = 11/166 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            ET D C+ D    Y+NR DVQKALHA   G +  W+  S     D  + +  +  +  + 
Sbjct  308  ETVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWSVCS--NVLDYEVLDVEVPTINIVG  364

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +
Sbjct  365  TLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVY  424

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            GN         L FATVRG AH VP S P++AL LFKAFL G P P
Sbjct  425  GNI--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGLPLP  462



>emb|CDY61693.1| BnaC05g51120D [Brassica napus]
Length=456

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 114/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  C+ +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  250  GSMSSICAKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  309

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
             +Y+NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+
Sbjct  310  VKYLNRRDVQEALHARLVGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVQAGVPVLV  366

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN         
Sbjct  367  YSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  418

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P ++L LFKAFL   P P
Sbjct  419  LSFATVRGASHEVPFSQPQRSLVLFKAFLDSHPLP  453



>ref|XP_006844530.2| PREDICTED: serine carboxypeptidase-like 45 [Amborella trichopoda]
Length=464

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 116/215 (54%), Gaps = 14/215 (7%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWVGE  685
            +S  CS +  ++S E    +DK ++            S + +    +E  D C+ D    
Sbjct  260  VSPICSRVMSLVSRETSKFVDKYDVTLDVCISSILMQSKALRPMQVSEPIDVCVEDETVN  319

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQ+ALHA  +G +  W+  S    + +   N  I  +  L  ++ S IPVL+YS
Sbjct  320  YLNRKDVQRALHARLSGDE-TWSVCSSMNYNRL---NLEIPTISLLGLVVKSGIPVLVYS  375

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN         L+
Sbjct  376  GDQDSVIPLTGSRTLVHGLAAKLHLNTTVPYRVWFEGEQVGGWTQVYGNI--------LS  427

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  428  FATIRGASHEAPFSQPQRSLGLFRAFLQGRPLPET  462



>ref|NP_564298.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 ref|NP_973926.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 sp|Q93Y09.1|SCP45_ARATH RecName: Full=Serine carboxypeptidase-like 45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL24336.1| serine carboxypeptidase II, putative [Arabidopsis thaliana]
 gb|AAP49525.1| At1g28110 [Arabidopsis thaliana]
 gb|AEE30918.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 gb|AEE30919.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
Length=461

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 114/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  255  GSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  314

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+
Sbjct  315  VNYLNRRDVQEALHARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVKAGVPVLV  371

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA +L L T      W+ G+++GGW+Q +GN         
Sbjct  372  YSGDQDSVIPLTGSRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  423

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  424  LSFATVRGASHEVPFSQPERSLVLFKAFLDGHPLP  458



>gb|EAY93940.1| hypothetical protein OsI_15713 [Oryza sativa Indica Group]
Length=470

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 114/220 (52%), Gaps = 20/220 (9%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqQHYLATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++            S S      +   D C+ D  
Sbjct  260  GSLSSACDTVMTQVARETSRFVDKYDVTLDVCVSSVLMQSKSLAPQRGSRELDVCVEDET  319

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLS---ALLMSDI  523
              Y+NR DVQ+A+HA   G    W   S       +L    +D+ +PT++    L+ S +
Sbjct  320  MGYLNRKDVQEAMHARLEGGVPKWTVCSS------VLEYKQLDLQIPTINIVGGLVKSGV  373

Query  522  PVLIYSGDQDLRIPVSHTREVATVLAVRLKL-TTLEMNGPWYDGKEIGGWSQTFGNSGRC  346
            PVL+YSGDQD  IP++ +R V   LA RL+L TT      W++G+++GGW+Q+FG     
Sbjct  374  PVLVYSGDQDSVIPLTGSRTVVQRLAGRLRLGTTAAGYRVWFEGRQVGGWTQSFGG----  429

Query  345  NKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
               G L+FATVRG +H  P S P ++L LF AFL G P P
Sbjct  430  ---GALSFATVRGASHEAPFSQPERSLVLFAAFLAGRPLP  466



>emb|CBI32794.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 111/217 (51%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G LS  CS +   +S E+G  +D  ++    C     S S        TE  D C+ D  
Sbjct  244  GSLSPACSGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSERLNQPRGTEKIDVCVEDET  303

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
             +Y+NR DVQKALHA+  G    W+  S  +       N  I  +  + A+L S I VL+
Sbjct  304  IKYLNRKDVQKALHAHLKGVSR-WSICS--EVLKYEYRNLEIPTIHVVGAVLKSGIRVLV  360

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  +P++ TR +   LA  L L T      W+ G+++GGW+Q +G+         
Sbjct  361  YSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYGD--------K  412

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FAT+RG +H  P S P ++L LF  FL+G P P  
Sbjct  413  LSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLPEA  449



>tpg|DAA38059.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=466

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 113/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVGE  685
            G LS  C  +   ++ E    +DK ++    C SS +  SQQ    +   D C+ D    
Sbjct  263  GSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQQ---GSRELDVCVEDETMR  319

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQ+A+HA   G Q  W   S     +    +  I  + T+ AL+ + IP L+YS
Sbjct  320  YLNRKDVQQAMHARLDGVQ-RWTVCS--SVLEYKQLDLQIPTVNTVGALVKAGIPALVYS  376

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA RL+L        W+ GK++GGW+Q FG        G L+
Sbjct  377  GDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFGG-------GALS  429

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            FATVRG +H  P S P ++L LF+AFL G   P +
Sbjct  430  FATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  464



>ref|XP_002280796.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinifera]
 emb|CBI15743.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 111/213 (52%), Gaps = 13/213 (6%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWVGE  685
            +S  CS +   +S E    +DK ++          S S         ET D C+ D    
Sbjct  258  VSSVCSRVMAQVSRETSKFVDKYDVTLDVCLSSVLSQSKVISPQQVAETIDVCIDDKTVN  317

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQKALHA   G +   ++T      D  L N  I  +  + +L+ + IPVL+YS
Sbjct  318  YLNRKDVQKALHARLVGIR---SWTVCSDILDYELLNLEIPTISIVGSLIKAGIPVLVYS  374

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA  L L T      W++GK++GGW++ +GN         L+
Sbjct  375  GDQDSVIPLTGSRTLVHNLAKELGLNTTVPYRVWFEGKQVGGWTRVYGNI--------LS  426

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            FAT+RG +H  P S P ++L LFK+FL+  P P
Sbjct  427  FATIRGASHEAPFSQPERSLVLFKSFLEARPLP  459



>gb|ACF83756.1| unknown [Zea mays]
Length=324

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 111/218 (51%), Gaps = 13/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G LS  C+ +   ++ E    +DK ++   V  S   S       H    +  D C+ D 
Sbjct  115  GSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILSPHEQVGQRIDVCVEDE  174

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G    W   S     +  L N  I  +  + +L+ S I VL
Sbjct  175  TVRYLNRRDVQAALHARLVGVD-KWAVCS--SVLEYELLNLQIPTISVVGSLVKSGIRVL  231

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  + L T      W++G+++GGW+Q +G        G
Sbjct  232  VYSGDQDSVIPLTGSRTLVQNLARDMGLKTTTPYRVWFEGQQVGGWTQVYGG-------G  284

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  285  ALSFATIRGASHEAPFSQPGRSLVLFRAFLQGQPLPET  322



>ref|XP_007224935.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
 gb|EMJ26134.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
Length=438

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 113/215 (53%), Gaps = 29/215 (13%)
 Frame = -1

Query  870  LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWV  691
            ++G  S+ CSD+   +S+E+ + +DK                  +Y  T+  D C+ +  
Sbjct  250  IAGSPSDACSDVITQVSQELSNYVDK------------------YYQLTDKIDACVEEET  291

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G    W+  S     D  + +  I  +P + +L+ S I V++
Sbjct  292  VTYLNRKDVQKALHAKLVGVS-NWSLCSQVLQYD--MRDMEIPTIPIVGSLVKSGIRVMV  348

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  +P   +R +   LA +L L +      W++GK++GGW+Q + +         
Sbjct  349  YSGDQDSVVPFFGSRSLINGLATQLGLKSTVPYRAWFEGKQVGGWTQVYDDI--------  400

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FA +RG +H  PS+ P ++L LFK+FL G P P
Sbjct  401  LSFAIIRGASHTAPSTQPKRSLALFKSFLGGKPLP  435



>ref|XP_002893504.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69763.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 115/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  256  GSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  315

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+
Sbjct  316  VNYLNRRDVQEALHARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVKAGVPVLV  372

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA +L L T      W+ G+++GGW+Q +GN         
Sbjct  373  YSGDQDSVIPLTGSRILVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  424

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P+++L LFKAFL G P P
Sbjct  425  LSFATVRGASHEVPFSQPARSLVLFKAFLDGHPLP  459



>ref|XP_010653629.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=461

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 111/217 (51%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G LS  CS +   +S E+G  +D  ++    C     S S        TE  D C+ D  
Sbjct  252  GSLSPACSGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSERLNQPRGTEKIDVCVEDET  311

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
             +Y+NR DVQKALHA+  G    W+  S  +       N  I  +  + A+L S I VL+
Sbjct  312  IKYLNRKDVQKALHAHLKGVSR-WSICS--EVLKYEYRNLEIPTIHVVGAVLKSGIRVLV  368

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  +P++ TR +   LA  L L T      W+ G+++GGW+Q +G+         
Sbjct  369  YSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYGD--------K  420

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FAT+RG +H  P S P ++L LF  FL+G P P  
Sbjct  421  LSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLPEA  457



>ref|XP_004298533.1| PREDICTED: serine carboxypeptidase-like 45 [Fragaria vesca subsp. 
vesca]
Length=466

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 114/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWVGE  685
            +S  CS +  ++S E    +DK ++          S S +      TE  D C+ D +  
Sbjct  262  VSPVCSRVMSLVSRETSKFVDKYDVTLDVCISSVLSQSKAISPNQMTERIDVCVEDKIVN  321

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  505
            Y+NR DVQ ALHA   G +  W+  S     D  + +  I  +  + +++ + IPVL+YS
Sbjct  322  YLNRKDVQNALHAKLVGVR-RWDVCS--NILDYQMLDLEIPTISLVGSIVKAGIPVLVYS  378

Query  504  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLT  325
            GDQD  IP++ +R +   LA  L L T      W+ GK++GGW+Q +GN         L+
Sbjct  379  GDQDSVIPLTGSRTLVDRLARELGLNTTVPYRVWFQGKQVGGWTQVYGNI--------LS  430

Query  324  FATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            FAT+RG +H  P S P ++L LFK+FL+G P P+ 
Sbjct  431  FATIRGASHEAPFSQPERSLVLFKSFLQGRPLPQV  465



>ref|XP_006585840.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=429

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/217 (34%), Positives = 113/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            +G +S  CS +   ++ E    +DK ++          S +        TET D C+ D 
Sbjct  222  NGAVSPICSSVMSQVTTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDE  281

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ A+HA+  G Q    +++     D  L +  I  +  +  L+   IPVL
Sbjct  282  TVNYLNRKDVQSAMHAHLVGVQ---RWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVL  338

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++ +++GGW+Q +GN        
Sbjct  339  VYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI-------  391

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
             L+FAT+RG +H  P S P ++L LFK+FL+G P P+
Sbjct  392  -LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLPQ  427



>ref|XP_010249188.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=494

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 112/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S+E    +DK ++          S S        TE  D C+ D  
Sbjct  288  GSVSSVCSKVMNQVSKETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTERIDVCVEDET  347

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G +  W   S     +  L N  I  +  + +L+ + IPVL+
Sbjct  348  VNYLNRRDVQKALHARLVGVRR-WAVCS--NILNYELLNLEIPTISIVGSLVKAGIPVLV  404

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +GN         
Sbjct  405  YSGDQDSVIPLTGSRTLVHGLAKDLGLNTTVPYRVWFAGQQVGGWTQVYGNV--------  456

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FAT+RG +H  P S P ++L LFK+FL+G P P  
Sbjct  457  LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLPEV  493



>ref|XP_003531913.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/217 (34%), Positives = 113/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            +G +S  CS +   ++ E    +DK ++          S +        TET D C+ D 
Sbjct  254  NGAVSPICSSVMSQVTTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDE  313

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ A+HA+  G Q    +++     D  L +  I  +  +  L+   IPVL
Sbjct  314  TVNYLNRKDVQSAMHAHLVGVQ---RWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVL  370

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++ +++GGW+Q +GN        
Sbjct  371  VYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI-------  423

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
             L+FAT+RG +H  P S P ++L LFK+FL+G P P+
Sbjct  424  -LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLPQ  459



>ref|XP_011088288.1| PREDICTED: serine carboxypeptidase II-3-like [Sesamum indicum]
Length=483

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 93/166 (56%), Gaps = 15/166 (9%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPC  ++V  Y+NRPDVQKALHAN TG   PW+  +   T  +  ++    ILPT+  L+
Sbjct  333  DPCSSNYVFTYLNRPDVQKALHANVTGITGPWD--ACNNTVFLNWNDRPDTILPTIKELM  390

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               I V IYSGD D R+PV+ TR     L   +K        PWY+  E+GG++  + N 
Sbjct  391  AGGIRVWIYSGDTDKRVPVTSTRYSLEKLGTPVKTPWF----PWYNQGEVGGYAVEYQN-  445

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTN  217
                    +TF ++RG  HFVPS  P +AL +F +FL G  PPR N
Sbjct  446  --------VTFVSIRGAGHFVPSYQPQRALVVFSSFLDGKLPPRRN  483



>gb|KHN47533.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/217 (34%), Positives = 113/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            +G +S  CS +   ++ E    +DK ++          S +        TET D C+ D 
Sbjct  247  NGAVSPICSSVMSQVTTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDE  306

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ A+HA+  G Q    +++     D  L +  I  +  +  L+   IPVL
Sbjct  307  TVNYLNRKDVQSAMHAHLVGVQ---RWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVL  363

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++ +++GGW+Q +GN        
Sbjct  364  VYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI-------  416

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
             L+FAT+RG +H  P S P ++L LFK+FL+G P P+
Sbjct  417  -LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLPQ  452



>ref|XP_006662960.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=470

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 114/218 (52%), Gaps = 14/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G L+  C+ +   ++ E    +DK ++   V  S   S       H  A +  D C+ D 
Sbjct  262  GSLTPLCTRVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILTPHQQAGQRIDVCVEDE  321

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ+ALHA   G +   N+       +  L N  I  +  + +L+ S I VL
Sbjct  322  TVNYLNRKDVQEALHAKLIGVK---NWAVCSSVLEYELLNLQIPTINIVGSLVKSGIRVL  378

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +G+        
Sbjct  379  VYSGDQDSVIPLTGSRTLVQNLARNLGLKTTVPYRVWFEGQQVGGWTQVYGDM-------  431

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  432  -LSFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  468



>ref|XP_004238587.1| PREDICTED: putative serine carboxypeptidase-like 23 [Solanum 
lycopersicum]
Length=483

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 93/169 (55%), Gaps = 15/169 (9%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            +T   DPCL  ++  Y N P+VQKA+HAN T   YPW   S   T ++   +  + +LP 
Sbjct  329  STSDVDPCLPSYIQSYFNIPEVQKAMHANVTNLPYPWE--SCNNTLNLNWKDRPLSVLPL  386

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            L  L+ S + + +YSGD D+ +PV+ TR     L + +K +      PWY   E+GG+ +
Sbjct  387  LHQLMKSGLRIWLYSGDMDVVVPVTDTRYAIKKLNLSVKTSWY----PWYLQGEVGGYVE  442

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
             + N         LTF T+RG  HFVP+  P++AL  F  FL G PPP+
Sbjct  443  EYEN---------LTFVTIRGAGHFVPTYQPNRALAFFSQFLSGKPPPK  482



>ref|XP_002990798.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ08071.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=467

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 93/165 (56%), Gaps = 11/165 (7%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            D C+      Y N P+VQKALHANTTG  YPW         D+  ++  +DI+P L  LL
Sbjct  311  DVCMSYERYYYFNLPEVQKALHANTTGLPYPWTNCDGPVQYDI--NDMRLDIVPVLRDLL  368

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             + + V ++SGD+D  +P   TR     LA  LKL T      W+   ++GGW+++F   
Sbjct  369  KNGLRVWVFSGDEDAVVPFLGTRVNVNSLAQELKLRTTASYKAWFLRTQVGGWAESF---  425

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                  GNLTFATVRG AH VP + P++AL LF+ F+ G P P +
Sbjct  426  ------GNLTFATVRGAAHMVPLAQPARALLLFQKFISGQPLPAS  464



>ref|XP_002974500.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ24722.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=471

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 93/165 (56%), Gaps = 11/165 (7%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            D C+      Y N P+VQKALHANTTG  YPW         D+  ++  +DI+P L  LL
Sbjct  315  DVCMSYERYYYFNLPEVQKALHANTTGLPYPWTNCDGPVQYDI--NDMRLDIVPVLRDLL  372

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             + + V ++SGD+D  +P   TR     LA  LKL T      W+   ++GGW+++F   
Sbjct  373  KNGLRVWVFSGDEDAVVPFLGTRVNVNSLAQELKLRTTASYKAWFLRTQVGGWAESF---  429

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                  GNLTFATVRG AH VP + P++AL LF+ F+ G P P +
Sbjct  430  ------GNLTFATVRGAAHMVPLAQPARALLLFQKFISGQPLPAS  468



>gb|KHN08898.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=453

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 110/220 (50%), Gaps = 21/220 (10%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            +G L   C     +L+ EI + +DK ++         +  +        T+  D C+ D 
Sbjct  246  NGNLRGVCVKANKLLNTEISNFIDKYDVTLDVCLSSVNQQAYVLNQLQETQKIDVCIGDK  305

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAIDILPTLSALLMSD  526
               Y+NR  VQKALHAN  G        +   T   +LH    N  I  +P L +L+ S 
Sbjct  306  TTTYLNRKQVQKALHANLVG-------VTKWSTCSSVLHYDYQNLEIPTIPILGSLVKSG  358

Query  525  IPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRC  346
            I VL+YSGDQD  IP+  +R +   LA  + L T      W++GK++ GW++ +GN    
Sbjct  359  IKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLDTTVAYRAWFEGKQVAGWTKVYGNI---  415

Query  345  NKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                 L++AT+RG +H  P S P ++L L KAFL+G P P
Sbjct  416  -----LSYATIRGASHEAPFSQPQRSLLLLKAFLEGKPLP  450



>ref|XP_009404114.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 111/217 (51%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++          S S        TE  D C+ D  
Sbjct  257  GSLSSVCQRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQQVTERVDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHA+  G    W   S     +  L +  +  +  + +L+ S IPVL+
Sbjct  317  VRYLNRRDVQSALHAHLDGVT-KWTVCS--SVLEYELLDLEVPTISVVGSLVKSGIPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +G+         
Sbjct  374  YSGDQDSVIPLTGSRTLVQRLANELGLKTTVPYRVWFEGEQVGGWTQVYGDV--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FATVRG +H  P S P ++L LF+AFL+G P P T
Sbjct  426  LSFATVRGASHEAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_009355265.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 115/216 (53%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEI-GHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVG  688
            G LS  C ++      E+ GH +++ ++    C SS  + S      T   D C+ D + 
Sbjct  257  GPLSPACDEVANQFEREVPGHLINQYDVTLDVCLSSVEAQSS-QLRKTVKIDVCIGDEIV  315

Query  687  EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  508
             Y+NRPD+Q+ALHA  T W       S G   +  + N  I +LP L  L+ S I VLIY
Sbjct  316  TYLNRPDLQEALHARLTNW----TTCSNGGVLEYDMKNLEIPMLPVLGDLVKSGIRVLIY  371

Query  507  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNL  328
            SGDQD  IP++ TR + + LA  L L T      W++ K++ GW+Q + ++        L
Sbjct  372  SGDQDSVIPLTSTRTLVSGLAKDLGLQTNVPYRVWFEEKQVAGWTQVYSDA--------L  423

Query  327  TFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            ++AT+RG  H  P S P ++L LF +FL+G P P+ 
Sbjct  424  SYATIRGAGHEAPISQPERSLLLFTSFLRGKPLPKA  459



>ref|XP_010469459.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=466

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 94/166 (57%), Gaps = 11/166 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            E  D C+ D    Y+NR DVQKALHA   G +   N+       D  + +  +  +  + 
Sbjct  309  EAVDVCVEDETVNYLNRRDVQKALHARLVGTR---NWAVCSNVLDYEVLDVEVPTINIVG  365

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +
Sbjct  366  SLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVY  425

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            GN         L FATVRG AH VP S P++AL LFKAF+ G P P
Sbjct  426  GNI--------LAFATVRGAAHEVPFSQPARALVLFKAFMGGRPLP  463



>ref|XP_009109757.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
Length=460

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 112/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   ++ E    +DK ++          S S         E+ D C+ D  
Sbjct  254  GSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSKVVSPNQVGESVDVCVEDET  313

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G +  W   S     D  + +     +  + +L+ + +PVL+
Sbjct  314  VNYLNRRDVQEALHARLVGVR-EWTVCS--NVLDYQMLDVEKPTINIVGSLVEAGVPVLV  370

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN         
Sbjct  371  YSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  422

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG AH VP S P ++L LFKAFL G P P
Sbjct  423  LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  457



>ref|XP_008667417.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA38060.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=472

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 110/220 (50%), Gaps = 17/220 (8%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++            S        +   D C+ D  
Sbjct  263  GSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSRELDVCVEDET  322

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH---NFAIDILPTLSALLMSDIP  520
              Y+NR DVQ+A+HA   G Q  W   S    S V+ +   +  I  + T+ AL+ + IP
Sbjct  323  MRYLNRKDVQQAMHARLDGVQ-RWTVCS----SSVLEYKQLDLQIPTVNTVGALVKAGIP  377

Query  519  VLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNK  340
             L+YSGDQD  IP++ +R +   LA RL+L        W+ GK++GGW+Q FG       
Sbjct  378  ALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFGG------  431

Query  339  VGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             G L+FATVRG +H  P S P ++L LF+AFL G   P +
Sbjct  432  -GALSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  470



>ref|XP_009368797.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=467

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 97/167 (58%), Gaps = 11/167 (7%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
            TE  D C+ D    Y+NR DVQKALHA   G +  W+  S     +  + N  +  +  +
Sbjct  309  TERIDVCVEDKTVNYLNRKDVQKALHARLVGVR-RWDVCS--SILEYQMLNLEVPTISLV  365

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
             +L+   I VL+YSGDQD  IP++ +R + + LA  L+L T      W++GK++GGW+Q 
Sbjct  366  GSLVKQGIQVLVYSGDQDSVIPLTGSRRLVSRLARELELNTTVPYRVWFEGKQVGGWTQV  425

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +GN         L+FAT+RG +H  P S P ++L LFK+FL+G P P
Sbjct  426  YGNI--------LSFATIRGASHEAPFSQPERSLRLFKSFLEGRPLP  464



>gb|KFK44682.1| hypothetical protein AALP_AA1G289900 [Arabis alpina]
Length=463

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 112/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  257  GSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHA   G +  W   S     D  L +     +  + +L+ + +PVL+
Sbjct  317  VSYLNRRDVQAALHARLIGVR-EWTVCS--NVLDYELLDVEKPTINIVGSLVKAGVPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN         
Sbjct  374  YSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  426  LSFATVRGASHEVPFSQPERSLVLFKAFLDGHPLP  460



>emb|CDX90124.1| BnaA08g18600D [Brassica napus]
Length=460

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 112/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   ++ E    +DK ++          S S         E+ D C+ D  
Sbjct  254  GSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSKVVSPNQVGESVDVCVEDET  313

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G +  W   S     D  + +     +  + +L+ + +PVL+
Sbjct  314  VNYLNRRDVQEALHARLVGVR-EWTVCS--NVLDYQMLDVEKPTINIVGSLVEAGVPVLV  370

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN         
Sbjct  371  YSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  422

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG AH VP S P ++L LFKAFL G P P
Sbjct  423  LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  457



>ref|XP_003554110.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 110/220 (50%), Gaps = 21/220 (10%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            +G L   C     +L+ EI + +DK ++         +  +        T+  D C+ D 
Sbjct  255  NGNLRGVCVKANKLLNTEISNFIDKYDVTLDVCLSSVNQQAYVLNQLQETQKIDVCIGDK  314

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAIDILPTLSALLMSD  526
               Y+NR  VQKALHAN  G        +   T   +LH    N  I  +P L +L+ S 
Sbjct  315  TTTYLNRKQVQKALHANLVG-------VTKWSTCSSVLHYDYQNLEIPTIPILGSLVKSG  367

Query  525  IPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRC  346
            I VL+YSGDQD  IP+  +R +   LA  + L T      W++GK++ GW++ +GN    
Sbjct  368  IKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLDTTVAYRAWFEGKQVAGWTKVYGNI---  424

Query  345  NKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                 L++AT+RG +H  P S P ++L L KAFL+G P P
Sbjct  425  -----LSYATIRGASHEAPFSQPQRSLLLLKAFLEGKPLP  459



>ref|XP_002446348.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
 gb|EES10676.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
Length=474

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 120/224 (54%), Gaps = 24/224 (11%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETA----DPCLRD  697
            G LS  C  +   ++ E    +DK ++    C SS +  S    LA +      D C+ D
Sbjct  264  GSLSTACDRVMSQVTRETSRFVDKYDVTLDVCISSVLMQS--QILAPQQGSRELDVCVED  321

Query  696  WVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLS---ALLMS  529
                Y+NR DVQ+A+HA  T     W   S       +L    +D+ +PT++   AL+ S
Sbjct  322  ETMNYLNRKDVQQAMHARLTDGVQRWTVCSS------VLEYKQLDLQIPTVNIVGALVKS  375

Query  528  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKL-TTLEMNGPWYDGKEIGGWSQTFGNSG  352
             IPVL+YSGDQD  IP++ +R + + LA RL+L TT      W+ GK++GGW+Q FG   
Sbjct  376  GIPVLVYSGDQDSVIPLTGSRTLVSRLAGRLRLNTTAAPYRAWFQGKQVGGWTQVFGG--  433

Query  351  RCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                 G L+FATVRG +H  P S P ++L LF+AFL G   P +
Sbjct  434  -----GALSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  472



>gb|KHN09723.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 99/168 (59%), Gaps = 11/168 (7%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            A E+ D C+ D V  Y+NR DVQ+ALHA   G +  W   S     D++  N  +  L  
Sbjct  298  ANESIDVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWEVCSNILDYDML--NLEVPTLLV  354

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ + + VLIYSGDQD  IP++ +R +   LA +L L +      W++G+++GGW+Q
Sbjct  355  VGSLIKAGVKVLIYSGDQDSVIPLTGSRTLVQKLARKLGLNSTVPYRVWFEGQQVGGWTQ  414

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             +GN         L+FATVRG +H  P S P ++L LFK+FL+G P P
Sbjct  415  GYGNI--------LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  454



>ref|NP_001150027.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG37565.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=471

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 108/217 (50%), Gaps = 12/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++            S        +   D C+ D  
Sbjct  263  GSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSRELDVCVEDET  322

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+A+HA   G Q  W   S     +    +  I  + T+ AL+ + IP L+
Sbjct  323  MRYLNRKDVQQAMHARLDGVQ-RWTVCS--SVLEYKQLDLQIPTVNTVGALVKAGIPALV  379

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA RL+L +      W+ GK++GGW+Q FG        G 
Sbjct  380  YSGDQDSVIPLTGSRTLVGRLAARLRLNSTAPYRAWFQGKQVGGWTQVFGG-------GA  432

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FATVRG +H  P S P ++L LF+AFL G   P +
Sbjct  433  LSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  469



>ref|XP_011020860.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 110/216 (51%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +   ++ E    +DK ++   V  S   S            +  D C+ D 
Sbjct  256  GSVSPQCSRVMNQVTRETSRFVDKYDVTLDVCISSALSQSKILSPQQQLGDNIDVCVEDE  315

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NRPDVQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL
Sbjct  316  TVNYLNRPDVQKALHARLVGVR-RWAVCS--NILDYELLDLEIPTISIVGRLIKAGIPVL  372

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +GN        
Sbjct  373  VYSGDQDSVIPLTGSRTLVHGLAEELGLQTTVPYRVWFGGQQVGGWTQVYGNI-------  425

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG +H  P S P ++L LFKAFL G P P
Sbjct  426  -LSFATIRGASHEAPFSQPERSLVLFKAFLGGQPLP  460



>ref|XP_010413849.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 94/166 (57%), Gaps = 11/166 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            E  D C+ D    Y+NR DVQKALHA   G +  W+  S     D  + +  +  +  + 
Sbjct  308  EAVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWSVCS--NVLDYEVLDVEVPTINIVG  364

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +
Sbjct  365  RLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLADELGLRTTVPYRVWFAGQQVGGWTQVY  424

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            GN         L FATVRG AH VP S P++AL LFKAFL G P P
Sbjct  425  GNI--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  462



>ref|XP_002304645.2| hypothetical protein POPTR_0003s16250g [Populus trichocarpa]
 gb|EEE79624.2| hypothetical protein POPTR_0003s16250g [Populus trichocarpa]
Length=343

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 110/216 (51%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +   ++ E    +DK ++   V  S   S            +  D C+ D 
Sbjct  136  GSVSPQCSRVMSQVTRETSRFVDKYDVTLDVCISSALSQSKILSPQQQLGDNIDVCVEDE  195

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NRPDVQ ALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL
Sbjct  196  TVNYLNRPDVQMALHARLVGVR-RWAVCS--NILDYELLDLEIPTITIVGRLIKAGIPVL  252

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +GN        
Sbjct  253  VYSGDQDSVIPLTGSRTLVHGLAEELGLQTTVPYRVWFEGQQVGGWTQVYGNI-------  305

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG +H  P S P ++L LFKAFL G P P
Sbjct  306  -LSFATIRGASHEAPFSQPERSLVLFKAFLGGQPLP  340



>ref|XP_009415855.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 112/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C+ +   ++ E    +DK ++          S S         E  D C+ D  
Sbjct  257  GSLSPVCARVMSQVTRETSRFVDKYDVTLDVCISSVLSQSLVLSPQQVPENIDVCIEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHA  TG    W   S     +++  N  I  +  + +LL + IPVL+
Sbjct  317  VNYLNRKDVQDALHARLTGVT-KWTVCSSVLQYELL--NLEIPTITLVGSLLKARIPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  + L T      W++GK++GGW+Q +G+         
Sbjct  374  YSGDQDSVIPLTGSRTLVQKLANEMGLKTTVPYRVWFEGKQVGGWTQVYGDI--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FAT+RG +H  P S P ++L LF++FL+G P P T
Sbjct  426  LSFATIRGASHEAPFSQPERSLVLFRSFLQGRPLPET  462



>ref|XP_011086871.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=466

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 110/215 (51%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  CS +  +++ E    +DK ++          S S        TE  D C+ D  
Sbjct  260  GSLSPICSKVMSLVTTETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDET  319

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DV+ ALHA   G    W   S     D  L +  I  +  +  ++ + IPVL+
Sbjct  320  VNYLNRRDVRNALHARLVGVN-RWLVCS--NILDYELLDIEIPTINVVGRIIEAGIPVLV  376

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R++   LA  LKL T      W+ G ++GGW+Q +GN         
Sbjct  377  YSGDQDSVIPLTGSRKLVHRLARELKLRTTTPYRVWFAGMQVGGWTQVYGNI--------  428

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H  P S P ++L LFKAFL+G P P
Sbjct  429  LSFATVRGASHEAPFSQPERSLVLFKAFLEGRPLP  463



>ref|XP_007159978.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31972.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=468

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 96/166 (58%), Gaps = 9/166 (5%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            E+ D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     D  + N     LP + 
Sbjct  309  ESIDVCVDDKVTNYLNRKDVQEALHAKLVGVR-KWDVCSNNSILDYDMLNLEKPTLPVVG  367

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ + + VLIYSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +
Sbjct  368  SLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVY  427

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            G+         L+FATVRG +H  P S P ++  LFK+FL+  P P
Sbjct  428  GSI--------LSFATVRGASHEAPFSQPERSFVLFKSFLEDRPLP  465



>ref|XP_011088747.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 24-like 
[Sesamum indicum]
Length=502

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 95/178 (53%), Gaps = 25/178 (14%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPW---------NFTSPGKTSDVI---LHNF  571
            DPC  ++V  Y+N P+VQKALHAN TG   PW         N  +P + SD+I    H+ 
Sbjct  338  DPCSDNYVFTYLNTPEVQKALHANVTGIPGPWDTLXSTTLKNSCTPSQCSDIISLFWHDM  397

Query  570  AIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGK  391
               +LP +  L+ S I V IYSGD D R+PV+ TR   + L   +K        PWY   
Sbjct  398  PDTVLPVIKELMASGISVWIYSGDTDGRVPVTTTRYSMSKLGTPVKTPWY----PWYYEG  453

Query  390  EIGGWSQTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTN  217
            E+GG++  + N         +TF T+RG  HFVPS  P +AL  F +FL+G  PP  N
Sbjct  454  EVGGYAVEYQN---------VTFVTIRGAGHFVPSYQPERALAFFMSFLEGKLPPGQN  502



>ref|XP_008667418.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF78622.1| unknown [Zea mays]
 gb|ACF84275.1| unknown [Zea mays]
 tpg|DAA38061.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=471

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 107/217 (49%), Gaps = 12/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++            S        +   D C+ D  
Sbjct  263  GSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSRELDVCVEDET  322

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+A+HA   G Q  W   S     +    +  I  + T+ AL+ + IP L+
Sbjct  323  MRYLNRKDVQQAMHARLDGVQ-RWTVCS--SVLEYKQLDLQIPTVNTVGALVKAGIPALV  379

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA RL+L        W+ GK++GGW+Q FG        G 
Sbjct  380  YSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFGG-------GA  432

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L+FATVRG +H  P S P ++L LF+AFL G   P +
Sbjct  433  LSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  469



>ref|XP_002307963.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
 gb|EEE91486.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
Length=459

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 111/221 (50%), Gaps = 21/221 (10%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            SG LS  CS +   +S E+   +D  ++          S S   +    T T D C+ D 
Sbjct  250  SGSLSLPCSAVNSQVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQMEYTGTIDVCVEDE  309

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDI  523
              +Y+NR DV +ALHA   G    W   S     DV+   + N  I  +P L+ LL S I
Sbjct  310  TIKYLNRKDVLEALHAQLVGVD-QWTVCS-----DVVKYEMENLEISTVPLLAKLLKSGI  363

Query  522  PVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCN  343
             V +YSGDQD  IP++ TR V   LA  L L T      W+ GK++ GW+Q +GN     
Sbjct  364  RVHVYSGDQDSVIPLTGTRTVVNGLAKELGLNTTVPYRTWFQGKQVAGWTQVYGNI----  419

Query  342  KVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGS--PPP  226
                L+FAT+RG +H  P S P ++  LF AFL+G   PPP
Sbjct  420  ----LSFATIRGASHEAPFSQPERSFVLFNAFLEGKQLPPP  456



>ref|XP_002512656.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF50108.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 113/218 (52%), Gaps = 15/218 (7%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +   +S E    +DK ++   V  S   S       H +A +  D C+ D 
Sbjct  252  GSVSPLCSRVMGQVSRETSKFVDKYDVTLDVCISSVLSQSKILSPHVIA-DNVDVCVEDE  310

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G  + W   S     D  L +  I  +  +  L+ + +PVL
Sbjct  311  TVNYLNRLDVQMALHARLVG-VHQWTVCS--SILDYELLDLEIPTISIVGKLIEAGVPVL  367

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +GN        
Sbjct  368  VYSGDQDSVIPLTGSRTLVHGLAEELGLKTTVPYRVWFEGQQVGGWTQVYGNI-------  420

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LFKAFL+G P P  
Sbjct  421  -LSFATIRGASHEAPFSQPERSLVLFKAFLEGQPLPEA  457



>ref|NP_001151474.1| LOC100285107 precursor [Zea mays]
 gb|ACG42988.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=480

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 111/218 (51%), Gaps = 13/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G LS  C+ +   ++ E    +DK ++   V  S   S       H    +  D C+ D 
Sbjct  271  GSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILSPHEQVGQRIDVCVEDE  330

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G    W   S     +  L N  I  +  + +L+ S I VL
Sbjct  331  TVRYLNRRDVQAALHARLVGVD-KWAVCS--SVLEYELLNLQIPTINVVGSLVKSGIRVL  387

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  + L T      W++G+++GGW+Q +G        G
Sbjct  388  VYSGDQDSVIPLTGSRTLVQNLARDMGLKTTTPYRVWFEGQQVGGWTQVYGG-------G  440

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  441  ALSFATIRGASHEAPFSQPGRSLVLFRAFLQGQPLPET  478



>ref|XP_003528093.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=470

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 98/168 (58%), Gaps = 11/168 (7%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            A E+ D C+ D V  Y+NR DVQ+ALHA   G +  W   S     D  + N  +  L  
Sbjct  311  ANESIDVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWEVCS--NILDYDMLNLEVPTLLV  367

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ + + VLIYSGDQD  IP++ +R +   LA +L L +      W++G+++GGW+Q
Sbjct  368  VGSLIKAGVKVLIYSGDQDSVIPLTGSRTLVQKLARKLGLNSTVPYRVWFEGQQVGGWTQ  427

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             +GN         L+FATVRG +H  P S P ++L LFK+FL+G P P
Sbjct  428  GYGNI--------LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  467



>gb|EYU21824.1| hypothetical protein MIMGU_mgv1a006099mg [Erythranthe guttata]
Length=457

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 95/167 (57%), Gaps = 11/167 (7%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
            +E  D C+ D + +Y+NR DVQ ALHA   G +  W+  S     D  + +  I  +  +
Sbjct  299  SERIDVCVEDEITKYLNRRDVQMALHARLVGVR-KWDVCS--NILDYDMLDLEIPTISII  355

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
             +L+   IPVLIYSGDQD  IP++ TR +   LA +L L T      W++G+++GGW+Q 
Sbjct  356  GSLVKEGIPVLIYSGDQDSVIPLTGTRTLVHKLAKQLGLNTTVTYRVWFEGQQVGGWTQV  415

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +GN         L+F TVRG +H  P S P ++  LFK+FL G P P
Sbjct  416  YGNI--------LSFGTVRGASHEAPFSQPERSFVLFKSFLSGKPLP  454



>ref|XP_006589008.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=464

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 113/222 (51%), Gaps = 22/222 (10%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATE-----TADPCLR  700
            G L+  CS +  ++S E+   +D  ++    C SS+   +      T+       D C+ 
Sbjct  254  GTLTPICSGVNRLVSTEVSRYIDTYDVTLDVCLSSADQQAYVLNQLTQLQEGAKIDVCVE  313

Query  699  DWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMS  529
            D    Y+NR DVQ+ALHA   G       TS    SDV+   + N  I  +  L AL  S
Sbjct  314  DETIAYLNRKDVQEALHAKLVG------ITSWSTCSDVLKYDMQNLEIPTISILGALAKS  367

Query  528  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGR  349
             I VL+YSGDQD  IP++ TR +   LA    L T      W++G+++ GW+Q +G+   
Sbjct  368  GIRVLVYSGDQDSVIPLTGTRSLVNGLAKDFGLNTTVSYRAWFEGRQVAGWTQVYGDI--  425

Query  348  CNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                  L+FAT+RG AH  P S P ++L L KAFL+G P P 
Sbjct  426  ------LSFATIRGAAHEAPFSQPERSLVLLKAFLEGKPLPE  461



>gb|KCW64995.1| hypothetical protein EUGRSUZ_G02537, partial [Eucalyptus grandis]
Length=477

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 92/177 (52%), Gaps = 41/177 (23%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTS-PGKTSDVILHNFAIDILPTLSAL  538
            DPCL D++  Y+N P VQKALHAN T     WNF S P    DV   +  IDI+P LSAL
Sbjct  303  DPCLGDFIFSYLNNPQVQKALHANITKLPSVWNFCSGPLSYHDV---DIGIDIIPLLSAL  359

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDG------------  394
            +   + VL++SGDQD ++P+  TR +A ++A  LK T+L    PWYD             
Sbjct  360  IEKHLRVLLFSGDQDSKVPLMQTRMIANMIAQDLKFTSLGKYAPWYDKMQTHHGAKEREC  419

Query  393  -------------------------KEIGGWSQTFGNSGRCNKVGNLTFATVRGGAH  298
                                      ++GGW+Q+FG+S     V +LTFATVRG AH
Sbjct  420  FRPLLNMLPNLTVYILKNISDARVINQVGGWTQSFGSSREGKNVTHLTFATVRGAAH  476



>gb|KHN07932.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=464

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 113/222 (51%), Gaps = 22/222 (10%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATE-----TADPCLR  700
            G L+  CS +  ++S E+   +D  ++    C SS+   +      T+       D C+ 
Sbjct  254  GTLTPICSGVNRLVSTEVSRYIDTYDVTLDVCLSSADQQAYVPNQLTQLQEGAKIDVCVE  313

Query  699  DWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMS  529
            D    Y+NR DVQ+ALHA   G       TS    SDV+   + N  I  +  L AL  S
Sbjct  314  DETIAYLNRKDVQEALHAKLVG------ITSWSTCSDVLKYDMQNLEIPTISILGALAKS  367

Query  528  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGR  349
             I VL+YSGDQD  IP++ TR +   LA    L T      W++G+++ GW+Q +G+   
Sbjct  368  GIRVLVYSGDQDSVIPLTGTRSLVNGLAKDFGLNTTVSYRAWFEGRQVAGWTQVYGDI--  425

Query  348  CNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                  L+FAT+RG AH  P S P ++L L KAFL+G P P 
Sbjct  426  ------LSFATIRGAAHEAPFSQPERSLVLLKAFLEGKPLPE  461



>ref|XP_012088729.1| PREDICTED: serine carboxypeptidase-like 45 [Jatropha curcas]
 ref|XP_012088730.1| PREDICTED: serine carboxypeptidase-like 45 [Jatropha curcas]
 gb|KDP23272.1| hypothetical protein JCGZ_23105 [Jatropha curcas]
Length=463

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 112/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++          + S++       +  D C+ D  
Sbjct  257  GSVSPICSRVMGQVSRETSRFVDKYDVTLDVCISSVLAQSNALSPKQVGDNIDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G +    +T      D  L +  I  +  +  L+ + IPVL+
Sbjct  317  VNYLNRQDVQKALHARLVGVR---RWTVCSNILDYELLDLEIPTIAIVGRLIRAGIPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L T      W+ G+++GGW+Q +GN         
Sbjct  374  YSGDQDSVIPLTGSRTLVRGLAEKLGLKTSVPYRVWFGGQQVGGWTQVYGNI--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FAT+RG +H  P S P ++L LFKAFL+G P P
Sbjct  426  LSFATIRGASHEAPFSQPERSLVLFKAFLEGRPLP  460



>ref|XP_010460580.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 113/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  285  GSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  344

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G +  W   S     D  L +     +  + +L+ + +PVL+
Sbjct  345  VNYLNRRDVQEALHARLIGVR-EWTVCS--NVLDYQLLDVEKPTINIVGSLVRAGVPVLV  401

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA +L L T      W+ G+++GGW+Q +GN         
Sbjct  402  YSGDQDSVIPLTGSRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  453

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  454  LSFATVRGASHEVPFSQPERSLVLFKAFLNGHPLP  488



>ref|XP_008374178.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=467

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 96/167 (57%), Gaps = 11/167 (7%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
            TE  D C+ D    Y+NR DVQKALHA   G +  W+  S     +  + N  I  +  +
Sbjct  309  TERIDVCVEDKTVIYLNRKDVQKALHARLVGVR-RWDVCS--SILEYQMLNLEIPTISLV  365

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
             +L+   I VL+YSGDQD  IP++ +R + + LA  L L T      W++GK++GGW+Q 
Sbjct  366  GSLVKQGIQVLVYSGDQDSVIPLTGSRRLVSRLARELGLNTTVPYRVWFEGKQVGGWTQV  425

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            +GN         L+FAT+RG +H  P S P ++L LFK+FL+G P P
Sbjct  426  YGNI--------LSFATIRGASHEAPFSQPERSLRLFKSFLEGRPLP  464



>ref|XP_010499305.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
 ref|XP_010499306.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=489

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 113/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  283  GSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  342

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHA   G +  W   S     D  L +     +  + +L+ + +PVL+
Sbjct  343  VNYLNRRDVQGALHARLVGVR-EWTVCS--NVLDYQLLDVEKPTINIVGSLVRAGVPVLV  399

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA +L L+T      W+ G+++GGW+Q +GN         
Sbjct  400  YSGDQDSVIPLTGSRTLVSRLAKQLGLSTSVPYRVWFAGQQVGGWTQVYGNV--------  451

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  452  LSFATVRGASHEVPFSQPERSLVLFKAFLGGHPLP  486



>ref|XP_010478165.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 113/215 (53%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   +S E    +DK ++    C     S S         E+ D C+ D  
Sbjct  285  GSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDET  344

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G +  W   S     D  L +     +  + +L+ + +PVL+
Sbjct  345  VNYLNRRDVQEALHARLIGVR-EWTVCS--NVLDYQLLDVEKPTINIVGSLVRAGVPVLV  401

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA +L L T      W+ G+++GGW+Q +GN         
Sbjct  402  YSGDQDSVIPLTGSRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  453

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  454  LSFATVRGASHEVPFSQPERSLVLFKAFLGGHPLP  488



>gb|KHN13827.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 73/217 (34%), Positives = 112/217 (52%), Gaps = 13/217 (6%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            +G +S  CS +   +S E    ++K ++          S +        TET D C+ D 
Sbjct  247  NGAVSPTCSSVMSQVSTETSRFVEKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDE  306

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA+  G Q    +++     D  L +     +  +  L+   IPVL
Sbjct  307  TVNYLNRKDVQSALHAHLVGVQ---RWSACSNVLDYELRDLETPTITVVGKLVKEGIPVL  363

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++ +++GGW+Q +GN        
Sbjct  364  VYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI-------  416

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
             L+FAT+RG +H  P S P ++L LFK+FL+G P P+
Sbjct  417  -LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLPQ  452



>ref|XP_011073181.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=458

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 96/168 (57%), Gaps = 11/168 (7%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
            +E  D C+ D    Y+NR DVQKALHA   G +  W+  S     D  + +  I  +  +
Sbjct  300  SERIDVCVEDETVSYLNRRDVQKALHARLVGVR-RWDVCS--NILDYDMLDLEIPTISII  356

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
             +L+   IPVLIYSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q 
Sbjct  357  GSLIKEGIPVLIYSGDQDSVIPLTGSRTLVHRLAKQLGLNTTVPYRVWFEGQQVGGWTQV  416

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            +GN         L+FAT+RG +H  P S P ++  LFK+FL G P P+
Sbjct  417  YGNL--------LSFATIRGASHEAPFSQPERSFVLFKSFLDGRPLPQ  456



>ref|XP_002449560.1| hypothetical protein SORBIDRAFT_05g019090 [Sorghum bicolor]
 gb|EES08548.1| hypothetical protein SORBIDRAFT_05g019090 [Sorghum bicolor]
Length=490

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 112/218 (51%), Gaps = 13/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G LS  C+ +   ++ E    +DK ++   V  S   S       H    +  D C+ D 
Sbjct  281  GSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILSPHEQVGQRIDVCVEDE  340

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ ALHA   G    W   S     +++  N  I  +  + +L+ S I VL
Sbjct  341  TVRYLNRRDVQAALHARLVGVD-KWAVCSSVLQYELL--NLQIPTINIVGSLVKSGIRVL  397

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  + L T      W++G+++GGW+Q +G        G
Sbjct  398  VYSGDQDSVIPLTGSRTLVQNLAHDMGLKTTTPYRVWFEGQQVGGWTQVYGG-------G  450

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  451  ALSFATIRGASHEAPFSQPGRSLVLFRAFLQGQPLPET  488



>gb|ERN14541.1| hypothetical protein AMTR_s00038p00086160, partial [Amborella 
trichopoda]
Length=330

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 91/164 (55%), Gaps = 17/164 (10%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAID-ILPTLSAL  538
            DPC  ++V  Y+N P VQKA HAN TG  YPW+    G +S +      +D ILP +   
Sbjct  182  DPCTSNYVENYLNLPAVQKAFHANVTGLPYPWS----GCSSVISTWADTVDTILPLVQEF  237

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            +   I VL+YSGD D R+PV+ TR     L + ++        PWY   E+GG+S  +  
Sbjct  238  IARGIRVLVYSGDTDGRVPVTGTRSSVNKLNLGIQTPWY----PWYTKGEVGGYSVIYK-  292

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                   G LTFATVRG  H VPS  P+++LTL  AFLKG P P
Sbjct  293  -------GGLTFATVRGAGHEVPSYQPARSLTLINAFLKGKPLP  329



>ref|NP_001176565.1| Os11g0522900 [Oryza sativa Japonica Group]
 gb|ABA93967.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG86949.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52189.1| hypothetical protein OsJ_34064 [Oryza sativa Japonica Group]
 dbj|BAH95293.1| Os11g0522900 [Oryza sativa Japonica Group]
Length=472

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 113/218 (52%), Gaps = 14/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G L+  C+ +   ++ E    +DK ++   V  S   S       H    +  D C+ D 
Sbjct  264  GSLTPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILTPHQQVGQRIDVCVEDE  323

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ+ALHA   G +   N+       +  L N  I  +  + +L+ S I VL
Sbjct  324  TVNYLNRKDVQEALHAKLIGVK---NWAVCSSVLEYELLNLQIPTINIVGSLVKSGIRVL  380

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +G+        
Sbjct  381  VYSGDQDSVIPLTGSRTLVQNLARDLGLKTSVPYRVWFEGQQVGGWTQVYGDM-------  433

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  434  -LSFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  470



>ref|XP_008791046.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
 ref|XP_008791047.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
Length=463

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 109/217 (50%), Gaps = 13/217 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G LS  C+ +   ++ E    +DK ++          S S         E  D C+ D  
Sbjct  257  GSLSPVCARVMGQVTRETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVAERIDVCVEDET  316

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ ALHA  TG    W   S     +  L N     +  + +L+ S IPVL+
Sbjct  317  VNYLNRKDVQDALHARLTGVP-KWTVCS--SVLEYELLNLENPTISVVGSLVSSGIPVLV  373

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA  LKL T      W++GK++GGW+Q +G+         
Sbjct  374  YSGDQDSVIPLTGSRTLVQRLANELKLKTTVPYRVWFEGKQVGGWTQVYGDI--------  425

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            L FAT+RG +H  P S P ++L LF+AFL+  P P T
Sbjct  426  LAFATIRGASHEAPFSQPERSLVLFRAFLQRRPLPET  462



>gb|EEC68261.1| hypothetical protein OsI_36290 [Oryza sativa Indica Group]
Length=472

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 113/218 (52%), Gaps = 14/218 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G L+  C+ +   ++ E    +DK ++   V  S   S       H    +  D C+ D 
Sbjct  264  GSLTPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILTPHQQVGQRIDVCVEDE  323

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ+ALHA   G +   N+       +  L N  I  +  + +L+ S I VL
Sbjct  324  TVNYLNRKDVQEALHAKLIGVK---NWAVCSSVLEYELLNLQIPTINIVGSLVKSGIRVL  380

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +G+        
Sbjct  381  VYSGDQDSVIPLTGSRTLVQNLARDLGLKTSVPYRVWFEGQQVGGWTQVYGDM-------  433

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FAT+RG +H  P S P ++L LF+AFL+G P P T
Sbjct  434  -LSFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  470



>ref|XP_009607740.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=448

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 108/211 (51%), Gaps = 21/211 (10%)
 Frame = -1

Query  855  SEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVGEYIN  676
            S+ C+D    + +EIG      N+   +  +    +      +T   DPC+  ++  Y N
Sbjct  258  SKKCNDYLDQIDKEIG------NIFLYNIYAPLCPNGSPSSTSTSEVDPCMPFYIQSYFN  311

Query  675  RPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQ  496
            +P+VQKA+HAN     YPW   S   T ++   +  + +LP L  L+ SD+ + +YSGD 
Sbjct  312  KPEVQKAIHANVKNLPYPWE--SCNNTLNLSWKDRPLTVLPLLRQLMKSDLKIWLYSGDM  369

Query  495  DLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNLTFAT  316
            D+ +PV+ TR     L + +K        PWY  +E+GG+ + + N         LT  T
Sbjct  370  DVVVPVTDTRYAIKKLKLPIKTAWY----PWYFQEEVGGYVEEYEN---------LTLVT  416

Query  315  VRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            +RG  HFVP+  PS+AL+ F  FL G  PP+
Sbjct  417  IRGAGHFVPTYQPSRALSFFSYFLSGKLPPK  447



>ref|XP_011036159.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=463

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 110/216 (51%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +   ++ E    +DK ++   V  S   S            +  D C+ D 
Sbjct  256  GSVSPQCSRVMNQVTRETSRFVDKYDVTLDVCISSVLSQSKVLTPQQQVGDNVDVCVEDE  315

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NRPDVQ ALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL
Sbjct  316  TVNYLNRPDVQMALHARLVGVR-RWAVCS--NILDYELLDLEIPTITIVGRLIKAGIPVL  372

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   L+  L L T      W++G+++GGW+Q +GN        
Sbjct  373  VYSGDQDSVIPLTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNI-------  425

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG +H  P S P ++L LFKAFL G P P
Sbjct  426  -LSFATIRGASHEAPFSQPERSLVLFKAFLGGQPLP  460



>ref|XP_002520628.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF41764.1| serine carboxypeptidase, putative [Ricinus communis]
Length=467

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 91/164 (55%), Gaps = 11/164 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            E  D C+++   EY+N  DVQ ALHA   G    W F S     D    NF I  +  + 
Sbjct  313  ENIDLCVQEKSFEYLNNKDVQDALHAKLVGIS-NWTFCSRVMYYD--RRNFEIPTIDVVG  369

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ S I VL+YSGDQD  IP   +R +   LA +LKL        W   K++GGW+Q +
Sbjct  370  SLVSSGIRVLVYSGDQDSVIPFIGSRTLVNGLATKLKLNATTTYSGWLVDKQVGGWTQVY  429

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSP  232
            G+         LT+AT+RGG+H  P SSP ++L LFKAFL GSP
Sbjct  430  GDI--------LTYATIRGGSHMAPWSSPKRSLALFKAFLSGSP  465



>ref|XP_009355272.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Pyrus 
x bretschneideri]
Length=461

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 91/168 (54%), Gaps = 14/168 (8%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
            T   D C+ D    Y+NRPDVQ+ALHA  T W      T+        + N  + +LP L
Sbjct  303  TAKIDVCIADETVSYLNRPDVQEALHARVTNW------TTCSNVLKYDMKNVEVPMLPVL  356

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
              L+ S I VLIYSGDQD  IP++ TR +A  LA  L L T      W   K++ GW+Q 
Sbjct  357  GDLVKSGIRVLIYSGDQDSVIPLTSTRTLANGLAKDLGLQTNVPYRVWVQEKQVAGWTQV  416

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            + ++        L++AT+RG  H  P S P ++L LF +FLKG P P+
Sbjct  417  YSDA--------LSYATIRGAGHEAPISQPERSLLLFTSFLKGKPLPK  456



>ref|NP_001052663.1| Os04g0396800 [Oryza sativa Japonica Group]
 emb|CAE05146.2| OSJNBa0039C07.2 [Oryza sativa Japonica Group]
 dbj|BAF14577.1| Os04g0396800 [Oryza sativa Japonica Group]
 gb|EAZ30581.1| hypothetical protein OsJ_14632 [Oryza sativa Japonica Group]
 dbj|BAG91822.1| unnamed protein product [Oryza sativa Japonica Group]
Length=470

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 113/220 (51%), Gaps = 20/220 (9%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqQHYLATETADPCLRDWV  691
            G LS  C  +   ++ E    +DK ++            S S      +   D C+ D  
Sbjct  260  GSLSSACDTVMTQVARETSRFVDKYDVTLDVCVSSVLMQSKSLAPQRGSRELDVCVEDET  319

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLS---ALLMSDI  523
              Y+NR DVQ+A+HA   G    W   S       +L    +D+ +PT++    L+ S +
Sbjct  320  MGYLNRKDVQEAMHARLEGGVPKWTVCSS------VLEYKQLDLQIPTINIVGGLVKSGV  373

Query  522  PVLIYSGDQDLRIPVSHTREVATVLAVRLKL-TTLEMNGPWYDGKEIGGWSQTFGNSGRC  346
            PVL+YSGDQD  IP++ +R V   LA  L+L TT      W++G+++GGW+Q+FG     
Sbjct  374  PVLVYSGDQDSVIPLTGSRTVVQRLAGWLRLGTTAAGYRVWFEGRQVGGWTQSFGG----  429

Query  345  NKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
               G L+FATVRG +H  P S P ++L LF AFL G P P
Sbjct  430  ---GALSFATVRGASHEAPFSQPERSLVLFAAFLAGRPLP  466



>emb|CDY11750.1| BnaC03g58280D [Brassica napus]
Length=461

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 111/215 (52%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   ++ E    +DK ++          S S         E+ D C+ D  
Sbjct  255  GSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSKVVSPNQVGESVDVCVEDET  314

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+AL A   G +  W   S     D  + +     +  + +L+ + +PVL+
Sbjct  315  VNYLNRRDVQEALQARLVGVR-EWTVCS--NVLDYQMLDVEKPTINIVGSLVEAGVPVLV  371

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN         
Sbjct  372  YSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------  423

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FATVRG AH VP S P ++L LFKAFL G P P
Sbjct  424  LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  458



>ref|XP_010239839.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=465

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 94/165 (57%), Gaps = 11/165 (7%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            D C+ D    Y+NR DVQ+A+HA   G    W   S     +    +  I  + T+  L+
Sbjct  310  DVCVEDETMNYLNRKDVQQAMHARLNGVP-KWTVCS--SVLEYKQLDLQIPTINTVGMLV  366

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             S IPVL+YSGDQD  IP++ +R +   LA RL+L        W++GK++GGW+Q FG++
Sbjct  367  KSGIPVLVYSGDQDSVIPLTGSRTLVHRLAKRLRLNATVPYRVWFEGKQVGGWTQVFGDA  426

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                    L+FAT+RG +H  P S P ++L LF+AFL G P P +
Sbjct  427  --------LSFATIRGASHEAPFSQPERSLVLFRAFLAGRPLPES  463



>ref|XP_010234952.1| PREDICTED: serine carboxypeptidase-like 34 [Brachypodium distachyon]
Length=468

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 88/163 (54%), Gaps = 15/163 (9%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            DPC + +  EY+NR DVQ+ALHANTTG  YP+       +S  I  +  + ++P +  L 
Sbjct  317  DPCTQTYATEYLNREDVQRALHANTTGVPYPYALCRNSISS--IWKDSDMTVVPIVKKLA  374

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
               + + I+SGD D RIP + TR     L + +K    E   PW+  K++GGW+  +   
Sbjct  375  QEGLRIWIFSGDTDARIPTTSTRYTLKKLGLSIK----EDWAPWFSHKQVGGWTVVY---  427

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                    LTF TVRG  H VPSS P QAL LFK FL G   P
Sbjct  428  ------DGLTFVTVRGAGHMVPSSQPKQALQLFKHFLAGKNLP  464



>ref|XP_009355267.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Pyrus 
x bretschneideri]
Length=462

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 109/216 (50%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEI-GHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVG  688
            G L+  C  +      E+ GH +++ ++    C SS  + S      T   D CL D + 
Sbjct  256  GPLTPACDAVANQFEREVPGHLINRYDVTLDVCLSSVEAQSF-QLRKTVKIDVCLVDEIV  314

Query  687  EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  508
             Y+NRPDVQ+ALHA  T W     F S        L N    +LP L  L+ S I VLIY
Sbjct  315  SYLNRPDVQEALHARITNW----TFCSNRAVIQYDLKNLETPMLPVLGELVKSGIRVLIY  370

Query  507  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNL  328
            SGDQD  IP++ TR +   LA  L L T      W   K++ GW+Q + ++        L
Sbjct  371  SGDQDSIIPLTSTRTLVNGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------L  422

Query  327  TFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            ++AT+RG  H  P S P ++L LF +FL+G P P+ 
Sbjct  423  SYATIRGAGHEAPISQPERSLLLFASFLRGKPLPKA  458



>ref|XP_007159976.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31970.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=344

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 97/166 (58%), Gaps = 11/166 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            E+ D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     D++  N     LP + 
Sbjct  187  ESIDVCVDDKVTNYLNRKDVQEALHAKLVGVR-KWDVCSNILDYDML--NLEKPTLPVVG  243

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ + + VLIYSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +
Sbjct  244  SLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVY  303

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            G+         L+FATVRG +H  P S P ++  LFK+FL+  P P
Sbjct  304  GSI--------LSFATVRGASHEAPFSQPERSFVLFKSFLEDRPLP  341



>ref|XP_002964377.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ34710.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 96/164 (59%), Gaps = 13/164 (8%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNF-TSPGKTSDVILHNFAIDILPTLSAL  538
            D C+      Y N P+VQ+ LHANTTG  Y W+  T P    D  + + + +++P L  +
Sbjct  309  DICIDKERDVYFNLPEVQRELHANTTGLSYSWSMCTGP---VDYAMQDGSTNMVPLLGDI  365

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            L + + V I+SGDQD  +P++ TR +   LA  L + T +    WY G ++ GW+Q++  
Sbjct  366  LKAGLRVWIFSGDQDSVVPLTGTRSLIGGLAKSLGMQTTQPYTAWYQGGQVAGWTQSY--  423

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                   GNLT+AT+RG AH VP + P +AL LF++F++G+  P
Sbjct  424  -------GNLTYATIRGAAHMVPYAQPERALLLFRSFIRGNALP  460



>ref|XP_010678341.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=476

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 96/169 (57%), Gaps = 17/169 (10%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHA---NTTGWQYPWNFTSPGKTSDVILHNFAIDILP  553
            E+ D C+ D    Y+NR DVQKALHA   N   W+   N        D  L +  I  + 
Sbjct  319  ESVDVCIEDETVSYLNRQDVQKALHARLVNVRRWEVCSNIL------DYELLDVEIPTIT  372

Query  552  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  373
             + +L+ S +PVL+YSGDQD  IP++ +R +   LA+ L L        W+ G+++GGW+
Sbjct  373  IVGSLVKSGVPVLVYSGDQDSVIPLTGSRTLVHRLAMELGLNATTPYRVWFAGEQVGGWT  432

Query  372  QTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            + +GN         L+FATVRG AH VP S P+++L LFK+FL+  P P
Sbjct  433  EVYGNI--------LSFATVRGAAHEVPYSQPARSLVLFKSFLESRPLP  473



>ref|XP_006853074.2| PREDICTED: serine carboxypeptidase II-3 [Amborella trichopoda]
Length=456

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 91/164 (55%), Gaps = 17/164 (10%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAID-ILPTLSAL  538
            DPC  ++V  Y+N P VQKA HAN TG  YPW+    G +S +      +D ILP +   
Sbjct  308  DPCTSNYVENYLNLPAVQKAFHANVTGLPYPWS----GCSSVISTWADTVDTILPLVQEF  363

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            +   I VL+YSGD D R+PV+ TR     L + ++        PWY   E+GG+S  +  
Sbjct  364  IARGIRVLVYSGDTDGRVPVTGTRSSVNKLNLGIQTPWY----PWYTKGEVGGYSVIYK-  418

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                   G LTFATVRG  H VPS  P+++LTL  AFLKG P P
Sbjct  419  -------GGLTFATVRGAGHEVPSYQPARSLTLINAFLKGKPLP  455



>ref|XP_012086498.1| PREDICTED: serine carboxypeptidase-like 27 [Jatropha curcas]
 gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 88/171 (51%), Gaps = 23/171 (13%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAID----I  559
            +   DPC   +   Y NRP+VQKALHAN TG  YPW      KT   I+ N+  D    +
Sbjct  304  SRAYDPCTERYSKLYFNRPEVQKALHANATGISYPW------KTCSDIVGNYWADAPLSM  357

Query  558  LPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGG  379
            LP    L+ + + + +YSGD D  +PV+ TR         LKL T+    PWYD  ++GG
Sbjct  358  LPIYKELIAAGLKIWVYSGDTDAVVPVTATRYSIDA----LKLPTITNWSPWYDNGKVGG  413

Query  378  WSQTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            WSQ +           LTF TV G  H VP   P QA  LFK+FL+  P P
Sbjct  414  WSQVY---------KGLTFVTVTGAGHEVPLHRPRQAFILFKSFLENKPMP  455



>ref|XP_011040748.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=459

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 110/221 (50%), Gaps = 21/221 (10%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDW  694
            SG LS  CS +   +S E+   +D  ++          S S   +    T T D C+ D 
Sbjct  250  SGSLSLPCSAVNSRVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQMEYTGTIDVCVEDE  309

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDI  523
              +Y+NR DV +ALHA   G    W   S     DVI   + N  I  +P L+ LL S I
Sbjct  310  TIKYLNRKDVLEALHAQLVGVD-QWTVCS-----DVIKYEMENLEISTVPLLAKLLKSGI  363

Query  522  PVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCN  343
             V +YSGDQD  IP++ TR +   LA  L L T      W+ GK++ GW+Q +GN     
Sbjct  364  RVHVYSGDQDSVIPLTGTRTIVNGLAKELGLNTTVPYRTWFQGKQVAGWTQVYGNI----  419

Query  342  KVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGS--PPP  226
                L+FAT+R  +H  P S P ++  LF AFL+G   PPP
Sbjct  420  ----LSFATIRAASHEAPFSQPERSFVLFNAFLEGKQLPPP  456



>ref|XP_002297872.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE82677.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=454

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 109/215 (51%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   ++ E    +DK ++          S S         +  D C+ D  
Sbjct  248  GSVSPLCSRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSKVLTPQQVGDNVDVCVEDET  307

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NRPDVQ ALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+
Sbjct  308  VNYLNRPDVQMALHARLVGVR-RWAVCS--NILDYELLDLEIPTITIVGRLIKAGIPVLV  364

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   L+  L L T      W++G+++GGW+Q +GN         
Sbjct  365  YSGDQDSVIPLTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNI--------  416

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FAT+RG +H  P S P ++L LFKAFL G P P
Sbjct  417  LSFATIRGASHEAPFSQPERSLVLFKAFLGGQPLP  451



>ref|XP_003577529.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=468

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/216 (34%), Positives = 111/216 (51%), Gaps = 14/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G LS  C+ +   ++ E    +DK ++   V  +   S       H    +  D C+ D 
Sbjct  260  GSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLASVLSQSMILSPHRHVGQRIDVCIEDE  319

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQ+ALHA   G +   N+          L N  I  +  + +L+ S I VL
Sbjct  320  TVNYLNRKDVQEALHAKLIGVK---NWAVCSSVLQYELLNLQIPTINIVGSLVKSGIRVL  376

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            +YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW+Q +G+        
Sbjct  377  VYSGDQDSVIPLTGSRTLVQNLAHDLGLKTSTPYRVWFEGKQVGGWTQVYGDM-------  429

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
             L+FAT+RG +H  P S P ++L L++AFL+G P P
Sbjct  430  -LSFATIRGASHEAPFSQPKRSLVLYRAFLQGRPLP  464



>ref|XP_008357674.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=376

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 109/215 (51%), Gaps = 14/215 (7%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEI-GHDMDKENLVFqscesssisssqQHYLATETADPCLRDWVG  688
            G LS  C  +      E+ GH +++ ++    C SS  + S      T   D C+ D   
Sbjct  170  GPLSPACDAVANQFEREVPGHLINQYDVTLDVCLSSVEAQSF-QLRKTVKIDVCIGDETV  228

Query  687  EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  508
             Y NRPDVQ+ALHA  T W       S G   +  + N  I +LP L  L+ S I VLIY
Sbjct  229  TYFNRPDVQEALHARVTNW----TICSXGGVLEYDMKNXEIPMLPVLGDLVKSGIRVLIY  284

Query  507  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGNL  328
            SGDQD  IP++ TR +   LA  L L T      W   K++ GW+Q + ++        L
Sbjct  285  SGDQDSIIPLTSTRTLVNGLARDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------L  336

Query  327  TFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            ++AT+RG  H  P S P ++L LF +FL+G P P+
Sbjct  337  SYATIRGAGHEAPISQPKRSLLLFTSFLRGKPLPK  371



>ref|XP_002307961.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
 gb|EEE91484.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
Length=482

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 92/172 (53%), Gaps = 11/172 (6%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
             E  D C+++   +Y+NR DVQ+ALHA   G      +T      +    NF I  +  +
Sbjct  322  AENIDVCVQEKSSQYLNRKDVQEALHAQLVGVT---RWTGCSSVVNYDRRNFEIPTINIV  378

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
             +L+ S I VL+YSGDQD  IP   +R +   LA  L L       PW++ K++GGW+Q 
Sbjct  379  GSLVSSGIRVLVYSGDQDSVIPFIGSRILVDGLAKELGLNATVPYRPWFEDKQVGGWTQV  438

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTNPN  211
            +G+         LTFAT+RG  H  P +SP ++L LF AFL G P P   PN
Sbjct  439  YGDI--------LTFATIRGAGHLAPLTSPKRSLALFSAFLSGKPLPEALPN  482



>ref|XP_011041403.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=476

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 93/166 (56%), Gaps = 11/166 (7%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
            A E  DPC+++    Y+NR DVQ++ HA   G    W F S     D  L N  I  +  
Sbjct  320  AQENIDPCVQEETFVYLNRKDVQESFHAKLVGTP-KWTFCSGVVNYD--LRNLEIPTIDV  376

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ S + VL+YSGDQD  IP + +R +   LA +L L        W++ K++GGW+Q
Sbjct  377  VGSLVTSGVRVLVYSGDQDSVIPFTGSRTLVEGLAKKLGLNATVPYTAWFEDKQVGGWTQ  436

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSP  232
             +G+         LTF+T+RGG+H  P SSP ++L LF AFL G P
Sbjct  437  VYGDI--------LTFSTIRGGSHMAPFSSPGRSLALFAAFLSGKP  474



>gb|KEH35413.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=477

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 92/167 (55%), Gaps = 10/167 (6%)
 Frame = -1

Query  720  TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSA  541
            T D C+   +  Y+N P+VQKALHAN T   YPW+  S     +   H+  I+ILP L  
Sbjct  309  TVDICMDSEIYFYLNLPEVQKALHANRTNLPYPWSMCSGVLNYNDADHD--INILPVLKR  366

Query  540  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  361
            ++ + IPV +YSGDQD  +P+  +R     LA  L     +    W+   ++GGW   +G
Sbjct  367  IVQNHIPVWVYSGDQDSIVPLLGSRRHIRELAHDLNFNITDSYRVWFHRDQVGGWVTEYG  426

Query  360  NSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            N         LTFATVRG  H VP + PS+AL LF +F++G   P+T
Sbjct  427  NL--------LTFATVRGAGHIVPYAQPSKALHLFSSFVRGRRLPKT  465



>ref|XP_002517289.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45082.1| serine carboxypeptidase, putative [Ricinus communis]
Length=464

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 114/225 (51%), Gaps = 29/225 (13%)
 Frame = -1

Query  867  SGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqQHYL-ATETA---DPCLR  700
            SG LS  CS +   +S E+   +D  ++    C SS  S S  H L   E A   D C+ 
Sbjct  250  SGSLSPDCSRVSREVSREVSKFVDTYDITLDVCLSSIQSQS--HVLNQMEYAGKIDVCVE  307

Query  699  DWVGEYINRPDVQKALHAN---TTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSAL  538
            D   +Y+NR DVQ+ALHA      GW            SDV+   + N  I   P L  L
Sbjct  308  DETVKYLNRKDVQEALHAQLFGVNGWTV---------CSDVLKYNMQNLEISTTPLLGKL  358

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            + S I VLIYSGDQD  IP++ TR +   LA  L L T      W+ GK++ GW+Q FG+
Sbjct  359  IKSGIRVLIYSGDQDSVIPLTGTRALVNGLAKELTLNTTVPYRAWFGGKQVAGWTQVFGD  418

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
                     L++AT+RG +H  P S P +++ LF AFL G P P 
Sbjct  419  I--------LSYATIRGASHEAPFSQPERSIVLFSAFLGGVPLPE  455



>ref|XP_011036160.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=462

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 109/215 (51%), Gaps = 13/215 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
            G +S  CS +   ++ E    +DK ++          S S         +  D C+ D  
Sbjct  256  GSVSPQCSRVMNQVTRETSRFVDKYDVTLDVCISSVLSQSKVLTPQQVGDNVDVCVEDET  315

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NRPDVQ ALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+
Sbjct  316  VNYLNRPDVQMALHARLVGVR-RWAVCS--NILDYELLDLEIPTITIVGRLIKAGIPVLV  372

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   L+  L L T      W++G+++GGW+Q +GN         
Sbjct  373  YSGDQDSVIPLTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNI--------  424

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FAT+RG +H  P S P ++L LFKAFL G P P
Sbjct  425  LSFATIRGASHEAPFSQPERSLVLFKAFLGGQPLP  459



>ref|XP_010664883.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Vitis 
vinifera]
Length=400

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 89/165 (54%), Gaps = 10/165 (6%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            D C+      Y N P+VQKALHAN TG  Y W   S          N  IDILP L  ++
Sbjct  239  DVCMTYERSFYFNLPEVQKALHANRTGLNYRWTMCSGVLNYSETDGN--IDILPLLKRIV  296

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             + IPV ++SGDQD  +P+  +R +   LA  +K       G W+   ++GGW+  +GN 
Sbjct  297  QNSIPVWVFSGDQDSVVPLLGSRTLIRELAQEMKFKITVPFGAWFHKGQVGGWATEYGNL  356

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                    LTFATVRG AH VP + PS+AL LF +F++G   P T
Sbjct  357  --------LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNT  393



>gb|KCW78823.1| hypothetical protein EUGRSUZ_C00253 [Eucalyptus grandis]
Length=382

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 91/168 (54%), Gaps = 21/168 (13%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFA---IDILPTLS  544
            DPC  ++  +Y NRPDVQKALHAN TG  Y W        SDV++ N+      +LPT  
Sbjct  233  DPCTENYAEKYYNRPDVQKALHANVTGIPYKWT-----ACSDVLIKNWKDSQNSMLPTYK  287

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             L+ + + + ++SGD D  +PV+ TR     L + +K        PWY G ++GGW++ +
Sbjct  288  ELIATRLRIWVFSGDTDSVVPVTATRFALHHLNLNIKTRWY----PWYSGNQVGGWTEVY  343

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                       LTFATVRG  H VP   P +A  LFK+FL G   P++
Sbjct  344  ---------DGLTFATVRGAGHEVPLFQPKRAFILFKSFLAGKELPKS  382



>ref|XP_002967656.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ31003.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 96/164 (59%), Gaps = 13/164 (8%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNF-TSPGKTSDVILHNFAIDILPTLSAL  538
            D C+      Y N P+VQ+ LHANTTG  Y W+  T P    D  + + + +++P L  +
Sbjct  309  DICIDKERDVYFNLPEVQRELHANTTGLPYSWSMCTGP---VDYAMQDGSTNMVPLLGDI  365

Query  537  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  358
            L + + V I+SGDQD  +P++ TR +   LA  L + T +    WY G ++ GW+Q++  
Sbjct  366  LKAGLRVWIFSGDQDSVVPLTGTRSLIGGLAKSLGMQTTQPYTAWYQGGQVAGWTQSY--  423

Query  357  SGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
                   GNLT+AT+RG AH VP + P +AL LF++F++G+  P
Sbjct  424  -------GNLTYATIRGAAHMVPYAQPERALLLFRSFIRGNALP  460



>ref|XP_009592799.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=616

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 100/175 (57%), Gaps = 20/175 (11%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH--NFAIDILP  553
            ++  DPC  D+V  Y+NRPDVQK LHAN T  +Y W        SDVI    +  + I+P
Sbjct  340  SQVIDPCSDDYVIAYMNRPDVQKLLHANVTKIKYNWQ-----PCSDVIESWTDSPLTIIP  394

Query  552  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  373
             L  L+ + + V I+SGD D  +PV+ T++       ++KL T     PW+   E+GG++
Sbjct  395  LLKELMENGVRVWIFSGDTDGIVPVTSTKKSIK----KMKLLTKTPWYPWFHNDEVGGYA  450

Query  372  QTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTNPNH  208
            Q +        +GNLTFATVRG  H VPS  P++AL+L K FL G+  P + P H
Sbjct  451  QVY--------IGNLTFATVRGAGHQVPSYQPARALSLVKHFLAGTELPNS-PRH  496



>ref|XP_007032750.1| Serine carboxypeptidase-like 25 isoform 3 [Theobroma cacao]
 gb|EOY03676.1| Serine carboxypeptidase-like 25 isoform 3 [Theobroma cacao]
Length=395

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 93/175 (53%), Gaps = 21/175 (12%)
 Frame = -1

Query  735  YLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFA---I  565
            + A    DPC   +   Y NRPDVQKALHANTTG  Y W        S+V+  N+     
Sbjct  239  FRAISGYDPCTEKYAEIYYNRPDVQKALHANTTGIHYKWT-----ACSEVLNRNWNDTDA  293

Query  564  DILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEI  385
             +LP    ++   + V ++SGD D  +PV+ TR        +LKLTT     PWY  K++
Sbjct  294  SVLPIYREMIAGGLRVWVFSGDVDSVVPVTATR----YSLAQLKLTTKIPWYPWYVKKQV  349

Query  384  GGWSQTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            GGW++ +           LTFATVRG  H VP   P  AL LFK+FL+G P P++
Sbjct  350  GGWTEVY---------HGLTFATVRGAGHEVPLFKPRAALQLFKSFLRGEPLPKS  395



>ref|XP_010682654.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 113/218 (52%), Gaps = 15/218 (7%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqQHYLATETADPCLRDW  694
            G +S  CS +  ++S E    +DK ++   V      S       H +  ET D C+ D 
Sbjct  267  GFVSPMCSKVMSLVSRETSRFVDKYDVTLDVCLPSIFSQSKFLTPHQVG-ETIDVCVEDE  325

Query  693  VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  514
               Y+NR DVQKALHA   G     ++T   +  D  + +     +  +  L+ + IPVL
Sbjct  326  TVGYLNRRDVQKALHARLVGVN---SWTVCSRILDYEMLDLERPTIHLIGNLVKAGIPVL  382

Query  513  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVG  334
            IYSGDQD  +P++ +R +   LA  LKL T      W+ GK++GGW++  G+        
Sbjct  383  IYSGDQDSVVPLTGSRTLVKRLAEELKLNTTVPYRVWFVGKQVGGWTEVHGDL-------  435

Query  333  NLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             L+FATVRG +H  P S P ++L LFK+FL+G P P  
Sbjct  436  -LSFATVRGASHEAPFSQPERSLVLFKSFLEGKPLPEV  472



>ref|XP_011009402.1| PREDICTED: serine carboxypeptidase-like 25 isoform X2 [Populus 
euphratica]
Length=401

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 91/168 (54%), Gaps = 21/168 (13%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNF---AIDILPTLS  544
            DPC   +   Y NRPDVQKALHAN T   Y W        S+V+  N+   A+ +LP   
Sbjct  252  DPCTEKYAEIYYNRPDVQKALHANVTKTPYKWT-----ACSEVLNRNWNDTAVSVLPIYR  306

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             +L S + + ++SGD D  +PV+ TR        +LKL T     PWY  K++GGW++ +
Sbjct  307  EMLASGLRIWVFSGDVDSVVPVTATR----YSLAQLKLATKIPWHPWYVKKQVGGWTEVY  362

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                       LTFATVRG  H VP   P  AL LFK+FLKG P P++
Sbjct  363  EG---------LTFATVRGAGHEVPLFKPRAALQLFKSFLKGQPLPKS  401



>ref|XP_004503800.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=466

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 117/215 (54%), Gaps = 15/215 (7%)
 Frame = -1

Query  858  LSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssq----QHYLATETADPCLRDWV  691
            +S  CS +   +S E    +DK ++    C SS +S S+    Q + A E+ D C+ D V
Sbjct  260  ISPLCSKVMRKVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQTHQANESIDVCVDDKV  319

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQKALHA   G    W+  +     D  + N  +  L  + +L+ + + VLI
Sbjct  320  TNYLNRRDVQKALHAELVGVP-TWDVCN--NVLDYNMLNLEVPTLHVVGSLIKAGVRVLI  376

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R +   LA +L L T      W++G ++GGW+Q +GN         
Sbjct  377  YSGDQDSVIPLTGSRSLVQKLARQLSLNTTVPYRVWFEGHQVGGWTQVYGNI--------  428

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            L+FAT+RG +H  P S P ++L LF +FL+  P P
Sbjct  429  LSFATIRGASHEAPFSQPQRSLVLFNSFLEDRPLP  463



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 91/168 (54%), Gaps = 21/168 (13%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFA---IDILPTLS  544
            DPC  ++  +Y NRPDVQKA+HAN TG  Y W        SD +L N+      +LPT  
Sbjct  307  DPCTENYAEKYYNRPDVQKAMHANATGIPYRWT-----ACSDFLLKNWKDSQFSMLPTYK  361

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             L+   + + ++SGD D  +PV+ TR         L LT      PWY G ++GGW++ +
Sbjct  362  ELMEGGLRIWVFSGDTDSVVPVTATRFSLN----HLNLTVKTRWYPWYSGGQVGGWTEVY  417

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                       LTFATVRG  H VP   P +ALTLF++FL G+  P++
Sbjct  418  ---------EGLTFATVRGAGHEVPLFQPERALTLFRSFLAGAELPKS  456



>ref|XP_010265560.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 91/168 (54%), Gaps = 21/168 (13%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFA---IDILPTLS  544
            DPC  ++  +Y NRPDVQKA+HAN TG  Y W        SD +L N+      +LPT  
Sbjct  276  DPCTENYAEKYYNRPDVQKAMHANATGIPYRWT-----ACSDFLLKNWKDSQFSMLPTYK  330

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             L+   + + ++SGD D  +PV+ TR         L LT      PWY G ++GGW++ +
Sbjct  331  ELMEGGLRIWVFSGDTDSVVPVTATRFSLN----HLNLTVKTRWYPWYSGGQVGGWTEVY  386

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                       LTFATVRG  H VP   P +ALTLF++FL G+  P++
Sbjct  387  ---------EGLTFATVRGAGHEVPLFQPERALTLFRSFLAGAELPKS  425



>gb|EYU28449.1| hypothetical protein MIMGU_mgv1a004999mg [Erythranthe guttata]
Length=501

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 113/216 (52%), Gaps = 12/216 (6%)
 Frame = -1

Query  864  GELSEYCSDIEIMLSEEIGHDMDKENLVFqs--cesssisssqQHYLATETADPCLRDWV  691
              LS  CS +  +++ E    +DK ++          S S +      T+  D C+ D  
Sbjct  294  ASLSPICSKVMSLVTIETSKFVDKYDVTLDVCISSVLSQSKALVPQQMTDKVDVCVEDET  353

Query  690  GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  511
              Y+NR DVQ+ALHA   G    W   S     D  L +  I  +  +  ++ + IPVL+
Sbjct  354  VNYLNRRDVQRALHARLLGVNR-WLVCS--NILDYELLDLEIPTINIVGRIVEAGIPVLV  410

Query  510  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNKVGN  331
            YSGDQD  IP++ +R++   LA  L+L T      W+ G ++GGW+Q +GN+        
Sbjct  411  YSGDQDSVIPLTGSRKLVHRLARELRLRTSTPYRVWFAGMQVGGWTQVYGNN-------K  463

Query  330  LTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPR  223
            L+FAT+RG +H  P S P ++L LF+AFL+G P P+
Sbjct  464  LSFATIRGASHEAPFSQPERSLVLFRAFLQGKPLPQ  499



>ref|XP_002318164.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
 gb|EEE96384.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
Length=463

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 95/170 (56%), Gaps = 11/170 (6%)
 Frame = -1

Query  729  ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  550
             +E  D C+ D    Y+NR DV+KALHA   G +  W   S     +V+  N  I  +  
Sbjct  304  VSERIDVCIEDETVNYLNREDVRKALHARLIGVR-RWEVCSNILDYEVL--NIEIPTINI  360

Query  549  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  370
            + +L+ + IPVLIYSGDQD  IP++ +R +   LA  L L T      W+ GK++GGW+Q
Sbjct  361  VGSLIKAGIPVLIYSGDQDSVIPLTGSRTLVHRLAKELGLNTTVPYRAWFAGKQVGGWTQ  420

Query  369  TFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
             +GN         L+FAT+RG +H  P S P ++L LFK+FL+G   P  
Sbjct  421  VYGNI--------LSFATIRGASHEAPFSQPERSLMLFKSFLQGKHLPEV  462



>gb|AFK38452.1| unknown [Lotus japonicus]
Length=160

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 89/160 (56%), Gaps = 20/160 (13%)
 Frame = -1

Query  684  YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFA-----IDILPTLSALLMSDIP  520
            Y N P+VQKALHAN T   Y W+  SP       + N++     I+ILP L  ++ + IP
Sbjct  8    YFNLPEVQKALHANRTNLPYKWSMCSP-------VLNYSETDPKINILPILKRIVKNHIP  60

Query  519  VLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGRCNK  340
            V + SGDQD  +P+  +R +   LA  L+       G W+   ++GGW   +GN      
Sbjct  61   VWVLSGDQDSVVPLLGSRTLIRELAHELQYKVTVPYGAWFHKGQVGGWVTEYGNL-----  115

Query  339  VGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
               LTFATVRG AH VP + PS+AL LF AF++GS  P T
Sbjct  116  ---LTFATVRGAAHMVPYAQPSRALGLFSAFVRGSRLPNT  152



>ref|XP_011009401.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Populus 
euphratica]
Length=469

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 91/168 (54%), Gaps = 21/168 (13%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNF---AIDILPTLS  544
            DPC   +   Y NRPDVQKALHAN T   Y W        S+V+  N+   A+ +LP   
Sbjct  320  DPCTEKYAEIYYNRPDVQKALHANVTKTPYKWT-----ACSEVLNRNWNDTAVSVLPIYR  374

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             +L S + + ++SGD D  +PV+ TR        +LKL T     PWY  K++GGW++ +
Sbjct  375  EMLASGLRIWVFSGDVDSVVPVTATR----YSLAQLKLATKIPWHPWYVKKQVGGWTEVY  430

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                       LTFATVRG  H VP   P  AL LFK+FLKG P P++
Sbjct  431  EG---------LTFATVRGAGHEVPLFKPRAALQLFKSFLKGQPLPKS  469



>ref|XP_009355269.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 92/169 (54%), Gaps = 12/169 (7%)
 Frame = -1

Query  726  TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  547
            T   D C+ D +  Y+NRPDVQ+ALHA  T W       S G   +  + +  I +LP L
Sbjct  302  TVKIDVCIGDEIVTYLNRPDVQEALHARVTNW----TICSNGGVLEYDMKDHEILMLPVL  357

Query  546  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  367
              L+ S I VLIYSGDQD  IP+  TR +   LA  L L T      W   K++ GW+Q 
Sbjct  358  GDLVKSGIRVLIYSGDQDSIIPLVSTRTLVNGLAKDLGLQTNVPYRVWVQEKQVAGWTQV  417

Query  366  FGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
            +G++        L++AT+RG  H  P S P ++L LF +FL+G P P+ 
Sbjct  418  YGDT--------LSYATIRGAGHEAPISQPERSLLLFTSFLRGKPLPKA  458



>ref|XP_008230880.1| PREDICTED: serine carboxypeptidase-like 25 [Prunus mume]
Length=253

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 94/169 (56%), Gaps = 21/169 (12%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFA---IDILPTLS  544
            DPC   +   Y NRPDVQKALHAN TG  Y W        S+V+  N+    + +LP   
Sbjct  103  DPCTEKYAEVYYNRPDVQKALHANITGIPYKWT-----ACSEVLNRNWNDTDVSVLPIYR  157

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             ++++ + + ++SGD D  +PV+ TR        +LKL T     PWY  K++GGW++ +
Sbjct  158  DMIIAGLRIWVFSGDVDSVVPVTATR----YSLAQLKLETKIPWYPWYTKKQVGGWTEVY  213

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRTN  217
                       LTFATVRG  H VP   P +AL LFK+F++G P P+++
Sbjct  214  ---------EGLTFATVRGAGHEVPLFKPREALHLFKSFIQGKPLPKSS  253



>ref|XP_010099600.1| Serine carboxypeptidase-like 45 [Morus notabilis]
 gb|EXB79994.1| Serine carboxypeptidase-like 45 [Morus notabilis]
Length=464

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 99/169 (59%), Gaps = 11/169 (7%)
 Frame = -1

Query  732  LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILP  553
            ++ +T D C+ D V +Y+NR DVQ+ALHA   G +  W+  S     D  + N  +  + 
Sbjct  304  VSDQTIDVCVDDKVVKYLNRRDVQRALHARLVGVR-QWDACS--NILDYEVLNVELPTIS  360

Query  552  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  373
             + +L+ + I VL+YSGDQD  IP+  +R +   LA  L L T      W+ GK++GGW+
Sbjct  361  IVGSLVKAGISVLVYSGDQDSVIPLMGSRTLVDKLASELGLKTTVPYRVWFQGKQVGGWT  420

Query  372  QTFGNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            Q +GN+        L+FAT+R  +H  P S P ++L LFK+FL+G+P P
Sbjct  421  QVYGNA--------LSFATIRDASHEAPFSQPERSLILFKSFLQGNPLP  461



>ref|XP_007159977.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31971.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=466

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 96/166 (58%), Gaps = 11/166 (7%)
 Frame = -1

Query  723  ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  544
            E+ D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     D  + N     LP + 
Sbjct  309  ESIDVCVDDKVTNYLNRKDVQEALHAKLVGVR-KWDVCS--NILDYDMLNLEKPTLPVVG  365

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
            +L+ + + VLIYSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +
Sbjct  366  SLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVY  425

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPP  226
            G+         L+FATVRG +H  P S P ++  LFK+FL+  P P
Sbjct  426  GSI--------LSFATVRGASHEAPFSQPERSFVLFKSFLEDRPLP  463



>ref|XP_010047069.1| PREDICTED: serine carboxypeptidase 24-like [Eucalyptus grandis]
Length=461

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 91/168 (54%), Gaps = 21/168 (13%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFA---IDILPTLS  544
            DPC  ++  +Y NRPDVQKALHAN TG  Y W        SDV++ N+      +LPT  
Sbjct  312  DPCTENYAEKYYNRPDVQKALHANVTGIPYKWT-----ACSDVLIKNWKDSQNSMLPTYK  366

Query  543  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  364
             L+ + + + ++SGD D  +PV+ TR     L + +K        PWY G ++GGW++ +
Sbjct  367  ELIATRLRIWVFSGDTDSVVPVTATRFALHHLNLNIKTRWY----PWYSGNQVGGWTEVY  422

Query  363  GNSGRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                       LTFATVRG  H VP   P +A  LFK+FL G   P++
Sbjct  423  ---------DGLTFATVRGAGHEVPLFQPKRAFILFKSFLAGKELPKS  461



>ref|XP_002278193.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Vitis 
vinifera]
 emb|CBI19968.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 89/165 (54%), Gaps = 10/165 (6%)
 Frame = -1

Query  714  DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  535
            D C+      Y N P+VQKALHAN TG  Y W   S          N  IDILP L  ++
Sbjct  306  DVCMTYERSFYFNLPEVQKALHANRTGLNYRWTMCSGVLNYSETDGN--IDILPLLKRIV  363

Query  534  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  355
             + IPV ++SGDQD  +P+  +R +   LA  +K       G W+   ++GGW+  +GN 
Sbjct  364  QNSIPVWVFSGDQDSVVPLLGSRTLIRELAQEMKFKITVPFGAWFHKGQVGGWATEYGNL  423

Query  354  GRCNKVGNLTFATVRGGAHFVPSSSPSQALTLFKAFLKGSPPPRT  220
                    LTFATVRG AH VP + PS+AL LF +F++G   P T
Sbjct  424  --------LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNT  460



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1949878542686