BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1838

Length=1173
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004144543.1|  PREDICTED: chlorophyll a-b binding protein 1...    511   4e-179   Cucumis sativus [cucumbers]
emb|CDP19007.1|  unnamed protein product                                511   7e-179   Coffea canephora [robusta coffee]
ref|XP_002321186.1|  chlorophyll a/b-binding family protein             511   7e-179   Populus trichocarpa [western balsam poplar]
ref|XP_008462084.1|  PREDICTED: chlorophyll a-b binding protein 1...    510   1e-178   Cucumis melo [Oriental melon]
ref|XP_009365212.1|  PREDICTED: chlorophyll a-b binding protein 1...    511   1e-178   Pyrus x bretschneideri [bai li]
ref|XP_009630805.1|  PREDICTED: chlorophyll a-b binding protein 3...    510   1e-178   Nicotiana tomentosiformis
sp|P12062.1|CB26_PETSP  RecName: Full=Chlorophyll a-b binding pro...    510   1e-178   Petunia sp.
ref|XP_002531690.1|  chlorophyll A/B binding protein, putative          509   2e-178   Ricinus communis
ref|XP_009626274.1|  PREDICTED: chlorophyll a-b binding protein 3...    509   2e-178   Nicotiana tomentosiformis
sp|P27494.1|CB23_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    509   2e-178   Nicotiana tabacum [American tobacco]
dbj|BAE46383.1|  chlorophyll a/b binding protein                        509   3e-178   Panax ginseng [Asiatic ginseng]
ref|XP_011100602.1|  PREDICTED: chlorophyll a-b binding protein 5...    508   5e-178   Sesamum indicum [beniseed]
ref|XP_009802594.1|  PREDICTED: chlorophyll a-b binding protein 3...    508   8e-178   Nicotiana sylvestris
ref|XP_010270182.1|  PREDICTED: chlorophyll a-b binding protein 1...    508   1e-177   Nelumbo nucifera [Indian lotus]
gb|EYU42755.1|  hypothetical protein MIMGU_mgv1a011961mg                508   1e-177   Erythranthe guttata [common monkey flower]
gb|AFO67217.1|  putative chlorophyll a/b binding protein                507   2e-177   Aralia elata
gb|AEY78525.1|  chlorophyll a/b-binding protein                         507   2e-177   Tagetes erecta [big marigold]
gb|AHC95482.1|  chlorophyll A/B binding protein                         506   3e-177   Ziziphus jujuba [Chinese jujube]
ref|XP_002301582.1|  chlorophyll a/b-binding family protein             506   3e-177   Populus trichocarpa [western balsam poplar]
gb|AFJ25031.1|  chlorophyll a/b binding protein                         506   3e-177   Lonicera japonica [Japanese honeysuckle]
ref|XP_011039316.1|  PREDICTED: chlorophyll a-b binding protein 5...    506   5e-177   Populus euphratica
ref|XP_012081439.1|  PREDICTED: chlorophyll a-b binding protein 1...    505   7e-177   
ref|XP_006352013.1|  PREDICTED: chlorophyll a-b binding protein 3...    504   2e-176   Solanum tuberosum [potatoes]
ref|XP_004251540.1|  PREDICTED: chlorophyll a-b binding protein 5...    504   2e-176   
ref|XP_008379987.1|  PREDICTED: chlorophyll a-b binding protein 1...    504   2e-176   
ref|NP_001234739.1|  chlorophyll a-b binding protein 4, chloropla...    504   3e-176   Solanum lycopersicum
gb|ABK96530.1|  unknown                                                 504   3e-176   Populus trichocarpa x Populus deltoides
emb|CAA84525.1|  chlorophyll a,b binding protein type I                 504   3e-176   Solanum tuberosum [potatoes]
ref|XP_007215825.1|  hypothetical protein PRUPE_ppa010078mg             503   4e-176   Prunus persica
gb|AEK26372.1|  chloroplast photosystem II chlorophyll a/b bindin...    503   4e-176   Sedum alfredii
ref|XP_010112785.1|  Chlorophyll a-b binding protein 151                503   1e-175   Morus notabilis
gb|KDO58421.1|  hypothetical protein CISIN_1g024579mg                   502   1e-175   Citrus sinensis [apfelsine]
ref|XP_009618965.1|  PREDICTED: chlorophyll a-b binding protein 3...    502   2e-175   Nicotiana tomentosiformis
ref|XP_010252708.1|  PREDICTED: chlorophyll a-b binding protein 1...    502   2e-175   Nelumbo nucifera [Indian lotus]
ref|XP_006363015.1|  PREDICTED: chlorophyll a-b binding protein 4...    501   3e-175   Solanum tuberosum [potatoes]
ref|XP_008229895.1|  PREDICTED: chlorophyll a-b binding protein 1...    501   3e-175   Prunus mume [ume]
emb|CAA52750.1|  chlorophyll a/b binding protein                        501   4e-175   Amaranthus hypochondriacus [prince's feather]
ref|XP_006447758.1|  hypothetical protein CICLE_v10016280mg             501   4e-175   Citrus clementina [clementine]
ref|XP_008342193.1|  PREDICTED: chlorophyll a-b binding protein 1...    501   5e-175   Malus domestica [apple tree]
ref|XP_002271687.1|  PREDICTED: chlorophyll a-b binding protein 1...    501   6e-175   Vitis vinifera
ref|XP_009343482.1|  PREDICTED: chlorophyll a-b binding protein 1...    501   6e-175   
gb|AAL29886.1|M97171_1  chlorophyll a/b binding protein type II         500   7e-175   Glycine max [soybeans]
emb|CDY15050.1|  BnaC03g44110D                                          500   8e-175   Brassica napus [oilseed rape]
gb|AAC34983.1|  light harvesting chlorophyll A/B binding protein        500   1e-174   Prunus persica
ref|XP_004293460.1|  PREDICTED: chlorophyll a-b binding protein 1...    500   1e-174   Fragaria vesca subsp. vesca
gb|AAO62942.1|  chlorophyll a/b binding protein                         499   1e-174   Nicotiana tabacum [American tobacco]
ref|XP_009792415.1|  PREDICTED: chlorophyll a-b binding protein 3...    499   2e-174   Nicotiana sylvestris
ref|XP_009136161.1|  PREDICTED: chlorophyll a-b binding protein 1...    498   4e-174   Brassica rapa
ref|NP_001240183.1|  uncharacterized protein LOC100793702               498   4e-174   Glycine max [soybeans]
gb|AAD48017.1|AF165529_1  chlorophyll a/b binding protein               498   7e-174   Rumex palustris
ref|XP_003617948.1|  Chlorophyll a/b binding protein                    498   1e-173   Medicago truncatula
gb|AAD28771.1|AF134124_1  Lhcb2 protein                                 497   1e-173   Arabidopsis thaliana [mouse-ear cress]
gb|KJB06801.1|  hypothetical protein B456_001G192300                    497   1e-173   Gossypium raimondii
ref|XP_002885789.1|  Lhcb2 protein                                      497   1e-173   Arabidopsis lyrata subsp. lyrata
gb|AFW90566.1|  chlorophyll a/b-binding protein                         497   1e-173   Solanum tuberosum [potatoes]
gb|AII25433.1|  light-harvesting chlorophyll a/b binding protein        497   2e-173   Sedum alfredii
gb|AFK45982.1|  unknown                                                 497   2e-173   Lotus japonicus
ref|XP_009111582.1|  PREDICTED: chlorophyll a-b binding protein 3...    497   2e-173   Brassica rapa
ref|XP_010665939.1|  PREDICTED: chlorophyll a-b binding protein 5...    496   3e-173   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001241179.1|  uncharacterized protein LOC100815789               496   3e-173   Glycine max [soybeans]
ref|XP_010467054.1|  PREDICTED: chlorophyll a-b binding protein 1...    496   3e-173   Camelina sativa [gold-of-pleasure]
ref|XP_006296728.1|  hypothetical protein CARUB_v10014404mg             496   3e-173   Capsella rubella
ref|XP_007142492.1|  hypothetical protein PHAVU_008G285100g             496   3e-173   Phaseolus vulgaris [French bean]
gb|KJB10748.1|  hypothetical protein B456_001G220900                    496   3e-173   Gossypium raimondii
ref|XP_010045878.1|  PREDICTED: chlorophyll a-b binding protein 3...    496   4e-173   Eucalyptus grandis [rose gum]
gb|ACJ84374.1|  unknown                                                 496   5e-173   Medicago truncatula
gb|KJB06589.1|  hypothetical protein B456_001G192000                    496   5e-173   Gossypium raimondii
sp|P27518.2|CB21_GOSHI  RecName: Full=Chlorophyll a-b binding pro...    496   5e-173   Gossypium hirsutum [American cotton]
gb|AAD28769.1|AF134122_1  Lhcb2 protein                                 496   6e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397219.1|  PREDICTED: chlorophyll a-b binding protein 1...    495   6e-173   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_178585.1|  photosystem II light harvesting complex protein...    495   7e-173   Arabidopsis thaliana [mouse-ear cress]
gb|AFK45300.1|  unknown                                                 495   9e-173   Medicago truncatula
ref|XP_007049308.1|  Photosystem II light harvesting complex gene...    495   1e-172   Theobroma cacao [chocolate]
ref|XP_010412501.1|  PREDICTED: chlorophyll a-b binding protein 1...    494   2e-172   Camelina sativa [gold-of-pleasure]
ref|NP_178582.1|  photosystem II light harvesting complex protein...    494   2e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151928.1|  PREDICTED: chlorophyll a-b binding protein 5...    494   3e-172   Brassica rapa
gb|KFK23428.1|  hypothetical protein AALP_AAs45999U001400               494   3e-172   Arabis alpina [alpine rockcress]
emb|CDY13732.1|  BnaA06g31910D                                          494   4e-172   Brassica napus [oilseed rape]
ref|XP_010502775.1|  PREDICTED: chlorophyll a-b binding protein 5...    493   5e-172   Camelina sativa [gold-of-pleasure]
emb|CDY03989.1|  BnaC02g37040D                                          493   7e-172   
ref|XP_008810536.1|  PREDICTED: chlorophyll a-b binding protein 5...    493   7e-172   
ref|XP_010557706.1|  PREDICTED: chlorophyll a-b binding protein 5...    493   7e-172   Tarenaya hassleriana [spider flower]
ref|XP_006291684.1|  hypothetical protein CARUB_v10017845mg             493   9e-172   Capsella rubella
emb|CDY00149.1|  BnaC09g01520D                                          492   1e-171   
ref|XP_006395408.1|  hypothetical protein EUTSA_v10004777mg             492   2e-171   Eutrema salsugineum [saltwater cress]
ref|XP_006291597.1|  hypothetical protein CARUB_v10017751mg             493   2e-171   Capsella rubella
gb|ABO20852.1|  chlorophyll a/b binding protein of LHCII type I         492   2e-171   Lilium longiflorum [Easter lily]
gb|AAF89205.1|AF279248_1  LHCII type II chlorophyll a/b-binding p...    492   2e-171   Vigna radiata [mung bean]
ref|NP_189406.1|  photosystem II light harvesting complex protein...    491   2e-171   Arabidopsis thaliana [mouse-ear cress]
gb|AAW31512.1|  light-harvesting chlorophyll-a/b binding protein ...    491   5e-171   Pisum sativum [garden pea]
ref|XP_002875397.1|  LHCB2:4                                            490   7e-171   
gb|ABD92879.1|  chloroplast chlorophyll a/b binding protein             490   8e-171   Pachysandra terminalis
ref|XP_006836754.1|  PREDICTED: chlorophyll a-b binding protein 5...    490   8e-171   Amborella trichopoda
ref|XP_004491575.1|  PREDICTED: chlorophyll a-b binding protein 2...    489   1e-170   Cicer arietinum [garbanzo]
sp|P27520.1|CB215_PEA  RecName: Full=Chlorophyll a-b binding prot...    489   1e-170   Pisum sativum [garden pea]
ref|XP_010514479.1|  PREDICTED: chlorophyll a-b binding protein 5...    489   2e-170   Camelina sativa [gold-of-pleasure]
gb|KFK33681.1|  hypothetical protein AALP_AA5G045800                    489   2e-170   Arabis alpina [alpine rockcress]
emb|CDX83726.1|  BnaC07g24660D                                          489   2e-170   
ref|XP_010908796.1|  PREDICTED: chlorophyll a-b binding protein 5...    489   2e-170   Elaeis guineensis
ref|XP_002875398.1|  LHCB2:4                                            489   3e-170   Arabidopsis lyrata subsp. lyrata
sp|P12328.1|CB21_LEMGI  RecName: Full=Chlorophyll a-b binding pro...    488   6e-170   Lemna gibba
gb|KFK33683.1|  hypothetical protein AALP_AA5G046000                    487   1e-169   Arabis alpina [alpine rockcress]
gb|KFK33682.1|  hypothetical protein AALP_AA5G045900                    486   4e-169   Arabis alpina [alpine rockcress]
ref|NP_001050586.1|  Os03g0592500                                       485   1e-168   
gb|ABK21429.1|  unknown                                                 483   4e-168   Picea sitchensis
ref|XP_011005408.1|  PREDICTED: chlorophyll a-b binding protein 1...    483   4e-168   Populus euphratica
gb|AAC15992.1|  chlorophyll a/b binding protein                         483   4e-168   Oryza sativa Japonica Group [Japonica rice]
gb|AEZ49172.1|  chlorophyll a/b binding protein of LHCII type I         483   6e-168   Wolffia australiana
ref|XP_006664981.1|  PREDICTED: chlorophyll a-b binding protein, ...    482   1e-167   Oryza brachyantha
gb|ABK21859.1|  unknown                                                 481   2e-167   Picea sitchensis
dbj|BAA00537.1|  type II light-harvesting chlorophyll a/b-binding...    481   2e-167   Oryza sativa Japonica Group [Japonica rice]
gb|AFV34723.1|  light harvesting chlorophyll a/b-binding protein 2-1    481   3e-167   Dendrocalamus latiflorus [sweet bamboo]
gb|ABK21323.1|  unknown                                                 481   4e-167   Picea sitchensis
gb|ABR17665.1|  unknown                                                 481   5e-167   Picea sitchensis
prf||1707316B  chlorophyll a/b binding protein 2                        480   7e-167
gb|ABQ02464.1|  chloroplast chlorophyll a/b binding protein             479   1e-166   Phyllostachys edulis [kikko-chiku]
gb|AEW70716.1|  light harvesting chlorophyll a-b binding protein 2-1    479   2e-166   Phyllostachys edulis [kikko-chiku]
gb|AEO51757.1|  chloroplast chlorophyll A/B binding protein             479   2e-166   Dimocarpus longan [longan]
gb|ABR25974.1|  chloroplast chlorophyll a-b binding protein precu...    478   3e-166   Oryza sativa Indica Group [Indian rice]
emb|CAA43907.1|  chlorophyll a/b-binding protein                        478   8e-166   Pinus thunbergii [green pine]
gb|ABO10493.1|  light-harvesting chlorophyll a/b binding protein        477   8e-166   Bambusa oldhamii
gb|ABK22382.1|  unknown                                                 477   1e-165   Picea sitchensis
gb|ABQ02463.1|  chloroplast chlorophyll a/b binding protein             476   2e-165   Phyllostachys edulis [kikko-chiku]
gb|ABK21446.1|  unknown                                                 474   1e-164   Picea sitchensis
gb|AAV74408.1|  chloroplast chlorophyll A/B binding protein             473   2e-164   Manihot esculenta [manioc]
ref|NP_001148271.1|  chlorophyll a-b binding protein                    473   3e-164   Zea mays [maize]
ref|XP_004982492.1|  PREDICTED: chlorophyll a-b binding protein, ...    473   3e-164   Setaria italica
gb|AAB19040.1|  type 2 light-harvesting chlorophyll a/b-binding p...    473   4e-164   Pinus palustris [longleaf pine]
gb|ACG30954.1|  chlorophyll a-b binding protein                         473   6e-164   Zea mays [maize]
ref|XP_002466863.1|  hypothetical protein SORBIDRAFT_01g015400          470   5e-163   Sorghum bicolor [broomcorn]
gb|ABK22497.1|  unknown                                                 470   8e-163   Picea sitchensis
ref|XP_003562323.1|  PREDICTED: chlorophyll a-b binding protein, ...    469   2e-162   Brachypodium distachyon [annual false brome]
sp|P14279.1|CB25_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    465   2e-161   Solanum lycopersicum
gb|EMS46868.1|  Chlorophyll a-b binding protein, chloroplastic          466   3e-161   Triticum urartu
sp|P10049.1|CB21_PINTH  RecName: Full=Chlorophyll a-b binding pro...    464   1e-160   Pinus thunbergii [green pine]
emb|CAA89823.1|  light-harvesting chlorophyll a/b binding protein...    462   4e-160   Pseudotsuga menziesii
gb|KDO58422.1|  hypothetical protein CISIN_1g024579mg                   461   1e-159   Citrus sinensis [apfelsine]
gb|ACX54226.1|  chlorophyll A/B binding protein                         459   1e-158   Jatropha curcas
ref|XP_002986911.1|  light-harvesting complex                           458   3e-158   Selaginella moellendorffii
gb|AAB82142.1|  chlorophyll a-b binding protein                         456   2e-157   Oryza sativa Indica Group [Indian rice]
gb|EMT32028.1|  Chlorophyll a-b binding protein, chloroplastic          451   4e-156   
gb|ACO06088.1|  chlorophyll a-b binding protein                         452   6e-156   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001757271.1|  predicted protein                                  449   2e-154   
gb|ABK22798.1|  unknown                                                 447   6e-154   Picea sitchensis
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         446   2e-153   Sedum alfredii
prf||1615137A  chlorophyll a/b binding protein P25                      440   9e-152
gb|ABF97414.1|  Chlorophyll a-b binding protein, chloroplast prec...    439   2e-151   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001762089.1|  predicted protein                                  439   6e-151   
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    439   1e-150   Ginkgo biloba [ginkgo]
ref|XP_001755762.1|  predicted protein                                  437   4e-150   
emb|CAC38830.1|  chlorophyll a/b binding protein                        437   6e-150   Pinus contorta
emb|CAA47950.1|  chlorophyll a/b binding protein                        436   3e-149   Pinus contorta
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    436   3e-149   Picea abies
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    436   3e-149   Picea abies
gb|ABK20976.1|  unknown                                                 435   5e-149   Picea sitchensis
gb|ACN40194.1|  unknown                                                 433   2e-148   Picea sitchensis
ref|XP_001774812.1|  predicted protein                                  433   3e-148   
gb|AAC78690.1|  chlorophyll a/b-binding protein                         433   3e-148   Pinus thunbergii [green pine]
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    432   5e-148   Pinus sylvestris [Scotch pine]
sp|P15193.1|CB2A_PINSY  RecName: Full=Chlorophyll a-b binding pro...    432   1e-147   Pinus sylvestris [Scotch pine]
ref|XP_001779318.1|  predicted protein                                  431   2e-147   
ref|XP_001761868.1|  predicted protein                                  431   2e-147   
ref|XP_001751426.1|  predicted protein                                  431   2e-147   
gb|ABK22510.1|  unknown                                                 431   2e-147   Picea sitchensis
ref|XP_001774452.1|  predicted protein                                  431   3e-147   
gb|ACY66805.1|  chlorophyll a/b-binding protein                         430   5e-147   Pinus massoniana [Chinese red pine]
sp|P24006.1|CB2A_PYRPY  RecName: Full=Chlorophyll a-b binding pro...    429   1e-146   Pyrus pyrifolia [sha li]
ref|XP_002960494.1|  light-harvesting complex                           429   1e-146   Selaginella moellendorffii
ref|XP_002967230.1|  light-harvesting complex                           428   1e-146   
ref|XP_001751359.1|  predicted protein                                  428   3e-146   
emb|CAA48641.1|  type II light-harvesting chlorophyll a /b-bindin...    426   3e-146   Zea mays [maize]
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    427   7e-146   Populus euphratica
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    426   8e-146   Zea mays [maize]
gb|ACN40044.1|  unknown                                                 427   9e-146   Picea sitchensis
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    426   1e-145   Populus euphratica
ref|XP_001751602.1|  predicted protein                                  426   2e-145   
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  426   2e-145   Populus trichocarpa [western balsam poplar]
dbj|BAJ87356.1|  predicted protein                                      423   3e-145   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA80593.1|  chlorophyll a/b binding protein                         425   3e-145   Solanum tuberosum [potatoes]
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    425   3e-145   
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein o...    425   4e-145   Cucumis sativus [cucumbers]
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    425   4e-145   Malus domestica [apple tree]
ref|XP_001754234.1|  predicted protein                                  425   5e-145   
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    424   6e-145   Solanum tuberosum [potatoes]
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    424   7e-145   Solanum tuberosum [potatoes]
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    424   7e-145   Prunus mume [ume]
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  424   8e-145   Populus trichocarpa [western balsam poplar]
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          424   9e-145   Ricinus communis
ref|XP_011658281.1|  PREDICTED: chlorophyll a-b binding protein o...    424   1e-144   Cucumis sativus [cucumbers]
gb|AAC25775.1|  chlorophyll a/b binding protein                         424   1e-144   Medicago sativa [alfalfa]
ref|XP_004134608.2|  PREDICTED: chlorophyll a-b binding protein o...    424   1e-144   Cucumis sativus [cucumbers]
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    424   1e-144   Setaria italica
ref|XP_001754307.1|  predicted protein                                  424   1e-144   
gb|AAA80591.1|  chlorophyll a/b binding protein                         424   1e-144   Solanum tuberosum [potatoes]
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    424   1e-144   Solanum tuberosum [potatoes]
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    424   1e-144   Fragaria vesca subsp. vesca
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     425   1e-144   Eucalyptus grandis [rose gum]
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    423   1e-144   
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          423   1e-144   Sorghum bicolor [broomcorn]
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    423   2e-144   Populus euphratica
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             423   2e-144   Prunus persica
gb|AFK40061.1|  unknown                                                 423   2e-144   Medicago truncatula
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    423   2e-144   
ref|XP_006840304.2|  PREDICTED: chlorophyll a-b binding protein o...    423   2e-144   Amborella trichopoda
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       423   2e-144   Genlisea aurea
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  423   2e-144   Populus trichocarpa [western balsam poplar]
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             423   3e-144   Prunus persica
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    423   3e-144   Cucumis melo [Oriental melon]
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    423   3e-144   
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    422   3e-144   Prunus mume [ume]
emb|CAA57407.1|  light harvesting chlorophyll a /b-binding protei...    423   4e-144   Picea abies
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    422   4e-144   Sedum alfredii
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             422   4e-144   Prunus persica
ref|XP_001765456.1|  predicted protein                                  422   4e-144   
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    422   4e-144   Nicotiana sylvestris
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    422   4e-144   Eucalyptus grandis [rose gum]
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    425   5e-144   
gb|ACN40027.1|  unknown                                                 422   5e-144   Picea sitchensis
ref|XP_006856963.1|  PREDICTED: chlorophyll a-b binding protein o...    422   5e-144   Amborella trichopoda
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    422   5e-144   
gb|ABK22330.1|  unknown                                                 422   6e-144   Picea sitchensis
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    422   6e-144   Nicotiana tomentosiformis
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 422   6e-144   Morus notabilis
gb|ABK26071.1|  unknown                                                 422   6e-144   Picea sitchensis
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     426   6e-144   Eucalyptus grandis [rose gum]
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    421   6e-144   Cucumis sativus [cucumbers]
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    422   6e-144   Pisum sativum [garden pea]
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    422   7e-144   Pisum sativum [garden pea]
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    422   7e-144   
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    422   7e-144   Fragaria vesca subsp. vesca
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    422   7e-144   Cicer arietinum [garbanzo]
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein o...    422   7e-144   Cucumis sativus [cucumbers]
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    422   7e-144   Fragaria vesca subsp. vesca
prf||1204205B  protein 1B,chlorophyll binding                           421   8e-144
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             423   9e-144   
gb|ABK23849.1|  unknown                                                 422   9e-144   Picea sitchensis
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    421   9e-144   Populus euphratica
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    421   1e-143   Solanum tuberosum [potatoes]
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    421   1e-143   
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    421   1e-143   Kalanchoe fedtschenkoi [lavender-scallops]
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             421   1e-143   Pisum sativum [garden pea]
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    421   1e-143   Malus domestica [apple tree]
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    421   1e-143   Solanum nigrum
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...    421   1e-143   
ref|XP_006844081.1|  PREDICTED: chlorophyll a-b binding protein o...    421   1e-143   Amborella trichopoda
gb|AAA80594.1|  chlorophyll a/b binding protein                         421   1e-143   Solanum tuberosum [potatoes]
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    421   1e-143   Nicotiana sylvestris
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    421   2e-143   
ref|XP_001775090.1|  predicted protein                                  421   2e-143   
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    421   2e-143   Glycine max [soybeans]
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    421   2e-143   Nicotiana tomentosiformis
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    421   2e-143   Carya cathayensis
sp|P15195.1|CB23_POLMU  RecName: Full=Chlorophyll a-b binding pro...    421   2e-143   Polystichum munitum [common sword fern]
gb|AGZ15385.1|  chlorophyll a/b-binding protein (LHCII type II)         419   2e-143   Phaseolus vulgaris [French bean]
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             420   2e-143   Phaseolus vulgaris [French bean]
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein o...    421   2e-143   Cucumis sativus [cucumbers]
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    420   2e-143   Cucumis melo [Oriental melon]
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    420   2e-143   
gb|AAA80592.1|  chlorophyll a/b binding protein                         420   2e-143   Solanum tuberosum [potatoes]
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    420   3e-143   Cucumis melo [Oriental melon]
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       420   3e-143   Nicotiana sylvestris
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    420   3e-143   Nicotiana sylvestris
gb|AAA33636.1|  major chlorophyll binding protein                       421   3e-143   Physcomitrella patens
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    420   3e-143   Nicotiana tomentosiformis
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    420   3e-143   Fragaria vesca subsp. vesca
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    420   3e-143   Fragaria vesca subsp. vesca
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    420   3e-143   Vitis vinifera
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    420   3e-143   Sesamum indicum [beniseed]
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    420   4e-143   Nicotiana tomentosiformis
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    420   4e-143   Vitis vinifera
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             420   4e-143   Mangifera indica
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    420   4e-143   
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    420   4e-143   Solanum lycopersicum
ref|XP_011461952.1|  PREDICTED: chlorophyll a-b binding protein 1...    418   4e-143   Fragaria vesca subsp. vesca
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    420   4e-143   Nicotiana sylvestris
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    420   5e-143   Petunia sp.
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    419   5e-143   Nicotiana sylvestris
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    419   5e-143   Nicotiana sylvestris
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    419   5e-143   Pisum sativum [garden pea]
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    420   5e-143   
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    419   5e-143   
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    419   5e-143   
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        419   6e-143   
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    419   6e-143   
gb|AHM26643.1|  a-b binding protein                                     419   6e-143   
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 419   6e-143   
gb|AFW90512.1|  chlorophyll a/b-binding protein                         419   7e-143   
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    420   7e-143   
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    419   7e-143   
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    419   7e-143   
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    419   7e-143   
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    419   7e-143   
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    419   7e-143   
gb|ERN01979.1|  hypothetical protein AMTR_s00045p00069900               419   7e-143   
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    419   8e-143   
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    419   8e-143   
gb|ACU23816.1|  unknown                                                 419   8e-143   
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    419   8e-143   
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    419   8e-143   
gb|AAR10886.1|  chlorophyll a/b binding protein                         419   9e-143   
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    419   9e-143   
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    419   9e-143   
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    419   9e-143   
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    419   9e-143   
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    419   1e-142   
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    419   1e-142   
ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    419   1e-142   
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg                419   1e-142   
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             419   1e-142   
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    421   1e-142   
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    419   1e-142   
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    419   1e-142   
ref|XP_012072080.1|  PREDICTED: chlorophyll a-b binding protein o...    418   1e-142   
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg                418   1e-142   
ref|NP_565786.1|  photosystem II light harvesting complex protein...    418   2e-142   
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    418   2e-142   
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    418   2e-142   
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    418   2e-142   
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            418   2e-142   
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             418   2e-142   
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    418   2e-142   
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    418   2e-142   
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    418   2e-142   
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    418   2e-142   
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    418   2e-142   
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         418   2e-142   
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    418   2e-142   
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    418   3e-142   
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    417   3e-142   
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          417   3e-142   
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg                417   3e-142   
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    418   3e-142   
gb|EYU19649.1|  hypothetical protein MIMGU_mgv1a011927mg                417   3e-142   
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    417   3e-142   
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    417   3e-142   
ref|XP_007151990.1|  hypothetical protein PHAVU_004G092600g             417   3e-142   
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    417   3e-142   
ref|NP_001241277.1|  uncharacterized protein LOC100805310               417   3e-142   
gb|KEH25005.1|  light-harvesting complex I chlorophyll A/B-bindin...    417   3e-142   
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             417   3e-142   
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            417   3e-142   
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    417   3e-142   
ref|XP_006295385.1|  hypothetical protein CARUB_v10024479mg             417   4e-142   
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    417   4e-142   
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    417   4e-142   
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     417   4e-142   
dbj|BAA24493.1|  chlorophyll a/b-binding protein                        417   4e-142   
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    417   4e-142   
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    417   4e-142   
gb|AAF89207.1|AF279250_1  LHCII type I chlorophyll a/b-binding pr...    417   4e-142   
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    417   4e-142   
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        417   5e-142   
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    417   5e-142   
gb|KJB69716.1|  hypothetical protein B456_011G041600                    417   5e-142   
ref|XP_007151996.1|  hypothetical protein PHAVU_004G093000g             417   5e-142   
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             417   6e-142   
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    417   6e-142   
gb|KEH25006.1|  light-harvesting complex I chlorophyll A/B-bindin...    417   6e-142   
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    417   6e-142   
ref|XP_007151979.1|  hypothetical protein PHAVU_004G091600g             417   6e-142   
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    417   6e-142   
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    417   6e-142   
ref|XP_004489391.1|  PREDICTED: chlorophyll a-b binding protein 3...    417   7e-142   
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    417   7e-142   
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             417   7e-142   
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    417   7e-142   
gb|AHA84197.1|  chlorophyll a/b-binding protein                         416   7e-142   
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    416   7e-142   
ref|XP_010509756.1|  PREDICTED: chlorophyll a-b binding protein 1...    417   7e-142   
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative          416   8e-142   
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    416   8e-142   
emb|CDP06329.1|  unnamed protein product                                416   8e-142   
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...    416   8e-142   
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                  416   9e-142   
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             416   9e-142   
gb|ADI88502.1|  protoporphyrin IX magnesium chelatase                   416   9e-142   
gb|ABK25154.1|  unknown                                                 415   9e-142   
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 416   1e-141   
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                416   1e-141   
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    416   1e-141   
gb|ACU23974.1|  unknown                                                 416   1e-141   
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    415   1e-141   
gb|AAF89206.1|AF279249_1  LHCII type I chlorophyll a/b-binding pr...    416   1e-141   
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    416   1e-141   
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             416   1e-141   
ref|XP_010504897.1|  PREDICTED: chlorophyll a-b binding protein 1...    416   1e-141   
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...    416   1e-141   
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             416   1e-141   
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...    416   1e-141   
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    416   1e-141   
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg                416   1e-141   
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    416   1e-141   
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg                418   2e-141   
gb|AAB87573.1|  chlorophyll a/b binding protein of LHCII type I p...    416   2e-141   
gb|ABQ81857.1|  chloroplast chlorophyll a/b binding protein             416   2e-141   
emb|CDP06328.1|  unnamed protein product                                416   2e-141   
ref|XP_002455902.1|  hypothetical protein SORBIDRAFT_03g027040          416   2e-141   
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    416   2e-141   
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg                416   2e-141   
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...    416   2e-141   
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...    416   2e-141   
gb|KHN41291.1|  Chlorophyll a-b binding protein of LHCII type I, ...    414   2e-141   
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               416   2e-141   
gb|AEY85026.1|  light-harvesting complex II protein                     416   2e-141   
ref|XP_010231015.1|  PREDICTED: chlorophyll a-b binding protein o...    415   2e-141   
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...    416   2e-141   
dbj|BAJ90643.1|  predicted protein                                      415   2e-141   
ref|XP_006467509.1|  PREDICTED: chlorophyll a-b binding protein 3...    415   2e-141   
dbj|BAA03104.1|  light-harvesting chlorophyll a/b-binding protein...    415   2e-141   
ref|XP_004969083.1|  PREDICTED: chlorophyll a-b binding protein 2...    415   2e-141   
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                    415   3e-141   
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    415   3e-141   
gb|AAB61236.1|  chlorophyll a/b-binding protein                         415   3e-141   
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...    415   3e-141   
sp|P08963.1|CB22_HORVU  RecName: Full=Chlorophyll a-b binding pro...    415   4e-141   
gb|EYU35814.1|  hypothetical protein MIMGU_mgv1a011908mg                415   4e-141   
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...    415   4e-141   
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...    415   4e-141   
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg                414   4e-141   
gb|AAF26741.1|AF220527_1  chlorophyll a/b binding protein precursor     415   4e-141   
gb|AAA18529.1|  chlorophyll A/B binding protein                         414   5e-141   
gb|ABQ81856.1|  chloroplast chlorophyll a/b binding protein             414   5e-141   
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    414   5e-141   
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    413   5e-141   
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    414   5e-141   
gb|AFK39586.1|  unknown                                                 414   5e-141   
sp|P92919.1|CB23_APIGR  RecName: Full=Chlorophyll a-b binding pro...    414   5e-141   
gb|KJB57287.1|  hypothetical protein B456_009G156900                    414   6e-141   
ref|XP_010685893.1|  PREDICTED: chlorophyll a-b binding protein, ...    414   6e-141   
gb|AAZ79657.1|  putative chlorophyll a/b-binding protein                414   6e-141   
gb|AHA84168.1|  chlorophyll a/b-binding protein                         414   7e-141   
ref|XP_006449645.1|  hypothetical protein CICLE_v10016286mg             414   7e-141   
emb|CDP06330.1|  unnamed protein product                                414   7e-141   
gb|ABK23263.1|  unknown                                                 414   8e-141   
ref|XP_010666512.1|  PREDICTED: chlorophyll a-b binding protein, ...    414   8e-141   
ref|XP_010231410.1|  PREDICTED: chlorophyll a-b binding protein o...    414   8e-141   
dbj|BAJ90772.1|  predicted protein                                      414   9e-141   
ref|XP_006449643.1|  hypothetical protein CICLE_v10016287mg             414   9e-141   
ref|NP_174286.1|  chlorophyll A/B binding protein 1                     414   1e-140   
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...    414   1e-140   
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...    414   1e-140   
ref|NP_564339.1|  chlorophyll A/B binding protein 3                     414   1e-140   
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...    414   1e-140   
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    413   1e-140   
ref|NP_001062939.1|  Os09g0346500                                       413   1e-140   
ref|XP_010374558.1|  PREDICTED: chlorophyll a-b binding protein o...    412   2e-140   
gb|AAB18209.1|  chlorophyll a/b-binding protein WCAB precursor          413   2e-140   
ref|XP_007025148.1|  Chlorophyll a-b binding protein, chloroplastic     413   2e-140   
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    413   2e-140   
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...    413   2e-140   
gb|AAB61238.1|  chlorophyll a/b-binding protein                         413   2e-140   
gb|ACN31249.1|  unknown                                                 412   2e-140   
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...    413   2e-140   
gb|ACF84273.1|  unknown                                                 413   2e-140   
ref|XP_006368025.1|  PREDICTED: chlorophyll a-b binding protein 1...    413   2e-140   
gb|EMS45686.1|  Chlorophyll a-b binding protein, chloroplastic          413   2e-140   
ref|XP_002440263.1|  hypothetical protein SORBIDRAFT_09g028720          413   2e-140   
gb|AEV59642.1|  chloroplast photosystem II light harvesting compl...    412   2e-140   
ref|XP_003633024.1|  PREDICTED: chlorophyll a-b binding protein o...    413   2e-140   
gb|KFK44817.1|  hypothetical protein AALP_AA1G306700                    412   2e-140   
gb|EYU43278.1|  hypothetical protein MIMGU_mgv1a011933mg                412   3e-140   
ref|XP_002455901.1|  hypothetical protein SORBIDRAFT_03g027030          412   3e-140   
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                413   3e-140   
emb|CAN78667.1|  hypothetical protein VITISV_031287                     412   3e-140   
gb|AEV59643.1|  chloroplast photosystem II light harvesting compl...    411   3e-140   
ref|XP_002275075.1|  PREDICTED: chlorophyll a-b binding protein o...    412   3e-140   
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg             412   3e-140   
gb|EMT29002.1|  Chlorophyll a-b binding protein, chloroplastic          412   3e-140   
gb|KJB66916.1|  hypothetical protein B456_010G165100                    412   4e-140   
ref|XP_009416547.1|  PREDICTED: chlorophyll a-b binding protein o...    412   4e-140   
ref|XP_007025143.1|  Chlorophyll a-b binding protein, chloroplastic     412   4e-140   
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...    412   4e-140   
gb|EMS50797.1|  Chlorophyll a-b binding protein, chloroplastic          412   4e-140   
gb|ABM66819.1|  chloroplast light-harvesting chlorophyll a/b bind...    412   4e-140   
dbj|BAJ86427.1|  predicted protein                                      412   4e-140   
sp|P12469.1|CB23_NICPL  RecName: Full=Chlorophyll a-b binding pro...    412   4e-140   
gb|ACF85694.1|  unknown                                                 412   4e-140   
dbj|BAK02173.1|  predicted protein                                      412   4e-140   
ref|XP_006660556.1|  PREDICTED: chlorophyll a-b binding protein 2...    412   5e-140   
gb|AAG52048.1|AC022455_2  chlorophyll A-B-binding protein 2 precu...    411   5e-140   
gb|AGJ50622.1|  chlorophyll a/b binding protein                         412   5e-140   
gb|AAA33396.1|  light-harvesting chlorophyll a/b protein precursor      412   5e-140   
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...    412   5e-140   
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...    412   5e-140   
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203             412   5e-140   
ref|XP_010091411.1|  Chlorophyll a-b binding protein 16                 412   5e-140   
dbj|BAJ85110.1|  predicted protein                                      412   6e-140   
ref|XP_010052094.1|  PREDICTED: chlorophyll a-b binding protein o...    417   6e-140   
pdb|1VCR|A  Chain A, An Icosahedral Assembly Of Light-Harvesting ...    410   6e-140   
ref|XP_012072079.1|  PREDICTED: chlorophyll a-b binding protein o...    412   6e-140   
gb|EMS50796.1|  Chlorophyll a-b binding protein, chloroplastic          412   7e-140   
ref|XP_009400578.1|  PREDICTED: chlorophyll a-b binding protein o...    411   8e-140   
gb|AEO51755.1|  chloroplast chlorophyll A/B binding protein             411   8e-140   
emb|CAJ77390.1|  major chlorophyll a/b binding protein LHCb1.2          411   8e-140   
gb|AAB61237.1|  chlorophyll a/b-binding protein                         411   8e-140   
emb|CDX84316.1|  BnaC04g10780D                                          411   9e-140   
gb|AAL38341.1|  chlorophyll a/b-binding protein                         411   9e-140   
sp|P04779.1|CB21_PETSP  RecName: Full=Chlorophyll a-b binding pro...    411   9e-140   
ref|NP_001043493.1|  Os01g0600900                                       411   1e-139   
gb|KDP37944.1|  hypothetical protein JCGZ_04587                         411   1e-139   



>ref|XP_004144543.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Cucumis sativus]
 gb|KGN43422.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   511 bits (1317),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RKVG+ G ARFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGALGGARFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHVADPVANNAWAYATNFVPGK  265



>emb|CDP19007.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   511 bits (1315),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+ GIQQSAFAGQ+ALK Q +LLRKVGS G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSGIQQSAFAGQTALKPQNELLRKVGSFGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPV NNAWAYATNFVPGK
Sbjct  241  NLIDHLADPVTNNAWAYATNFVPGK  265



>ref|XP_002321186.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
 gb|EEE99501.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
Length=265

 Score =   511 bits (1315),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RKVGSSG  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSSGDGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAI+TGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIITGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLLDHLADPVANNAWAYATNFVPGK  265



>ref|XP_008462084.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Cucumis melo]
Length=265

 Score =   510 bits (1314),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RKVG+ G +RFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQAALKQSNELVRKVGAVGGSRFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHVADPVANNAWAYATNFVPGK  265



>ref|XP_009365212.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Pyrus x bretschneideri]
Length=287

 Score =   511 bits (1316),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 242/275 (88%), Positives = 259/275 (94%), Gaps = 0/275 (0%)
 Frame = +2

Query  95   KLRRAEESSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWY  274
            KL+  ++  +MA+  IQQSAFAGQ+ALK   +L+RK+G  G  RF+MRRTVKSAPQSIWY
Sbjct  13   KLQTEKKQQAMATSAIQQSAFAGQTALKQSNELVRKIGGLGGGRFSMRRTVKSAPQSIWY  72

Query  275  GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGAL  454
            GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGAL
Sbjct  73   GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGAL  132

Query  455  GCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGF  634
            GCVFPEILS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF
Sbjct  133  GCVFPEILSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGF  192

Query  635  VEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQ  814
            +EGYRVGGGPLGEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQ
Sbjct  193  IEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQ  252

Query  815  AIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AIVTGKGP+ENLFDH+ADPVANNAWAYATNFVPGK
Sbjct  253  AIVTGKGPVENLFDHIADPVANNAWAYATNFVPGK  287



>ref|XP_009630805.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   510 bits (1313),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALKSQ +L+RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAF ELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFTELKVKEMKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHVADPVANNAWAYATNFVPGK  265



>sp|P12062.1|CB26_PETSP RecName: Full=Chlorophyll a-b binding protein 37, chloroplastic; 
AltName: Full=LHCII type I CAB-37; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA28639.1| chlorophyll a/b binding protein [Petunia x hybrida]
Length=265

 Score =   510 bits (1313),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALKSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGP
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWA+ATNFVPGK
Sbjct  241  NLYDHVADPVANNAWAFATNFVPGK  265



>ref|XP_002531690.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF30681.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   509 bits (1312),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 245/265 (92%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKPSNELVRKVGSVGGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHVADPVANNAWAYATNFVPGK  265



>ref|XP_009626274.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Nicotiana tomentosiformis]
Length=265

 Score =   509 bits (1312),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALKSQ +L+RK+G     R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNELVRKIGCFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHVADPVANNAWAYATNFVPGK  265



>sp|P27494.1|CB23_TOBAC RecName: Full=Chlorophyll a-b binding protein 36, chloroplastic; 
AltName: Full=LHCII type I CAB-36; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41188.1| chlorophyll a/b binding protein [Nicotiana tabacum]
Length=265

 Score =   509 bits (1311),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  I+QSAFAGQ+ALKSQ +L+RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIEQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WASQVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHVADPVANNAWAYATNFVPGK  265



>dbj|BAE46383.1| chlorophyll a/b binding protein [Panax ginseng]
Length=265

 Score =   509 bits (1311),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ+SAFAGQ+ALK Q +L+RK+GS G  R TMRRTV+SAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQRSAFAGQTALKPQNELVRKIGSLGGGRITMRRTVRSAPESIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL++
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAR  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLYDHLADPVANNAWAYATNFVPGK  265



>ref|XP_011100602.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Sesamum 
indicum]
Length=266

 Score =   508 bits (1309),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 246/266 (92%), Positives = 254/266 (95%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGS-SGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+   QQSAF GQ+ALK Q +L+RKVG+ S   RFTMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MATSAFQQSAFGGQTALKPQNELIRKVGNVSAGGRFTMRRTVKSAPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILS
Sbjct  61   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  ENLFDHVADPVANNAWAYATNFVPGK  266



>ref|XP_009802594.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   508 bits (1308),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF+GQ+ALKSQ +L+RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFSGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAWA+ATNFVPGK
Sbjct  241  NLFDHIADPVANNAWAFATNFVPGK  265



>ref|XP_010270182.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Nelumbo nucifera]
Length=264

 Score =   508 bits (1307),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 255/265 (96%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK Q +L+RKVG SG  R +MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQQNELVRKVGVSG-GRISMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH+RWAMLGALGCVFPEIL+K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPEILAK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  180  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADP ANNAWAYATNFVPGK
Sbjct  240  NLFDHLADPAANNAWAYATNFVPGK  264



>gb|EYU42755.1| hypothetical protein MIMGU_mgv1a011961mg [Erythranthe guttata]
Length=265

 Score =   508 bits (1307),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF+G++ALK Q +L+RK+G+ G  RFTMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFSGKTALKPQNELIRKIGNVGGGRFTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEVLSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA+QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDKVYPGG+FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKVYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAWA+ATNFVPGK
Sbjct  241  NLFDHLADPVANNAWAFATNFVPGK  265



>gb|AFO67217.1| putative chlorophyll a/b binding protein [Aralia elata]
Length=265

 Score =   507 bits (1306),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK Q +L+RKVGS G    TMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKPQNELVRKVGSFGGGHITMRRTVKSAPESIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LG GLDK+YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGWGLDKIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLYDHLADPVANNAWAYATNFVPGK  265



>gb|AEY78525.1| chlorophyll a/b-binding protein [Tagetes erecta]
Length=265

 Score =   507 bits (1306),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAG +ALK Q +L++K GS    RFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGSAALKPQNELVKKTGSFTGGRFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEVLSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH++DPVANNAWAYATNFVPGK
Sbjct  241  NLFDHLSDPVANNAWAYATNFVPGK  265



>gb|AHC95482.1| chlorophyll A/B binding protein [Ziziphus jujuba]
Length=264

 Score =   506 bits (1304),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 245/265 (92%), Positives = 253/265 (95%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSGG-GRITMRRTVKSVPQSIWYGPDRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  120  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  180  LGEGLDPIYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPGK
Sbjct  240  NLYDHVADPVANNAWAYATNFVPGK  264



>ref|XP_002301582.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
 gb|ABK95270.1| unknown [Populus trichocarpa]
 gb|ABK95825.1| unknown [Populus trichocarpa]
 gb|EEE80855.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
Length=265

 Score =   506 bits (1304),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   DL+RKVGS G  R TMRRTVKSAPQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQQSAFAGQTALKQPNDLVRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGE+VWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGESVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+E
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLLDHLADPVANNAWAYATNFVPGK  265



>gb|AFJ25031.1| chlorophyll a/b binding protein [Lonicera japonica]
Length=265

 Score =   506 bits (1304),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ SAFAGQ+ LK Q +L+RKVGS GS+R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQHSAFAGQTVLKQQNELVRKVGSFGSSRTTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+E
Sbjct  181  LGEGLDSLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLYDHLADPVANNAWAYATNFVPGK  265



>ref|XP_011039316.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Populus 
euphratica]
Length=265

 Score =   506 bits (1302),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   DL+RKVGS G  R TMRRTVKSAPQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQQSAFAGQTALKQPNDLVRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLLDHLADPVANNAWAYATNFVPGK  265



>ref|XP_012081439.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Jatropha curcas]
 gb|KDP29912.1| hypothetical protein JCGZ_18481 [Jatropha curcas]
Length=265

 Score =   505 bits (1301),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSFGGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLSDHLADPVANNAWAYATNFVPGK  265



>ref|XP_006352013.1| PREDICTED: chlorophyll a-b binding protein 37, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   504 bits (1299),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALKSQ + +R +GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNEFIRTIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLSDHIADPVANNAWAYATNFVPGK  265



>ref|XP_004251540.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Solanum 
lycopersicum]
Length=265

 Score =   504 bits (1298),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ SAFAGQ+ALKSQ + +RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQHSAFAGQTALKSQNEFIRKIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLSDHIADPVANNAWAYATNFVPGK  265



>ref|XP_008379987.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Malus domestica]
Length=265

 Score =   504 bits (1298),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RK+G  G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSXELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILS+
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSR  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQAIVTGKGP+E
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHIADPVANNAWAYATNFVPGK  265



>ref|NP_001234739.1| chlorophyll a-b binding protein 4, chloroplastic [Solanum lycopersicum]
 sp|P14278.1|CB24_SOLLC RecName: Full=Chlorophyll a-b binding protein 4, chloroplastic; 
AltName: Full=LHCII type I CAB-4; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34141.1| chlorophyll a/b-binding protein precursor [Solanum lycopersicum]
Length=265

 Score =   504 bits (1298),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+C IQQSAF GQ+  KSQ + +RKVG+ G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATCAIQQSAFVGQAVGKSQNEFIRKVGNFGEGRITMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ DPVANNAWAYATNFVPGK
Sbjct  241  NLSDHINDPVANNAWAYATNFVPGK  265



>gb|ABK96530.1| unknown [Populus trichocarpa x Populus deltoides]
Length=265

 Score =   504 bits (1298),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   DL+RKVGS G  R TMRRTVKSAPQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQQSAFAGQTALKQPNDLVRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGE+VWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGESVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLA FSMFGFFVQAIVTGKGP+E
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLATFSMFGFFVQAIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLLDHLADPVANNAWAYATNFVPGK  265



>emb|CAA84525.1| chlorophyll a,b binding protein type I [Solanum tuberosum]
Length=265

 Score =   504 bits (1297),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALKSQ + +RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNEFIRKIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARN ELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNLELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLSDHIADPVANNAWAYATNFVPGK  265



>ref|XP_007215825.1| hypothetical protein PRUPE_ppa010078mg [Prunus persica]
 gb|EMJ17024.1| hypothetical protein PRUPE_ppa010078mg [Prunus persica]
Length=265

 Score =   503 bits (1296),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RK+G  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQAIVTGKGP+E
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPGK
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGK  265



>gb|AEK26372.1| chloroplast photosystem II chlorophyll a/b binding protein [Sedum 
alfredii]
 gb|AHB24930.1| chloroplast photosystem II light harvesting complex protein 2.1 
[Sedum alfredii]
Length=265

 Score =   503 bits (1296),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ SAFAGQ++LK Q +L+RKVG+    R TMRRTVKS PQSIWYG DRPKYLGP
Sbjct  1    MATSAIQSSAFAGQTSLKQQNELVRKVGNFSGGRATMRRTVKSTPQSIWYGADRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+E
Sbjct  181  LGEGLDKIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHLADPVANNAWAYATNFVPGK  265



>ref|XP_010112785.1| Chlorophyll a-b binding protein 151 [Morus notabilis]
 gb|EXC34900.1| Chlorophyll a-b binding protein 151 [Morus notabilis]
Length=265

 Score =   503 bits (1294),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RK G+ G  R TMRRTV+SAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKAGAVGGGRATMRRTVRSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPV NNAWAYATNFVPGK
Sbjct  241  NLVDHLADPVTNNAWAYATNFVPGK  265



>gb|KDO58421.1| hypothetical protein CISIN_1g024579mg [Citrus sinensis]
Length=265

 Score =   502 bits (1293),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+AL+   + +RKVG +   R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLYDHIADPVANNAWAYATNFVPGK  265



>ref|XP_009618965.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   502 bits (1293),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+  KSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTVAKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ DPVANNAWA+ATNFVPGK
Sbjct  241  NLFDHINDPVANNAWAFATNFVPGK  265



>ref|XP_010252708.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Nelumbo nucifera]
Length=264

 Score =   502 bits (1292),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 253/265 (95%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK Q +L+RKVG SG  R +MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQQNELVRKVGVSG-GRVSMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH+RWAMLGALGCVFPEIL K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHARWAMLGALGCVFPEILEK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAFQVVLMGFVEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  180  LGEGLDKIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADP +NNAWAYATNFVPG 
Sbjct  240  NLFDHLADPASNNAWAYATNFVPGN  264



>ref|XP_006363015.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   501 bits (1291),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+  KSQ + +RKVGS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQAVGKSQNEFVRKVGSFGEGRITMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ DPVANNAWAYATNFVPGK
Sbjct  241  NLSDHINDPVANNAWAYATNFVPGK  265



>ref|XP_008229895.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Prunus mume]
Length=265

 Score =   501 bits (1290),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  I QSAFAGQ+ALK   +L+RK+G  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIHQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQAIVTGKGP+E
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPGK
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGK  265



>emb|CAA52750.1| chlorophyll a/b binding protein [Amaranthus hypochondriacus]
Length=264

 Score =   501 bits (1290),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 252/265 (95%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+ LK Q +L+RKVG +G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSTIQQSAFVGQTLLKQQNELVRKVGGNG-GRFSMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIF EGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGP
Sbjct  120  NGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  180  LGEGLDKIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  240  NLSDHLADPVANNAWAYATNFVPGK  264



>ref|XP_006447758.1| hypothetical protein CICLE_v10016280mg [Citrus clementina]
 ref|XP_006469510.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Citrus sinensis]
 gb|ESR60998.1| hypothetical protein CICLE_v10016280mg [Citrus clementina]
Length=265

 Score =   501 bits (1290),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+AL+   + +RKVG +   R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLYDHIADPVANNAWAYATNFVPGK  265



>ref|XP_008342193.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Malus domestica]
Length=265

 Score =   501 bits (1289),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ+SAFAGQ+ LK   +L+RK+G  G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQRSAFAGQTVLKQSNELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQAIVTGKGP+E
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAWA+ATNFVPGK
Sbjct  241  NLFDHIADPVANNAWAFATNFVPGK  265



>ref|XP_002271687.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Vitis vinifera]
 emb|CAN71610.1| hypothetical protein VITISV_000630 [Vitis vinifera]
Length=265

 Score =   501 bits (1289),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ+SAFAGQ+ALK   +L+RKVG  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQRSAFAGQTALKQPNELVRKVGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDAIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLVDHLADPVANNAWAYATNFVPGK  265



>ref|XP_009343482.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Pyrus x bretschneideri]
Length=265

 Score =   501 bits (1289),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ LK   +L++K+G  G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTVLKQSNELVQKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGG FDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGVFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDHVADPVANNAWA+ATNFVPGK
Sbjct  241  NLFDHVADPVANNAWAFATNFVPGK  265



>gb|AAL29886.1|M97171_1 chlorophyll a/b binding protein type II [Glycine max]
Length=265

 Score =   500 bits (1288),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RK G +G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQLNELVRKTGGAGKGRTTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGQ  265



>emb|CDY15050.1| BnaC03g44110D [Brassica napus]
Length=265

 Score =   500 bits (1288),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNFVPGK
Sbjct  241  NLFDHLADPVANNAWSYATNFVPGK  265



>gb|AAC34983.1| light harvesting chlorophyll A/B binding protein [Prunus persica]
Length=265

 Score =   500 bits (1287),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RK+G  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+N ELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNGELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQAIVTGKGP+E
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPGK
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGK  265



>ref|XP_004293460.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=265

 Score =   500 bits (1287),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RK+GS G  R +MRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKPSNELVRKIGSLGGGRISMRRTVKSAPESIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+LSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMTSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPGK
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGK  265



>gb|AAO62942.1| chlorophyll a/b binding protein [Nicotiana tabacum]
Length=265

 Score =   499 bits (1286),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+  KSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTVAKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFD + DPVANNAWA+ATNFVPGK
Sbjct  241  NLFDQINDPVANNAWAFATNFVPGK  265



>ref|XP_009792415.1| PREDICTED: chlorophyll a-b binding protein 37, chloroplastic-like 
[Nicotiana sylvestris]
Length=265

 Score =   499 bits (1285),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF G++  KSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGRTVAKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DH+ DPVANNAWA+ATNFVPGK
Sbjct  241  NLYDHINDPVANNAWAFATNFVPGK  265



>ref|XP_009136161.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Brassica rapa]
 emb|CDX93077.1| BnaA03g37990D [Brassica napus]
Length=265

 Score =   498 bits (1283),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNFVPGK
Sbjct  241  NLFDHLADPVANNAWSYATNFVPGK  265



>ref|NP_001240183.1| uncharacterized protein LOC100793702 [Glycine max]
 gb|ACU18219.1| unknown [Glycine max]
 gb|KHN43946.1| Chlorophyll a-b binding protein 151, chloroplastic [Glycine soja]
Length=265

 Score =   498 bits (1283),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RK G +G  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQLNELVRKTGGAGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGQ  265



>gb|AAD48017.1|AF165529_1 chlorophyll a/b binding protein [Rumex palustris]
Length=264

 Score =   498 bits (1282),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 253/265 (95%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+ GIQ SA AGQ+ALK Q +L+RKVG +G  RF MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MAASGIQFSAIAGQTALKPQNELVRKVGGNG-GRFFMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLSK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGV+FGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  120  NGVQFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGE LDK+YPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+E
Sbjct  180  LGEDLDKLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  240  NLVDHIADPVANNAWAYATNFVPGK  264



>ref|XP_003617948.1| Chlorophyll a/b binding protein [Medicago truncatula]
 gb|AET00907.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=265

 Score =   498 bits (1281),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF G++ LK   + +RK GS G +RFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLKQGNEFIRKAGSFGQSRFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP++
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGQ  265



>gb|AAD28771.1|AF134124_1 Lhcb2 protein [Arabidopsis thaliana]
Length=265

 Score =   497 bits (1280),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK   +LLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNFVPGK
Sbjct  241  NLFDHLADPVANNAWSYATNFVPGK  265



>gb|KJB06801.1| hypothetical protein B456_001G192300 [Gossypium raimondii]
Length=265

 Score =   497 bits (1280),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+ALK   +LLRKVG+    R TMRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHLADPVANNAWAYATNFVPGK  265



>ref|XP_002885789.1| Lhcb2 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62048.1| Lhcb2 protein [Arabidopsis lyrata subsp. lyrata]
Length=265

 Score =   497 bits (1280),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK   DLLRK G SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKAGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNFVPGK
Sbjct  241  NLFDHLADPVANNAWSYATNFVPGK  265



>gb|AFW90566.1| chlorophyll a/b-binding protein [Solanum tuberosum]
Length=271

 Score =   497 bits (1280),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 237/263 (90%), Positives = 247/263 (94%), Gaps = 0/263 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+  KSQ + +RKVGS G +R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQAVGKSQNEFVRKVGSCGESRITMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSY TGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYSTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVP  913
            NL DH+ DPVANNAWAYATNFVP
Sbjct  241  NLSDHINDPVANNAWAYATNFVP  263



>gb|AII25433.1| light-harvesting chlorophyll a/b binding protein [Sedum alfredii]
Length=265

 Score =   497 bits (1279),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ SAFAGQ++LK Q +L+RKVG+    R TMRRTVKS PQSIWYG DRPKYLGP
Sbjct  1    MATSAIQSSAFAGQTSLKQQNELVRKVGNFSGGRATMRRTVKSTPQSIWYGADRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YP G+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQ IVTGKGP+E
Sbjct  181  LGEGLDKIYPXGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQXIVTGKGPVE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
             LFDH+ADPVANNAWAYATNFVPGK
Sbjct  241  XLFDHLADPVANNAWAYATNFVPGK  265



>gb|AFK45982.1| unknown [Lotus japonicus]
Length=265

 Score =   497 bits (1279),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+ALK   +LLRK G  G  RFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGQTALKQGNELLRKAGGFGKGRFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEIL +
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILER  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWA+ATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAFATNFVPGQ  265



>ref|XP_009111582.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Brassica rapa]
 emb|CDY20039.1| BnaA09g02120D [Brassica napus]
Length=265

 Score =   497 bits (1279),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S   R  MRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGRVVMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHVADPVANNAWAYATNFVPGK  265



>ref|XP_010665939.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 emb|CAA74179.1| chlorophyll a/b-binding protein [Beta vulgaris subsp. vulgaris]
Length=264

 Score =   496 bits (1278),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 252/265 (95%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ LK Q +L+RK G +G  R +MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSTIQQSAFAGQTILKPQNELVRKFGGNG-GRASMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIF EGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGP
Sbjct  120  NGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLDK+YPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  180  LGEGLDKLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWA+ATNFVPGK
Sbjct  240  NLSDHLADPVANNAWAFATNFVPGK  264



>ref|NP_001241179.1| uncharacterized protein LOC100815789 [Glycine max]
 gb|ACU19775.1| unknown [Glycine max]
 gb|KHN46928.1| Chlorophyll a-b binding protein 215, chloroplastic [Glycine soja]
Length=265

 Score =   496 bits (1278),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 247/265 (93%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+ALK   + +RK G +G  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGQTALKQLNEFVRKTGGAGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGQ  265



>ref|XP_010467054.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
 ref|XP_010488741.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   496 bits (1278),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNF PG+
Sbjct  241  NLFDHLADPVANNAWSYATNFAPGQ  265



>ref|XP_006296728.1| hypothetical protein CARUB_v10014404mg [Capsella rubella]
 gb|EOA29626.1| hypothetical protein CARUB_v10014404mg [Capsella rubella]
Length=265

 Score =   496 bits (1277),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQAALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNF PG+
Sbjct  241  NLFDHLADPVANNAWSYATNFAPGQ  265



>ref|XP_007142492.1| hypothetical protein PHAVU_008G285100g [Phaseolus vulgaris]
 gb|AGV54257.1| LHCII type II chlorophyll a/b-binding protein [Phaseolus vulgaris]
 gb|ESW14486.1| hypothetical protein PHAVU_008G285100g [Phaseolus vulgaris]
Length=265

 Score =   496 bits (1277),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 247/265 (93%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+   QQSAFAGQ+ALK   + +RK G SG  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAFQQSAFAGQTALKQVNEFVRKTGGSGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD VYPGG+FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDPVYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGQ  265



>gb|KJB10748.1| hypothetical protein B456_001G220900 [Gossypium raimondii]
Length=265

 Score =   496 bits (1277),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+ KVG+ G  R +MRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVCKVGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHLADPVANNAWAYATNFVPGK  265



>ref|XP_010045878.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Eucalyptus grandis]
 gb|KCW88692.1| hypothetical protein EUGRSUZ_A01047 [Eucalyptus grandis]
Length=265

 Score =   496 bits (1277),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK  ++L+RKVG+    R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATTVIQQSAFAGQTALKQSSELVRKVGNFAGGRATMRRTVKSVPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEIL K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILQK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADP ANNAWAYATNFVPGK
Sbjct  241  NLFDHLADPAANNAWAYATNFVPGK  265



>gb|ACJ84374.1| unknown [Medicago truncatula]
Length=265

 Score =   496 bits (1276),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF G++ LK   + +RK GS G +RFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLKQGNEFIRKAGSFGQSRFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA++VVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATRVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP++
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGQ  265



>gb|KJB06589.1| hypothetical protein B456_001G192000 [Gossypium raimondii]
 gb|KJB06590.1| hypothetical protein B456_001G192000 [Gossypium raimondii]
Length=265

 Score =   496 bits (1276),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+ALK   +LLRKVG+    R TMRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLLDHLADPVANNAWAYATNFVPGK  265



>sp|P27518.2|CB21_GOSHI RecName: Full=Chlorophyll a-b binding protein 151, chloroplastic; 
AltName: Full=LHCII type II CAB-151; Short=LHCP; Flags: 
Precursor [Gossypium hirsutum]
 emb|CAA38025.1| chlorophyll ab binding protein [Gossypium hirsutum]
 gb|KHG21776.1| Chlorophyll a-b binding protein, chloroplastic [Gossypium arboreum]
Length=265

 Score =   496 bits (1276),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+ K+G+ G  R +MRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVCKIGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLFDHLADPVANNAWAYATNFVPGK  265



>gb|AAD28769.1|AF134122_1 Lhcb2 protein [Arabidopsis thaliana]
Length=265

 Score =   496 bits (1276),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            M +  IQQS+FAGQ+ALK   +LLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MGTSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNFVPGK
Sbjct  241  NLFDHLADPVANNAWSYATNFVPGK  265



>ref|XP_009397219.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Musa acuminata subsp. malaccensis]
 gb|ABF70157.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=264

 Score =   495 bits (1275),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 251/265 (95%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  +QQSAFAGQ+ALK Q +L+R+VGSS   RF MRRT  S P+SIWYGPDRPKYLGP
Sbjct  1    MATSALQQSAFAGQTALKQQNELVRRVGSS-RGRFFMRRTTASTPKSIWYGPDRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEIL+K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLGALGCVFPEILAK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  180  LGEGLDAIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DH+ADPVANNAWAYATNFVPGK
Sbjct  240  NLYDHLADPVANNAWAYATNFVPGK  264



>ref|NP_178585.1| photosystem II light harvesting complex protein 2.1 [Arabidopsis 
thaliana]
 gb|AAD31358.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAK96468.1| At2g05100/F15L11.2 [Arabidopsis thaliana]
 gb|AAK96540.1| At2g05100/F15L11.2 [Arabidopsis thaliana]
 gb|AAN71932.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC05894.1| photosystem II light harvesting complex protein 2.1 [Arabidopsis 
thaliana]
Length=265

 Score =   495 bits (1275),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK   +LLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNFVPG 
Sbjct  241  NLFDHLADPVANNAWSYATNFVPGN  265



>gb|AFK45300.1| unknown [Medicago truncatula]
Length=265

 Score =   495 bits (1275),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF G++ LK   + +RK GS G +RFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLKQGNEFIRKAGSFGQSRFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVT KGP++
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTDKGPVQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGQ  265



>ref|XP_007049308.1| Photosystem II light harvesting complex gene 2.1 [Theobroma cacao]
 gb|EOX93465.1| Photosystem II light harvesting complex gene 2.1 [Theobroma cacao]
Length=265

 Score =   495 bits (1274),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RKVG  G  R TMRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGVFGGGRVTMRRTVKSAPASIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILS+
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSR  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADP  NNAWAYATNFVPGK
Sbjct  241  NLFDHLADPATNNAWAYATNFVPGK  265



>ref|XP_010412501.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   494 bits (1273),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK   DLLRKVG S   R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSSGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNF PG+
Sbjct  241  NLFDHLADPVANNAWSYATNFAPGQ  265



>ref|NP_178582.1| photosystem II light harvesting complex protein 2.2 [Arabidopsis 
thaliana]
 gb|AAD28770.1|AF134123_1 Lhcb2 protein [Arabidopsis thaliana]
 gb|AAD25595.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAL06878.1| At2g05070/F1O13.20 [Arabidopsis thaliana]
 gb|AAL32641.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAL47403.1| At2g05070/F1O13.20 [Arabidopsis thaliana]
 gb|AAM13371.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC05893.1| photosystem II light harvesting complex protein 2.2 [Arabidopsis 
thaliana]
Length=265

 Score =   494 bits (1273),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK  +DL++KVG  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSSDLIQKVGVLGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNFVPGK
Sbjct  241  NLFDHLADPVANNAWSYATNFVPGK  265



>ref|XP_009151928.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic-like 
[Brassica rapa]
 emb|CDY49770.1| BnaA02g29010D [Brassica napus]
Length=266

 Score =   494 bits (1271),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 237/266 (89%), Positives = 249/266 (94%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  ENLFDHVADPVANNAWAYATNFVPGK  266



>gb|KFK23428.1| hypothetical protein AALP_AAs45999U001400 [Arabis alpina]
Length=265

 Score =   494 bits (1271),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQS+FAGQ+ALK   ++LRKVG S   R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNEILRKVGVSSGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LA+DPE F+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLNLAEDPETFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAW+YATNFVPGK
Sbjct  241  NLFDHLADPVANNAWSYATNFVPGK  265



>emb|CDY13732.1| BnaA06g31910D [Brassica napus]
Length=266

 Score =   494 bits (1271),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 237/266 (89%), Positives = 249/266 (94%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPANDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  ENLFDHVADPVANNAWAYATNFVPGK  266



>ref|XP_010502775.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic-like 
[Camelina sativa]
Length=266

 Score =   493 bits (1269),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 236/266 (89%), Positives = 249/266 (94%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DLLRKVGSS G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGSSNGGGRIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDH+ADPVANNAWA+ATNFVPGK
Sbjct  241  ENLFDHIADPVANNAWAFATNFVPGK  266



>emb|CDY03989.1| BnaC02g37040D [Brassica napus]
Length=266

 Score =   493 bits (1269),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 237/266 (89%), Positives = 249/266 (94%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSVIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  ENLFDHVADPVANNAWAYATNFVPGK  266



>ref|XP_008810536.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Phoenix 
dactylifera]
Length=265

 Score =   493 bits (1269),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 236/264 (89%), Positives = 249/264 (94%), Gaps = 1/264 (0%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            A+  +Q+SAFAGQ+ALK Q +L+RKVG     R +MRRTVKSAPQS+WYGPDRPKYLGPF
Sbjct  3    AASALQRSAFAGQTALKQQNELVRKVGVF-QGRISMRRTVKSAPQSMWYGPDRPKYLGPF  61

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILS+N
Sbjct  62   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSRN  121

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPL
Sbjct  122  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPL  181

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  182  GEGLDAIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIEN  241

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            LFDH+ADP  NNAWAYATNFVPGK
Sbjct  242  LFDHLADPATNNAWAYATNFVPGK  265



>ref|XP_010557706.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Tarenaya 
hassleriana]
Length=266

 Score =   493 bits (1269),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 235/264 (89%), Positives = 247/264 (94%), Gaps = 0/264 (0%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            A+  IQ++AFAGQ+AL    + LRKVG S   R TMRRTVKSAPQSIWYGPDRPKYLGPF
Sbjct  3    ATSAIQKTAFAGQTALNQSNEFLRKVGVSSGGRVTMRRTVKSAPQSIWYGPDRPKYLGPF  62

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKN
Sbjct  63   SENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKN  122

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPL
Sbjct  123  GVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPL  182

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPL LA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  183  GEGLDPLYPGGAFDPLNLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIEN  242

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            L+DHVADPVANNAWAYATNFVPGK
Sbjct  243  LYDHVADPVANNAWAYATNFVPGK  266



>ref|XP_006291684.1| hypothetical protein CARUB_v10017845mg [Capsella rubella]
 gb|EOA24582.1| hypothetical protein CARUB_v10017845mg [Capsella rubella]
Length=266

 Score =   493 bits (1268),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 249/266 (94%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ LK   DLLRKVG+S G AR  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTTLKPSNDLLRKVGASNGGARIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDH+ADPVANNAWA+ATNFVPGK
Sbjct  241  ENLFDHIADPVANNAWAFATNFVPGK  266



>emb|CDY00149.1| BnaC09g01520D [Brassica napus]
Length=266

 Score =   492 bits (1267),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/266 (89%), Positives = 248/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+F GQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFTGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPGK
Sbjct  241  ENLFDHVADPVANNAWAYATNFVPGK  266



>ref|XP_006395408.1| hypothetical protein EUTSA_v10004777mg [Eutrema salsugineum]
 dbj|BAJ33772.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ32694.1| hypothetical protein EUTSA_v10004777mg [Eutrema salsugineum]
Length=266

 Score =   492 bits (1266),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 249/266 (94%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDH+ADPVANNAW+YATNFVPGK
Sbjct  241  ENLFDHLADPVANNAWSYATNFVPGK  266



>ref|XP_006291597.1| hypothetical protein CARUB_v10017751mg [Capsella rubella]
 gb|EOA24495.1| hypothetical protein CARUB_v10017751mg [Capsella rubella]
Length=293

 Score =   493 bits (1269),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 234/267 (88%), Positives = 250/267 (94%), Gaps = 1/267 (0%)
 Frame = +2

Query  122  SMASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYL  298
            +MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYL
Sbjct  27   AMATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRIVMRRTVKSTPQSIWYGPDRPKYL  86

Query  299  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL  478
            GPFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEIL
Sbjct  87   GPFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEIL  146

Query  479  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGG  658
            SKNGVKFGEAVWF+AG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GG
Sbjct  147  SKNGVKFGEAVWFRAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGG  206

Query  659  GPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP  838
            GPLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGP
Sbjct  207  GPLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGP  266

Query  839  IENLFDHVADPVANNAWAYATNFVPGK  919
            IENLFDH+ADPVANNAWA+ATNFVPGK
Sbjct  267  IENLFDHIADPVANNAWAFATNFVPGK  293



>gb|ABO20852.1| chlorophyll a/b binding protein of LHCII type I [Lilium longiflorum]
Length=264

 Score =   492 bits (1266),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 251/265 (95%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF GQ+ALK++ +L+RKVG  G  R +MRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFTGQTALKNRDELVRKVGVVG-GRVSMRRTVKSAPQSIWYGADRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYR+GGGP
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRIGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+E
Sbjct  180  LGEGLDPLYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DH+ADP  NNAWAYATNFVPGK
Sbjct  240  NLYDHLADPATNNAWAYATNFVPGK  264



>gb|AAF89205.1|AF279248_1 LHCII type II chlorophyll a/b-binding protein [Vigna radiata]
Length=265

 Score =   492 bits (1266),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 247/265 (93%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+   QQSAFAGQ+ALK   + +RK G SG  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATTAFQQSAFAGQTALKQVNEFVRKTGGSGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG VFPEIL K
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGIVFPEILEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKELKNGRLAMFS+FGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKELKNGRLAMFSVFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWAYATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAYATNFVPGQ  265



>ref|NP_189406.1| photosystem II light harvesting complex protein 2.3 [Arabidopsis 
thaliana]
 gb|AAD28772.1|AF134125_1 Lhcb2 protein [Arabidopsis thaliana]
 gb|AAK48984.1|AF370557_1 light harvesting chlorophyll a/b-binding protein [Arabidopsis 
thaliana]
 dbj|BAB02693.1| light harvesting chlorophyll a/b-binding protein [Arabidopsis 
thaliana]
 gb|AAP13406.1| At3g27700 [Arabidopsis thaliana]
 gb|AEE77352.1| photosystem II light harvesting complex protein 2.3 [Arabidopsis 
thaliana]
Length=266

 Score =   491 bits (1265),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 234/266 (88%), Positives = 248/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ LK   DLLRK+G+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTTLKPSNDLLRKIGASNGGGRIIMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDH+ADPVANNAWAYATNFVPGK
Sbjct  241  ENLFDHIADPVANNAWAYATNFVPGK  266



>gb|AAW31512.1| light-harvesting chlorophyll-a/b binding protein Lhcb2 [Pisum 
sativum]
Length=265

 Score =   491 bits (1263),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF G++ L+   + +RK G+ G ARFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLRQGNEFIRKAGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPE+L K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP++FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDSFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWA+ATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAFATNFVPGQ  265



>ref|XP_002875397.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51656.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   490 bits (1262),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 234/266 (88%), Positives = 248/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DL+RKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLIRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMF MFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFPMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDH+ADPVANNAWAYATNFVPGK
Sbjct  241  ENLFDHIADPVANNAWAYATNFVPGK  266



>gb|ABD92879.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=264

 Score =   490 bits (1262),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 248/265 (94%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  +QQSA AG++ALK Q +L++KVG  G  R +M RTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSALQQSALAGRTALKQQNELVKKVGVFG-GRISMHRTVKSTPQSIWYGPDRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGGP
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  180  LGEGLDSIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+AD  ANNAWAYATNFVPGK
Sbjct  240  NLFDHLADLAANNAWAYATNFVPGK  264



>ref|XP_006836754.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Amborella 
trichopoda]
 gb|ERM99607.1| hypothetical protein AMTR_s00088p00153020 [Amborella trichopoda]
Length=264

 Score =   490 bits (1262),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 250/265 (94%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ S+FAGQ+ LK Q++L +KVG+ G  R  MRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MAASAIQSSSFAGQTVLKPQSELAKKVGAYG-GRIFMRRTVKSVPQSIWYGPDRPKYLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  120  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  180  LGEGLDAIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NLFDH+ADPVANNAWAYATNFVPGK
Sbjct  240  NLFDHLADPVANNAWAYATNFVPGK  264



>ref|XP_004491575.1| PREDICTED: chlorophyll a-b binding protein 215, chloroplastic-like 
[Cicer arietinum]
Length=265

 Score =   489 bits (1260),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 232/265 (88%), Positives = 247/265 (93%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF G++ L+   + +RK GS G  RFTMRRTVKS P+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLRQGNEFIRKAGSFGQGRFTMRRTVKSTPESIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAM SMFGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMTSMFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWA+ATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAFATNFVPGQ  265



>sp|P27520.1|CB215_PEA RecName: Full=Chlorophyll a-b binding protein 215, chloroplastic; 
AltName: Full=LHCII type II CAB-215; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 emb|CAA40365.1| chlorophyll a/b-binding protein [Pisum sativum]
Length=265

 Score =   489 bits (1260),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAF G++ L+   + +RK G+ G ARFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLRQGNEFIRKRGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPE+L K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP++FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI+
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDSFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQ  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL+DHVADPVANNAWA+ATNFVPG+
Sbjct  241  NLYDHVADPVANNAWAFATNFVPGQ  265



>ref|XP_010514479.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Camelina 
sativa]
Length=266

 Score =   489 bits (1259),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 234/266 (88%), Positives = 247/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S F+GQ+ALK   DLLRKVGSS G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSTFSGQTALKPSNDLLRKVGSSNGGGRIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPVANNAWA+ATNFVPGK
Sbjct  241  ENLSDHIADPVANNAWAFATNFVPGK  266



>gb|KFK33681.1| hypothetical protein AALP_AA5G045800 [Arabis alpina]
Length=266

 Score =   489 bits (1259),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 234/266 (88%), Positives = 248/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYG DRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGADRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL+DH+ADPVANNAWAYATNFVPGK
Sbjct  241  ENLYDHLADPVANNAWAYATNFVPGK  266



>emb|CDX83726.1| BnaC07g24660D [Brassica napus]
Length=266

 Score =   489 bits (1259),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 247/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNF P K
Sbjct  241  ENLFDHVADPVANNAWAYATNFAPVK  266



>ref|XP_010908796.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Elaeis 
guineensis]
Length=265

 Score =   489 bits (1258),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 237/266 (89%), Positives = 250/266 (94%), Gaps = 2/266 (1%)
 Frame = +2

Query  125  MASC-GIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MAS    Q+SAFAGQ+ALK Q +L++KVG     R +MRRTVKSAPQS+WYGPDRPKYLG
Sbjct  1    MASASAFQRSAFAGQTALKRQNELVQKVGVF-EGRISMRRTVKSAPQSMWYGPDRPKYLG  59

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEIL+
Sbjct  60   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILA  119

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  120  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLG+GLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  180  PLGQGLDAIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPI  239

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDH+ADP ANNAWAYATNFVPGK
Sbjct  240  ENLFDHLADPAANNAWAYATNFVPGK  265



>ref|XP_002875398.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51657.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   489 bits (1258),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 234/266 (88%), Positives = 248/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+F GQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQYSSFTGQTALKPSNDLLRKVGASNGGGRVIMRRTVKSTPQSIWYGPDRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLG+PNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGSPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDH+ADPVANNAWAYATNFVPGK
Sbjct  241  ENLFDHIADPVANNAWAYATNFVPGK  266



>sp|P12328.1|CB21_LEMGI RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor [Lemna 
gibba]
 gb|AAA33392.1| chlorophyll a/b apoprotein [Lemna gibba]
Length=264

 Score =   488 bits (1256),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 232/265 (88%), Positives = 251/265 (95%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ SAFAGQ+ALK + +L+RKVG S   RF+MRRTVK+ PQSIWYG DRPK+LGP
Sbjct  1    MAASAIQSSAFAGQTALKQRDELVRKVGVS-DGRFSMRRTVKAVPQSIWYGADRPKFLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC+FPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGV+FGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA+QVVLMG +EGYRVGGGP
Sbjct  120  NGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  180  LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWA+ATNFVPGK
Sbjct  240  NLADHIADPVANNAWAFATNFVPGK  264



>gb|KFK33683.1| hypothetical protein AALP_AA5G046000 [Arabis alpina]
Length=266

 Score =   487 bits (1254),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 233/266 (88%), Positives = 247/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSA-RFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S    R  MRRTVKS PQSIWYG DRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNDGGRVVMRRTVKSTPQSIWYGADRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEGLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL+DH+ADPVANNAWAYATNFVPGK
Sbjct  241  ENLYDHLADPVANNAWAYATNFVPGK  266



>gb|KFK33682.1| hypothetical protein AALP_AA5G045900 [Arabis alpina]
Length=266

 Score =   486 bits (1251),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 233/266 (88%), Positives = 247/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYG DRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGADRPKYLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE LD +YPGGAFDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  181  PLGEVLDPLYPGGAFDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL+DH+ADPVANNAWAYATNFVPGK
Sbjct  241  ENLYDHLADPVANNAWAYATNFVPGK  266



>ref|NP_001050586.1| Os03g0592500 [Oryza sativa Japonica Group]
 sp|Q10HD0.1|CB23_ORYSJ RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Oryza sativa Japonica Group]
 sp|A2XJ35.1|CB23_ORYSI RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Oryza sativa Indica Group]
 gb|AAT81763.1| chlorophyll a/b binding protein [Oryza sativa Japonica Group]
 gb|ABF97413.1| Chlorophyll a-b binding protein, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12500.1| Os03g0592500 [Oryza sativa Japonica Group]
 gb|EAY90845.1| hypothetical protein OsI_12453 [Oryza sativa Indica Group]
 gb|EAZ27662.1| hypothetical protein OsJ_11611 [Oryza sativa Japonica Group]
 gb|AFI71846.1| chlorophyll a/b binbing protein [Oryza sativa]
Length=263

 Score =   485 bits (1248),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 238/266 (89%), Positives = 249/266 (94%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  + +  L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPGK
Sbjct  238  ENLFDHVADPVANNAWAYATNFVPGK  263



>gb|ABK21429.1| unknown [Picea sitchensis]
 gb|ABK22448.1| unknown [Picea sitchensis]
 gb|ABK23914.1| unknown [Picea sitchensis]
 gb|ABK24064.1| unknown [Picea sitchensis]
 gb|ABK26103.1| unknown [Picea sitchensis]
 gb|ABK26818.1| unknown [Picea sitchensis]
 gb|ABR17641.1| unknown [Picea sitchensis]
 gb|ACN39896.1| unknown [Picea sitchensis]
 gb|ACN39974.1| unknown [Picea sitchensis]
 gb|ACN40033.1| unknown [Picea sitchensis]
 gb|ACN40585.1| unknown [Picea sitchensis]
 gb|ACN40649.1| unknown [Picea sitchensis]
Length=266

 Score =   483 bits (1244),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 232/264 (88%), Positives = 249/264 (94%), Gaps = 2/264 (1%)
 Frame = +2

Query  131  SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPL
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPL  182

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  183  GEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIEN  242

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            LFDH+ADP ANNAWAYATNFVPGK
Sbjct  243  LFDHLADPTANNAWAYATNFVPGK  266



>ref|XP_011005408.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Populus euphratica]
Length=265

 Score =   483 bits (1244),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RKVG SG  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGCSGDGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPL LADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLDLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNFVPGK
Sbjct  241  NLLDHLADPVANNAWAYATNFVPGK  265



>gb|AAC15992.1| chlorophyll a/b binding protein [Oryza sativa Japonica Group]
Length=263

 Score =   483 bits (1243),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 237/266 (89%), Positives = 248/266 (93%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  + +  L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYP GAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPSGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPGK
Sbjct  238  ENLFDHVADPVANNAWAYATNFVPGK  263



>gb|AEZ49172.1| chlorophyll a/b binding protein of LHCII type I [Wolffia australiana]
Length=264

 Score =   483 bits (1243),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 229/265 (86%), Positives = 250/265 (94%), Gaps = 1/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQ+SA AGQ  L+ + +L+RKVG S   R +MRRTVK+APQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQKSALAGQRGLRQRDELVRKVGVS-DGRVSMRRTVKAAPQSIWYGPDRPKFLGP  59

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH+RWAMLGALGC+FPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCIFPELLSK  119

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGF+EGYRVGGGP
Sbjct  120  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFIEGYRVGGGP  179

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+E
Sbjct  180  LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE  239

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAW+YATNFVPG 
Sbjct  240  NLSDHLADPVANNAWSYATNFVPGN  264



>ref|XP_006664981.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Oryza brachyantha]
Length=263

 Score =   482 bits (1241),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 237/266 (89%), Positives = 247/266 (93%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQSA-FAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+  F G +  + +  L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTGFLGTAPRRDE--LVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADP ANNAWAYATNFVPGK
Sbjct  238  ENLFDHVADPAANNAWAYATNFVPGK  263



>gb|ABK21859.1| unknown [Picea sitchensis]
 gb|ABK21874.1| unknown [Picea sitchensis]
 gb|ABK24058.1| unknown [Picea sitchensis]
 gb|ABK24837.1| unknown [Picea sitchensis]
 gb|ABK26095.1| unknown [Picea sitchensis]
 gb|ACN39796.1| unknown [Picea sitchensis]
 gb|ACN40179.1| unknown [Picea sitchensis]
Length=266

 Score =   481 bits (1239),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 231/264 (88%), Positives = 248/264 (94%), Gaps = 2/264 (1%)
 Frame = +2

Query  131  SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKT  122

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPL
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPL  182

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  183  GEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIEN  242

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            LFDH+ADP ANNAWAYATNFVPGK
Sbjct  243  LFDHLADPTANNAWAYATNFVPGK  266



>dbj|BAA00537.1| type II light-harvesting chlorophyll a/b-binding protein [Oryza 
sativa Japonica Group]
Length=263

 Score =   481 bits (1239),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 248/266 (93%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  +   D++R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DVVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELE+IHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELELIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHV DPVANNAW+YATNFVPGK
Sbjct  238  ENLFDHVTDPVANNAWSYATNFVPGK  263



>gb|AFV34723.1| light harvesting chlorophyll a/b-binding protein 2-1 [Dendrocalamus 
latiflorus]
Length=263

 Score =   481 bits (1238),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 236/266 (89%), Positives = 248/266 (93%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  + +  L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYR+GGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRIGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPV NNAWAYATNFVPGK
Sbjct  238  ENLFDHVADPVNNNAWAYATNFVPGK  263



>gb|ABK21323.1| unknown [Picea sitchensis]
Length=266

 Score =   481 bits (1237),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 231/264 (88%), Positives = 248/264 (94%), Gaps = 2/264 (1%)
 Frame = +2

Query  131  SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+ AP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRIAPESIWYGPDRPKYLGPF  62

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPL
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPL  182

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  183  GEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIEN  242

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            LFDH+ADP ANNAWAYATNFVPGK
Sbjct  243  LFDHLADPTANNAWAYATNFVPGK  266



>gb|ABR17665.1| unknown [Picea sitchensis]
Length=266

 Score =   481 bits (1237),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 231/264 (88%), Positives = 248/264 (94%), Gaps = 2/264 (1%)
 Frame = +2

Query  131  SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQV LMG +EGYRVGGGPL
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVGLMGLIEGYRVGGGPL  182

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  183  GEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIEN  242

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            LFDH+ADP ANNAWAYATNFVPGK
Sbjct  243  LFDHLADPTANNAWAYATNFVPGK  266



>prf||1707316B chlorophyll a/b binding protein 2
Length=263

 Score =   480 bits (1235),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 247/266 (93%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  +   DL+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELE+IHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELELIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIV GKGPI
Sbjct  178  PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVRGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHV DPVANNAWAYATNFVPGK
Sbjct  238  ENLFDHVTDPVANNAWAYATNFVPGK  263



>gb|ABQ02464.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=263

 Score =   479 bits (1234),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 236/266 (89%), Positives = 247/266 (93%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  +QQ+ +F G +  + +  L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALQQTTSFLGTAPRRDE--LVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKN RLAMFSMFGFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNSRLAMFSMFGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DHVADPV NNAWAYATNFVPGK
Sbjct  238  ENLADHVADPVNNNAWAYATNFVPGK  263



>gb|AEW70716.1| light harvesting chlorophyll a-b binding protein 2-1 [Phyllostachys 
edulis]
Length=263

 Score =   479 bits (1233),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 237/266 (89%), Positives = 247/266 (93%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G  A   + +L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLG--AAPRRDELVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEF GDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFAGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPV NNAWAYATNFVPGK
Sbjct  238  ENLFDHVADPVNNNAWAYATNFVPGK  263



>gb|AEO51757.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=265

 Score =   479 bits (1233),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 230/265 (87%), Positives = 244/265 (92%), Gaps = 0/265 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  +Q S+FAGQ++L    + +RKVGS G  R TMRRTVKS P SIWYGPDRPKYLGP
Sbjct  1    MATTALQHSSFAGQTSLNLSNEFIRKVGSFGEGRITMRRTVKSVPASIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYR+GGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRIGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIV GKGPIE
Sbjct  181  LGEGLDPLYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVPGKGPIE  240

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL D +A PVANNAWAYA NFVPGK
Sbjct  241  NLSDPLAAPVANNAWAYAPNFVPGK  265



>gb|ABR25974.1| chloroplast chlorophyll a-b binding protein precursor [Oryza 
sativa Indica Group]
Length=253

 Score =   478 bits (1231),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 232/246 (94%), Positives = 238/246 (97%), Gaps = 1/246 (0%)
 Frame = +2

Query  182  QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW  361
            + +L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDY W
Sbjct  9    RDELVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYRW  67

Query  362  DTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS  541
            DTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS
Sbjct  68   DTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS  127

Query  542  EGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGL  721
            EGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGL
Sbjct  128  EGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGL  187

Query  722  ADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYAT  901
            ADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYAT
Sbjct  188  ADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYAT  247

Query  902  NFVPGK  919
            NFVPGK
Sbjct  248  NFVPGK  253



>emb|CAA43907.1| chlorophyll a/b-binding protein [Pinus thunbergii]
Length=266

 Score =   478 bits (1229),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 228/264 (86%), Positives = 248/264 (94%), Gaps = 2/264 (1%)
 Frame = +2

Query  131  SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            +  IQ S+ AGQ+ L+  Q +L++KVG++  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPQQNELVKKVGTA-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SE TPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGC+FPE+L+KN
Sbjct  63   SEGTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCLFPELLAKN  122

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPL
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPL  182

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  183  GEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIEN  242

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            L+DH+ADPVANNAWAYATNFVPGK
Sbjct  243  LYDHLADPVANNAWAYATNFVPGK  266



>gb|ABO10493.1| light-harvesting chlorophyll a/b binding protein [Bambusa oldhamii]
Length=263

 Score =   477 bits (1228),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 246/266 (92%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  + +  L+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRHVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNREL VIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELGVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYR+GGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRIGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPV NNAWAYATNFVPGK
Sbjct  238  ENLFDHVADPVNNNAWAYATNFVPGK  263



>gb|ABK22382.1| unknown [Picea sitchensis]
 gb|ABK23122.1| unknown [Picea sitchensis]
 gb|ABK26462.1| unknown [Picea sitchensis]
 gb|ABR16136.1| unknown [Picea sitchensis]
 gb|ACN40237.1| unknown [Picea sitchensis]
Length=266

 Score =   477 bits (1228),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/264 (88%), Positives = 246/264 (93%), Gaps = 2/264 (1%)
 Frame = +2

Query  131  SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            +  IQ S+ AGQ+ L+  Q +L+ KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQISSLAGQTLLRPQQNELVSKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPL
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAFQVVLMGLIEGYRVGGGPL  182

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  183  GEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  242

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            LFDH+ADP  NNAWAYATNFVPGK
Sbjct  243  LFDHLADPANNNAWAYATNFVPGK  266



>gb|ABQ02463.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=263

 Score =   476 bits (1226),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 236/266 (89%), Positives = 246/266 (92%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G  A   + +L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLG--AAPRRDELVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEF GDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFAGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKNG LAMFSMFGFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGSLAMFSMFGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPV NNAWAYATNFVPGK
Sbjct  238  ENLFDHVADPVNNNAWAYATNFVPGK  263



>gb|ABK21446.1| unknown [Picea sitchensis]
Length=266

 Score =   474 bits (1221),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 245/264 (93%), Gaps = 2/264 (1%)
 Frame = +2

Query  131  SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            +  IQ S+ AGQ+ L+  Q +L+ KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQISSLAGQTLLRPQQNELVSKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SEQTPSYLTGEFPGDY WDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYRWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPL
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAFQVVLMGLIEGYRVGGGPL  182

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  183  GEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  242

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            LFDH+ADP  NNAWAYATNFVPGK
Sbjct  243  LFDHLADPANNNAWAYATNFVPGK  266



>gb|AAV74408.1| chloroplast chlorophyll A/B binding protein [Manihot esculenta]
Length=243

 Score =   473 bits (1218),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 227/243 (93%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = +2

Query  191  LLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA  370
            L+RK GS G  RF+MRRTVKSAP SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA
Sbjct  1    LVRKXGSFGGGRFSMRRTVKSAPPSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA  60

Query  371  GLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGG  550
            GLSADPETFA+NRELEVIH RWAMLGALGCVFPE+LSKNGVKFGEAVWFKAGAQIFSEGG
Sbjct  61   GLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSKNGVKFGEAVWFKAGAQIFSEGG  120

Query  551  LDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADD  730
            LDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGAFDPLGLADD
Sbjct  121  LDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADD  180

Query  731  PEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFV  910
            P+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENLFDH+ADPVANNAWAYATNFV
Sbjct  181  PDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNAWAYATNFV  240

Query  911  PGK  919
            PGK
Sbjct  241  PGK  243



>ref|NP_001148271.1| chlorophyll a-b binding protein [Zea mays]
 ref|XP_008665042.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Zea 
mays]
 gb|ACG30372.1| chlorophyll a-b binding protein [Zea mays]
 gb|ACR34075.1| unknown [Zea mays]
 tpg|DAA50197.1| TPA: type II light-harvesting chlorophyll a /b-binding protein 
isoform 1 [Zea mays]
 tpg|DAA50198.1| TPA: type II light-harvesting chlorophyll a /b-binding protein 
isoform 2 [Zea mays]
 tpg|DAA50201.1| TPA: light harvesting chlorophyll binding protein9 isoform 1 
[Zea mays]
 tpg|DAA50202.1| TPA: light harvesting chlorophyll binding protein9 isoform 2 
[Zea mays]
Length=260

 Score =   473 bits (1218),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 231/266 (87%), Positives = 240/266 (90%), Gaps = 7/266 (3%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F GQ+ +       R  G     R TMRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVS------RAAGVDAGGRITMRRTVKSVPQSIWYGPDRPKYLG  54

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL+
Sbjct  55   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  114

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  115  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  174

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  175  PLGEGLDKVYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  234

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPG 
Sbjct  235  ENLFDHVADPVANNAWAYATNFVPGN  260



>ref|XP_004982492.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   473 bits (1218),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 231/266 (87%), Positives = 241/266 (91%), Gaps = 6/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F GQ+ +           +    R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVSRPA-----AAADAGGRITMRRTVKSAPQSIWYGPDRPKYLG  55

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL+
Sbjct  56   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  115

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  116  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  175

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  176  PLGEGLDKVYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  235

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPGK
Sbjct  236  ENLFDHVADPVANNAWAYATNFVPGK  261



>gb|AAB19040.1| type 2 light-harvesting chlorophyll a/b-binding polypeptide, 
partial [Pinus palustris]
Length=246

 Score =   473 bits (1216),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 225/247 (91%), Positives = 239/247 (97%), Gaps = 1/247 (0%)
 Frame = +2

Query  179  SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYG  358
             Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYG
Sbjct  1    QQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYG  59

Query  359  WDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIF  538
            WDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+KNGVKFGEAVWFKAGAQIF
Sbjct  60   WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGAQIF  119

Query  539  SEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLG  718
            SEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGAFDPLG
Sbjct  120  SEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPLG  179

Query  719  LADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYA  898
            LADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYA
Sbjct  180  LADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANNAWAYA  239

Query  899  TNFVPGK  919
            TNFVPGK
Sbjct  240  TNFVPGK  246



>gb|ACG30954.1| chlorophyll a-b binding protein [Zea mays]
Length=260

 Score =   473 bits (1216),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 231/266 (87%), Positives = 240/266 (90%), Gaps = 7/266 (3%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F GQ+ +       R  G     R TMRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVA------RAAGVDAGDRITMRRTVKSVPQSIWYGPDRPKYLG  54

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL+
Sbjct  55   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  114

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  115  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  174

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  175  PLGEGLDKVYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  234

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPG 
Sbjct  235  ENLFDHVADPVANNAWAYATNFVPGN  260



>ref|XP_002466863.1| hypothetical protein SORBIDRAFT_01g015400 [Sorghum bicolor]
 gb|EER93861.1| hypothetical protein SORBIDRAFT_01g015400 [Sorghum bicolor]
Length=262

 Score =   470 bits (1210),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 231/266 (87%), Positives = 240/266 (90%), Gaps = 5/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F GQ+ +          G     R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVSRPAAAAADAG----GRITMRRTVKSAPQSIWYGPDRPKYLG  56

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL+
Sbjct  57   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  116

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  117  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  176

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFDPLGLADDP+  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI
Sbjct  177  PLGEGLDKVYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  236

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENLFDHVADPVANNAWAYATNFVPG 
Sbjct  237  ENLFDHVADPVANNAWAYATNFVPGN  262



>gb|ABK22497.1| unknown [Picea sitchensis]
 gb|ABK24164.1| unknown [Picea sitchensis]
 gb|ABK26145.1| unknown [Picea sitchensis]
 gb|ABR17447.1| unknown [Picea sitchensis]
 gb|ABR17727.1| unknown [Picea sitchensis]
 gb|ACN39972.1| unknown [Picea sitchensis]
 gb|ACN40388.1| unknown [Picea sitchensis]
Length=266

 Score =   470 bits (1209),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 241/254 (95%), Gaps = 2/254 (1%)
 Frame = +2

Query  161  GQSALKSQ-TDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTG  337
            GQ+ L+ Q  +L+RKVG S  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQTPSYLTG
Sbjct  14   GQTLLRPQHNELVRKVGMS-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEQTPSYLTG  72

Query  338  EFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWF  517
            EFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+K GVKFGEAVWF
Sbjct  73   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKTGVKFGEAVWF  132

Query  518  KAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPG  697
            KAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLD +YPG
Sbjct  133  KAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDPLYPG  192

Query  698  GAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVA  877
            GAFDPLGLADDPE+FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADP A
Sbjct  193  GAFDPLGLADDPESFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPTA  252

Query  878  NNAWAYATNFVPGK  919
            NNAWAYATNFVPGK
Sbjct  253  NNAWAYATNFVPGK  266



>ref|XP_003562323.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Brachypodium 
distachyon]
Length=263

 Score =   469 bits (1207),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 243/265 (92%), Gaps = 4/265 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFIEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDK+YPGGAFDPLGLADDP+  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  178  PLGEGLDKIYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPV  237

Query  842  ENLFDHVADPVANNAWAYATNFVPG  916
            ENLFDHVADPV NNAWA+ATNF PG
Sbjct  238  ENLFDHVADPVNNNAWAFATNFAPG  262



>sp|P14279.1|CB25_SOLLC RecName: Full=Chlorophyll a-b binding protein 5, chloroplastic; 
AltName: Full=LHCII type I CAB-5; Short=LHCP; Flags: Precursor, 
partial [Solanum lycopersicum]
 gb|AAA34142.1| chlorophyll a/b-binding protein precursor, partial [Solanum lycopersicum]
Length=237

 Score =   465 bits (1197),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 223/232 (96%), Positives = 227/232 (98%), Gaps = 0/232 (0%)
 Frame = +2

Query  224  RFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAR  403
            R TMRRTVKSAPQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAR
Sbjct  6    RVTMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAR  65

Query  404  NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIH  583
            NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIH
Sbjct  66   NRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIH  125

Query  584  AQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKE  763
            AQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDK+YPGGAFDPLGLADDPEAFAELKVKE
Sbjct  126  AQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKE  185

Query  764  LKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            +KNGRLAMFSMFGFFVQAIVTGKGPIENL DH+ADPVANNAWAYATNFVPGK
Sbjct  186  IKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHIADPVANNAWAYATNFVPGK  237



>gb|EMS46868.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=263

 Score =   466 bits (1199),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 242/265 (91%), Gaps = 4/265 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  118  KNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLD +YPGGAFDPLGLADDP+  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  178  PLGEGLDIIYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPV  237

Query  842  ENLFDHVADPVANNAWAYATNFVPG  916
            ENLFDHVADPV NNAWA+ATNF PG
Sbjct  238  ENLFDHVADPVNNNAWAFATNFAPG  262



>sp|P10049.1|CB21_PINTH RecName: Full=Chlorophyll a-b binding protein type I, chloroplastic; 
Short=CAB; Short=LHCP; Flags: Precursor [Pinus thunbergii]
 emb|CAA31773.1| chlorophylla/b-binding preprotein (AA -37 to 229) [Pinus thunbergii]
Length=266

 Score =   464 bits (1195),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 222/261 (85%), Positives = 242/261 (93%), Gaps = 2/261 (1%)
 Frame = +2

Query  140  IQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQ  316
            IQ S+ AGQ+ L+  Q +L++KVG++  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSE 
Sbjct  7    IQSSSLAGQTLLRPQQNELVKKVGTA-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEG  65

Query  317  TPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVK  496
            TPSYLTGEFPGDYGWDTA +SADPETFA+NRELEVIH RWAMLGALGCVFPE+L+KNG+K
Sbjct  66   TPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLK  125

Query  497  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEG  676
            FGEAVWFKAGAQIFSEGGLDY GNPNLIHAQSILAIWA QVVLMG +EGYRVGGG LGEG
Sbjct  126  FGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGTLGEG  185

Query  677  LDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFD  856
            LD + PGGAFDPLGLADDPEA AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL+D
Sbjct  186  LDPLLPGGAFDPLGLADDPEACAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYD  245

Query  857  HVADPVANNAWAYATNFVPGK  919
            H+ADPVANNAWAYATNFVPGK
Sbjct  246  HLADPVANNAWAYATNFVPGK  266



>emb|CAA89823.1| light-harvesting chlorophyll a/b binding protein of photosystem 
II [Pseudotsuga menziesii]
Length=234

 Score =   462 bits (1188),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 220/234 (94%), Positives = 228/234 (97%), Gaps = 0/234 (0%)
 Frame = +2

Query  218  SARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETF  397
             AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETF
Sbjct  1    QARITMRRTVRSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETF  60

Query  398  ARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL  577
            A+NRELEVIHSRWAMLGALGCVFPE+L+KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL
Sbjct  61   AKNRELEVIHSRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL  120

Query  578  IHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKV  757
            IHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGAFDPLGLADDPEAFAELKV
Sbjct  121  IHAQSILAIWAFQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKV  180

Query  758  KELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDH+ADP ANNAWAYATNFVPGK
Sbjct  181  KELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPTANNAWAYATNFVPGK  234



>gb|KDO58422.1| hypothetical protein CISIN_1g024579mg [Citrus sinensis]
Length=229

 Score =   461 bits (1185),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/229 (96%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = +2

Query  233  MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRE  412
            MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRE
Sbjct  1    MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRE  60

Query  413  LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  592
            LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS
Sbjct  61   LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  120

Query  593  ILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKN  772
            ILAIWA QVVLMGFVEGYR+GGGPLGEGLD +YPGGAFDPLGLADDP+ FAELKVKELKN
Sbjct  121  ILAIWACQVVLMGFVEGYRIGGGPLGEGLDPLYPGGAFDPLGLADDPDQFAELKVKELKN  180

Query  773  GRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            GRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct  181  GRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK  229



>gb|ACX54226.1| chlorophyll A/B binding protein [Jatropha curcas]
Length=261

 Score =   459 bits (1181),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  304
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSFGGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGP
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGP  180

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGEGLD +YPGGAFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIE
Sbjct  181  LGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIE  240

Query  845  N  847
            N
Sbjct  241  N  241



>ref|XP_002986911.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ11993.1| light-harvesting complex [Selaginella moellendorffii]
Length=267

 Score =   458 bits (1179),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 231/252 (92%), Gaps = 0/252 (0%)
 Frame = +2

Query  161  GQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGE  340
            GQ+ALKS  +L RKVG+ G AR  MRRT  S P SIWYGPDRPK+LGPFSEQTPSYLTGE
Sbjct  15   GQTALKSPNELSRKVGNLGEARTVMRRTRASTPDSIWYGPDRPKFLGPFSEQTPSYLTGE  74

Query  341  FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFK  520
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCV PE+L+KNG+KFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNGIKFGEAVWFK  134

Query  521  AGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGG  700
            AG+QIF EGGLDYLGNPNL+HAQSILAIWASQV+LMG VEGYRVGGGPLGEGLDK+YPGG
Sbjct  135  AGSQIFKEGGLDYLGNPNLVHAQSILAIWASQVILMGAVEGYRVGGGPLGEGLDKIYPGG  194

Query  701  AFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVAN  880
            AFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFF QAIVTGKGPIENL DH+ +P  N
Sbjct  195  AFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFTQAIVTGKGPIENLLDHLDNPTVN  254

Query  881  NAWAYATNFVPG  916
            NAWAYATNF PG
Sbjct  255  NAWAYATNFTPG  266



>gb|AAB82142.1| chlorophyll a-b binding protein [Oryza sativa Indica Group]
Length=263

 Score =   456 bits (1174),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 224/266 (84%), Positives = 239/266 (90%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  + +  L+R+VG+SG  R TMRRTVKSAPQ+IWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGNSG-GRITMRRTVKSAPQNIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTG+FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEILS
Sbjct  58   PFSEQTPSYLTGKFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCFFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGV FGEAVWFKAGAQIFSEGGLDYLGNP L+  QSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVNFGEAVWFKAGAQIFSEGGLDYLGNPALVRPQSILAIWAVQVVLMGFVEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGEGLDKVYPGGAFD LGLA+DP+ FAE KVKE  NGRLAMFSM GFFVQAIVTGKGPI
Sbjct  178  PLGEGLDKVYPGGAFDHLGLAEDPDTFAEFKVKEFNNGRLAMFSMLGFFVQAIVTGKGPI  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            EN FDHVADPVANNAWAYATNFVPGK
Sbjct  238  ENFFDHVADPVANNAWAYATNFVPGK  263



>gb|EMT32028.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=229

 Score =   451 bits (1161),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  233  MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRE  412
            MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRE
Sbjct  1    MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRE  60

Query  413  LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  592
            LEVIHSRWAMLGALGCVFPEILSKNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQS
Sbjct  61   LEVIHSRWAMLGALGCVFPEILSKNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQS  120

Query  593  ILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKN  772
            ILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGGAFDPLGLADDP+  AELKVKELKN
Sbjct  121  ILAIWAVQVVLMGFIEGYRVGGGPLGEGLDIIYPGGAFDPLGLADDPDTAAELKVKELKN  180

Query  773  GRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPG  916
            GRLAMFSMFGFFVQAIVTGKGP+ENLFDHVADPV NNAWA+ATNF PG
Sbjct  181  GRLAMFSMFGFFVQAIVTGKGPVENLFDHVADPVNNNAWAFATNFAPG  228



>gb|ACO06088.1| chlorophyll a-b binding protein [Triticum aestivum]
Length=263

 Score =   452 bits (1163),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 221/265 (83%), Positives = 238/265 (90%), Gaps = 4/265 (2%)
 Frame = +2

Query  125  MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  118  KNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PL EGLD +YPGGAFDPLGLADDP+  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  178  PLDEGLDIIYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPV  237

Query  842  ENLFDHVADPVANNAWAYATNFVPG  916
            ENLFD + DP  NNAWA+AT+F PG
Sbjct  238  ENLFDQLRDPGNNNAWAFATHFCPG  262



>ref|XP_001757271.1| predicted protein [Physcomitrella patens]
 gb|EDQ77756.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   449 bits (1154),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 216/264 (82%), Positives = 235/264 (89%), Gaps = 1/264 (0%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            A+  +  +  AGQS LK   +L RKVGSS  AR TMRRTVKS   SIWYG DRPKYLGPF
Sbjct  3    AATAMHSTTLAGQSLLKPVNELSRKVGSS-EARVTMRRTVKSTSDSIWYGADRPKYLGPF  61

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            S +TPSYLTGEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+K+
Sbjct  62   SGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKS  121

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQVVLMG VEGYRV GGPL
Sbjct  122  GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVVLMGAVEGYRVAGGPL  181

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GE  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+EN
Sbjct  182  GEITDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEN  241

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            L DH+ADPVANNAWAYATNFVPG 
Sbjct  242  LNDHLADPVANNAWAYATNFVPGN  265



>gb|ABK22798.1| unknown [Picea sitchensis]
Length=253

 Score =   447 bits (1149),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 220/264 (83%), Positives = 236/264 (89%), Gaps = 15/264 (6%)
 Frame = +2

Query  131  SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA             MLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFA-------------MLGALGCVFPELLAKT  109

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPL
Sbjct  110  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPL  169

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIEN
Sbjct  170  GEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIEN  229

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            LFDH+ADP ANNAWAYATNFVPGK
Sbjct  230  LFDHLADPTANNAWAYATNFVPGK  253



>gb|AHB24928.1| chloroplast chlorophyll a-b binding protein 2/3 [Sedum alfredii]
Length=267

 Score =   446 bits (1147),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 223/239 (93%), Gaps = 4/239 (2%)
 Frame = +2

Query  215  GSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  382
            GS R TMR+T      SA  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GSGRVTMRKTAAKPKPSASSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  383  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  562
            DPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  563  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAF  742
            GNPNL+HAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YPGG+FDPLGLADDPEAF
Sbjct  149  GNPNLVHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGSFDPLGLADDPEAF  208

Query  743  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLFDH+ADPVANNAWAYATNFV GK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLFDHLADPVANNAWAYATNFVLGK  267



>prf||1615137A chlorophyll a/b binding protein P25
Length=226

 Score =   440 bits (1132),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 209/226 (92%), Positives = 219/226 (97%), Gaps = 0/226 (0%)
 Frame = +2

Query  242  TVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEV  421
            TV+SAP+SIWYGPDRPKYLGPFSE TPSYLTGEFPGDYGWDTA +SADPETFA+NRELEV
Sbjct  1    TVRSAPESIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEV  60

Query  422  IHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA  601
            IH RWAMLGALGCVFPE+L KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA
Sbjct  61   IHCRWAMLGALGCVFPELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA  120

Query  602  IWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRL  781
            IWA QVVLMG +EGYRVGGGPLGEGLD +YPGGAFDPLGLADDPEAFAELKVKE+KNGRL
Sbjct  121  IWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRL  180

Query  782  AMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct  181  AMFSMFGFFVQAIVTGKGPIENLYDHLADPVANNAWAYATNFVPGK  226



>gb|ABF97414.1| Chlorophyll a-b binding protein, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=219

 Score =   439 bits (1129),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  272  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  451
            YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA
Sbjct  4    YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  63

Query  452  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG  631
            LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG
Sbjct  64   LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMG  123

Query  632  FVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFV  811
            FVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFV
Sbjct  124  FVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFV  183

Query  812  QAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            QAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK
Sbjct  184  QAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  219



>ref|XP_001762089.1| predicted protein [Physcomitrella patens]
 gb|EDQ73193.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   439 bits (1130),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 213/266 (80%), Positives = 235/266 (88%), Gaps = 4/266 (2%)
 Frame = +2

Query  125  MASC-GIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  301
            MA+C     +A AGQ+ALKS  +L RKVG+   AR TMR+   S+  SIWYG DRPKYLG
Sbjct  1    MAACTATHSTALAGQTALKSINELSRKVGNV-QARVTMRKA--SSSDSIWYGADRPKYLG  57

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            P S +TPSYLTGEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+
Sbjct  58   PLSGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLA  117

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYRV GG
Sbjct  118  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRVAGG  177

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  178  PLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  237

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPVANNAWAYATNFVPG 
Sbjct  238  ENLSDHLADPVANNAWAYATNFVPGN  263



>gb|AAA60965.1| light-harvesting chlorophyll a/b binding protein of photosystem 
II [Ginkgo biloba]
Length=270

 Score =   439 bits (1129),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 214/271 (79%), Positives = 236/271 (87%), Gaps = 6/271 (2%)
 Frame = +2

Query  119  SSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRT----VKSAPQSIWYGPDR  286
            ++MAS G+  SAFAGQ  LK Q + +   G  G  R TMR+T    V ++  S WYGPDR
Sbjct  2    ATMASAGVASSAFAGQIVLKPQNEFVG--GVHGEGRITMRKTASKKVVASSGSPWYGPDR  59

Query  287  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  466
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVF
Sbjct  60   VKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  119

Query  467  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  646
            PE+LS+NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  120  PELLSRNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGY  179

Query  647  RVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVT  826
            R+ GGPLGE  D +YPGG+FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQAIVT
Sbjct  180  RIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVT  239

Query  827  GKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            GKGPIENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  240  GKGPIENLADHLADPVNNNAWAFATNFVPGK  270



>ref|XP_001755762.1| predicted protein [Physcomitrella patens]
 gb|EDQ79435.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   437 bits (1125),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 208/264 (79%), Positives = 231/264 (88%), Gaps = 1/264 (0%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            A+  +  +A AGQS LK   +L RKVG+   AR +MR+T   +  SIWYG DRPKYLGPF
Sbjct  3    AATAMHSTALAGQSLLKPVNELSRKVGNV-EARISMRKTASKSSDSIWYGADRPKYLGPF  61

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            S +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+KN
Sbjct  62   SGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKN  121

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYRV GGPL
Sbjct  122  GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRVAGGPL  181

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            G+  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+EN
Sbjct  182  GDVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEN  241

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            L DH+ADPVANNAWAYATNF PG 
Sbjct  242  LNDHLADPVANNAWAYATNFTPGN  265



>emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   437 bits (1125),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 217/274 (79%), Positives = 236/274 (86%), Gaps = 9/274 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  277
            MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKAATKKVSVSASTSPWYG  60

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQA
Sbjct  181  EGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQA  240

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGPIENL DH+ADPV+NNAWAYATNFVPGK
Sbjct  241  IVTGKGPIENLADHLADPVSNNAWAYATNFVPGK  274



>emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   436 bits (1121),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 216/274 (79%), Positives = 235/274 (86%), Gaps = 9/274 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  277
            MASCGI    FAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCGFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSVSASTSPWYG  60

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQA
Sbjct  181  EGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQA  240

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGPIENL DH+ADPV+NNAWAYATNFVPGK
Sbjct  241  IVTGKGPIENLADHLADPVSNNAWAYATNFVPGK  274



>emb|CAA57408.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-1 [Picea 
abies]
Length=274

 Score =   436 bits (1120),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 218/274 (80%), Positives = 235/274 (86%), Gaps = 9/274 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  277
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLLGVGAGVHGEARVTMRKSSTKKVSASASPSPWYG  60

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAV  180

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQA
Sbjct  181  EGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQA  240

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  241  IVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  274



>emb|CAA57409.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-2 [Picea 
abies]
Length=275

 Score =   436 bits (1120),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 218/275 (79%), Positives = 235/275 (85%), Gaps = 10/275 (4%)
 Frame = +2

Query  125  MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK------SAPQSIWY  274
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++        SA  S WY
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLLGVGAGVHGEARVTMRKSSTTKKVSASASPSPWY  60

Query  275  GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGAL  454
            GPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGAL
Sbjct  61   GPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGAL  120

Query  455  GCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGF  634
            GCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG 
Sbjct  121  GCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGA  180

Query  635  VEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQ  814
            VEGYR+ GGPLGE  D +YPGG+FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQ
Sbjct  181  VEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQ  240

Query  815  AIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AIVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  241  AIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  275



>gb|ABK20976.1| unknown [Picea sitchensis]
 gb|ABK21395.1| unknown [Picea sitchensis]
 gb|ABK25775.1| unknown [Picea sitchensis]
 gb|ABR17147.1| unknown [Picea sitchensis]
 gb|ABR17370.1| unknown [Picea sitchensis]
 gb|ACN39891.1| unknown [Picea sitchensis]
 gb|ACN40202.1| unknown [Picea sitchensis]
 gb|ACN40506.1| unknown [Picea sitchensis]
 gb|ACN40508.1| unknown [Picea sitchensis]
Length=274

 Score =   435 bits (1119),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 217/274 (79%), Positives = 235/274 (86%), Gaps = 9/274 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  277
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLVGVGAGVHGEARVTMRKSSTKKVSASASTSPWYG  60

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQA
Sbjct  181  EGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQA  240

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  241  IVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  274



>gb|ACN40194.1| unknown [Picea sitchensis]
Length=274

 Score =   433 bits (1114),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 216/274 (79%), Positives = 235/274 (86%), Gaps = 9/274 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  277
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLVGVGAGVHGEARVTMRKSSTKKVSASASTSPWYG  60

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR  YLGPFS + PS+LTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSHLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFFVQA
Sbjct  181  EGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQA  240

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  241  IVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  274



>ref|XP_001774812.1| predicted protein [Physcomitrella patens]
 dbj|BAD08519.1| light-harvesting chlorophyll a/b-binding protein 2 [Physcomitrella 
patens]
 gb|EDQ60353.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   433 bits (1113),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/257 (83%), Positives = 230/257 (89%), Gaps = 3/257 (1%)
 Frame = +2

Query  155  FAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLGPFSEQTPSY  328
             AGQS LK   +L RKVGSS  AR TMRRTV KSA   SIWYG DRPKYLGPFS +TPSY
Sbjct  12   LAGQSLLKPVNELSRKVGSS-QARVTMRRTVNKSAGSDSIWYGADRPKYLGPFSGETPSY  70

Query  329  LTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEA  508
            L GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+K+GVKFGEA
Sbjct  71   LNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKSGVKFGEA  130

Query  509  VWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKV  688
            VWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRV GGPLGE  D +
Sbjct  131  VWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPI  190

Query  689  YPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVAD  868
            YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+AD
Sbjct  191  YPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDHLAD  250

Query  869  PVANNAWAYATNFVPGK  919
            PVANNAWAYATNFVPG 
Sbjct  251  PVANNAWAYATNFVPGN  267



>gb|AAC78690.1| chlorophyll a/b-binding protein [Pinus thunbergii]
Length=274

 Score =   433 bits (1113),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 215/274 (78%), Positives = 234/274 (85%), Gaps = 9/274 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  277
            MASCG  + AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGSGRCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPWYG  60

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALG  120

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFFVQA
Sbjct  181  EGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQA  240

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  241  IVTGKGPIENLTDHLADPVNNNAWAYATNFVPGK  274



>sp|P15194.1|CB2B_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 1B, 
chloroplastic; AltName: Full=Chlorophyll a-b binding protein 
type II 1B; Short=CAB; AltName: Full=LHCP; Flags: Precursor 
[Pinus sylvestris]
 emb|CAA32658.1| unnamed protein product [Pinus sylvestris]
Length=274

 Score =   432 bits (1112),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 215/274 (78%), Positives = 233/274 (85%), Gaps = 9/274 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  277
            MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKLTASASTSPWYG  60

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPE FA+NRELEVIH RWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALG  120

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQA
Sbjct  181  EGYRIAGGPLGEVTDPIYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQA  240

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  241  IVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  274



>sp|P15193.1|CB2A_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 1A, 
chloroplastic; AltName: Full=Chlorophyll a-b binding protein 
type II 1A; Short=CAB; AltName: Full=LHCP; Flags: Precursor 
[Pinus sylvestris]
 emb|CAA32657.1| unnamed protein product [Pinus sylvestris]
Length=278

 Score =   432 bits (1110),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 215/277 (78%), Positives = 239/277 (86%), Gaps = 9/277 (3%)
 Frame = +2

Query  116  SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  268
            +++MASCGI  + AFAG   S++K Q + L  VG + G AR TMR+     +V ++  S 
Sbjct  2    ATTMASCGIGSRCAFAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGKKSVAASIDSP  61

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWA QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILM  181

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G +EGYRV GGPLGE  D +YPGG FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFF  241

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  278



>ref|XP_001779318.1| predicted protein [Physcomitrella patens]
 gb|EDQ55825.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   431 bits (1108),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 207/264 (78%), Positives = 230/264 (87%), Gaps = 3/264 (1%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            A+  +  +  AGQS LK   +L RKVG+S  AR +MR++  S   SIWYG DRPK+LGPF
Sbjct  3    AATAMHSTTLAGQSLLKPVNELSRKVGTS-EARVSMRKS--SGSDSIWYGADRPKFLGPF  59

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            S +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+KN
Sbjct  60   SGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKN  119

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRV GGPL
Sbjct  120  GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPL  179

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GE  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+EN
Sbjct  180  GEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEN  239

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            L DH+ADPVANNAWAYATNF PG 
Sbjct  240  LNDHLADPVANNAWAYATNFTPGN  263



>ref|XP_001761868.1| predicted protein [Physcomitrella patens]
 ref|XP_001761952.1| predicted protein [Physcomitrella patens]
 sp|P20866.2|CB2_PHYPA RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ73309.1| predicted protein [Physcomitrella patens]
 gb|EDQ73393.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   431 bits (1108),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/266 (79%), Positives = 233/266 (88%), Gaps = 3/266 (1%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  301
            A+  +  +A AGQS +K   +L RKVG+   AR TMRRTV KSA   SIWYG DRPK+LG
Sbjct  3    AATAMHSTALAGQSLVKPVNELSRKVGNV-EARVTMRRTVSKSAGSDSIWYGADRPKFLG  61

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  121

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GG
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG  181

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  182  PLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  241

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPVANNAWAYATNF PG 
Sbjct  242  ENLNDHLADPVANNAWAYATNFTPGN  267



>ref|XP_001751426.1| predicted protein [Physcomitrella patens]
 ref|XP_001785364.1| predicted protein [Physcomitrella patens]
 ref|XP_001785367.1| predicted protein [Physcomitrella patens]
 gb|EDQ49825.1| predicted protein [Physcomitrella patens]
 gb|EDQ49828.1| predicted protein [Physcomitrella patens]
 gb|EDQ83743.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   431 bits (1107),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/265 (80%), Positives = 232/265 (88%), Gaps = 3/265 (1%)
 Frame = +2

Query  131  SCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLGP  304
            +  +  +A AGQ  LK   +L RKVG+   AR TMRRTV KSA   SIWYG DRPK+LGP
Sbjct  4    ATAMHSTALAGQGVLKPVNELSRKVGNV-EARVTMRRTVSKSAGSDSIWYGADRPKFLGP  62

Query  305  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  484
            FS +TPSYLTGEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+K
Sbjct  63   FSGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAK  122

Query  485  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGP  664
            +GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GGP
Sbjct  123  SGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGP  182

Query  665  LGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE  844
            LGE  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+E
Sbjct  183  LGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE  242

Query  845  NLFDHVADPVANNAWAYATNFVPGK  919
            NL DH+ADPVANNAWAYATNF PG 
Sbjct  243  NLNDHLADPVANNAWAYATNFTPGN  267



>gb|ABK22510.1| unknown [Picea sitchensis]
 gb|ABK22691.1| unknown [Picea sitchensis]
 gb|ABK26115.1| unknown [Picea sitchensis]
 gb|ABR17282.1| unknown [Picea sitchensis]
Length=278

 Score =   431 bits (1108),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 214/277 (77%), Positives = 238/277 (86%), Gaps = 9/277 (3%)
 Frame = +2

Query  116  SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  268
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAIWA QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAIWACQVILM  181

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G +EGYRV GGPLGE  D +YPGG FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFF  241

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  278



>ref|XP_001774452.1| predicted protein [Physcomitrella patens]
 dbj|BAA77273.1| chlorophyll a/b-binding protein precursor [Physcomitrella patens]
 gb|EDQ60676.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   431 bits (1107),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 234/268 (87%), Gaps = 3/268 (1%)
 Frame = +2

Query  122  SMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRPKY  295
            + A+  +  +  AGQ+ LK  ++L RKV ++G AR TMR+TV   S   SIWYG DRPK+
Sbjct  2    ATAATAMNSTVLAGQALLKPVSELSRKV-NAGEARVTMRKTVSKSSGSDSIWYGADRPKF  60

Query  296  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  475
            LGPFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+
Sbjct  61   LGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPEL  120

Query  476  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  655
            L+K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRV 
Sbjct  121  LAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVA  180

Query  656  GGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG  835
            GGPLG+  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct  181  GGPLGDVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG  240

Query  836  PIENLFDHVADPVANNAWAYATNFVPGK  919
            P+ENL DH+ADPVANNAWAYATNFVPG 
Sbjct  241  PLENLNDHLADPVANNAWAYATNFVPGN  268



>gb|ACY66805.1| chlorophyll a/b-binding protein [Pinus massoniana]
Length=274

 Score =   430 bits (1106),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 213/274 (78%), Positives = 232/274 (85%), Gaps = 9/274 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  277
            MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPWYG  60

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALG  120

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLADDP+AFAELKVKE+KNGRL MFSMFGFFVQA
Sbjct  181  EGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPDAFAELKVKEIKNGRLTMFSMFGFFVQA  240

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGPIE+L DH+ADPV NNAWAY TNFVPGK
Sbjct  241  IVTGKGPIEDLADHLADPVNNNAWAYGTNFVPGK  274



>sp|P24006.1|CB2A_PYRPY RecName: Full=Chlorophyll a-b binding protein 1A, chloroplastic; 
AltName: Full=LHCII type II CAB-1A; Short=LHCP; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00449.1| light harvesting a/b binding protein [Pyrus pyrifolia var. culta]
Length=278

 Score =   429 bits (1104),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 213/277 (77%), Positives = 239/277 (86%), Gaps = 9/277 (3%)
 Frame = +2

Query  116  SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  268
            +++MASCGI  + AFAG   S++K Q + L  VG + G AR TMR+     +V ++  S 
Sbjct  2    ATTMASCGIGSRCAFAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGRKSVAASIDSP  61

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  62   WYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWA QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILM  181

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G +EGYRV GGPLGE  D +YPGG FDPLGLADDP+AFA++KVKE+KNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFADVKVKEIKNGRLAMFSMFGFF  241

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  278



>ref|XP_002960494.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ38033.1| light-harvesting complex [Selaginella moellendorffii]
Length=272

 Score =   429 bits (1103),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 207/259 (80%), Positives = 231/259 (89%), Gaps = 4/259 (2%)
 Frame = +2

Query  149  SAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAP---QSIWYGPDRPKYLGPFSEQT  319
            S FAGQ+ LK Q + + +  S+GS R  MR+T K++     S WYGPDR KYLGPFS ++
Sbjct  14   STFAGQTGLKPQNEFVARNASNGS-RIAMRKTGKASSVGGGSPWYGPDRVKYLGPFSGES  72

Query  320  PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKF  499
            PSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSKNG+KF
Sbjct  73   PSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSKNGIKF  132

Query  500  GEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGL  679
            GEAVWFKAG+QIF EGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYR+ GGPLGE  
Sbjct  133  GEAVWFKAGSQIFKEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRIAGGPLGEVT  192

Query  680  DKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDH  859
            D +YPGG+FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH
Sbjct  193  DPIYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLSDH  252

Query  860  VADPVANNAWAYATNFVPG  916
            +ADPVANNAWAYATNF PG
Sbjct  253  LADPVANNAWAYATNFTPG  271



>ref|XP_002967230.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ31829.1| light-harvesting complex [Selaginella moellendorffii]
Length=263

 Score =   428 bits (1101),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 206/259 (80%), Positives = 231/259 (89%), Gaps = 4/259 (2%)
 Frame = +2

Query  149  SAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAP---QSIWYGPDRPKYLGPFSEQT  319
            S FAGQ+ LK Q + + +  S+GS R  MR+T +++     S WYGPDR KYLGPFS ++
Sbjct  5    STFAGQTGLKPQNEFVARNASNGS-RVAMRKTGRASSVGGGSPWYGPDRVKYLGPFSGES  63

Query  320  PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKF  499
            PSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSKNG+KF
Sbjct  64   PSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSKNGIKF  123

Query  500  GEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGL  679
            GEAVWFKAG+QIF EGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYR+ GGPLGE  
Sbjct  124  GEAVWFKAGSQIFKEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRIAGGPLGEVT  183

Query  680  DKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDH  859
            D +YPGG+FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH
Sbjct  184  DPIYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLSDH  243

Query  860  VADPVANNAWAYATNFVPG  916
            +ADPVANNAWAYATNF PG
Sbjct  244  LADPVANNAWAYATNFTPG  262



>ref|XP_001751359.1| predicted protein [Physcomitrella patens]
 gb|EDQ83676.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   428 bits (1100),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/266 (79%), Positives = 232/266 (87%), Gaps = 3/266 (1%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  301
            A+  +  +A AGQS  +   +L RKVG+  S R TMRRTV KSA   SIWYG DRPK+LG
Sbjct  3    AATAMHSTALAGQSLFQPVNELSRKVGNVDS-RVTMRRTVNKSAGSDSIWYGADRPKFLG  61

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  121

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GG
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG  181

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  182  PLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  241

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPVANNAWAYATNF PG 
Sbjct  242  ENLNDHLADPVANNAWAYATNFTPGN  267



>emb|CAA48641.1| type II light-harvesting chlorophyll a /b-binding protein [Zea 
mays]
Length=229

 Score =   426 bits (1096),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/229 (95%), Positives = 223/229 (97%), Gaps = 0/229 (0%)
 Frame = +2

Query  233  MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRE  412
            MRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW+TAG+SADPETFARNRE
Sbjct  1    MRRTVKSVPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWETAGVSADPETFARNRE  60

Query  413  LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  592
            LEVIHSRWAMLGALGCVFPEIL+KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQS
Sbjct  61   LEVIHSRWAMLGALGCVFPEILAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQS  120

Query  593  ILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKN  772
            ILAIWA QVVLMGFVEGY VGGGPLGEGLDKVYPGGAF+PLGLADDP+  AELKVKELKN
Sbjct  121  ILAIWACQVVLMGFVEGYGVGGGPLGEGLDKVYPGGAFEPLGLADDPDTAAELKVKELKN  180

Query  773  GRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            GRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPG 
Sbjct  181  GRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGN  229



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   427 bits (1097),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 218/236 (92%), Gaps = 1/236 (0%)
 Frame = +2

Query  215  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  391
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  28   GNGRISMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  392  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  571
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  147

Query  572  NLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAEL  751
            +LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAEL
Sbjct  148  SLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  207

Query  752  KVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  208  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Zea mays]
 emb|CAA32900.1| unnamed protein product [Zea mays]
 gb|ACF83754.1| unknown [Zea mays]
 gb|ACG25538.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|ACG28560.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA62636.1| TPA: light harvesting chlorophyll a/b binding protein2 [Zea mays]
Length=262

 Score =   426 bits (1096),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 221/244 (91%), Gaps = 4/244 (2%)
 Frame = +2

Query  200  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  367
            KVGS G  R TMR+TV     +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  19   KVGSFGEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  78

Query  368  AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  547
            AGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEG
Sbjct  79   AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEG  138

Query  548  GLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLAD  727
            GLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+FDPLGLAD
Sbjct  139  GLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAD  198

Query  728  DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNF  907
            DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNF
Sbjct  199  DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNF  258

Query  908  VPGK  919
            VPG 
Sbjct  259  VPGN  262



>gb|ACN40044.1| unknown [Picea sitchensis]
Length=278

 Score =   427 bits (1098),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 213/277 (77%), Positives = 237/277 (86%), Gaps = 9/277 (3%)
 Frame = +2

Query  116  SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  268
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEG LDYLG+PNL+HAQSILAIWA QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGWLDYLGSPNLVHAQSILAIWACQVILM  181

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G +EGYRV GGPLGE  D +YPGG FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFF  241

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  278



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   426 bits (1096),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 218/236 (92%), Gaps = 1/236 (0%)
 Frame = +2

Query  215  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  391
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  28   GNGRISMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  392  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  571
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  147

Query  572  NLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAEL  751
            +LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAEL
Sbjct  148  SLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  207

Query  752  KVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  208  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_001751602.1| predicted protein [Physcomitrella patens]
 gb|EDQ83919.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   426 bits (1094),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/266 (77%), Positives = 230/266 (86%), Gaps = 3/266 (1%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRPKYLG  301
            A+  +  +  AGQS LK   +L R+VG+   AR TMRRTV  + +S  IWYG DRPK+LG
Sbjct  3    AAIAMHSTGLAGQSLLKPVNELSRRVGNV-DARVTMRRTVSKSARSDSIWYGADRPKFLG  61

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS +TPSYL GEF GDYGWDTAGLS+D ETFARNRELEVIH+RWAMLGALGC+ PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDLETFARNRELEVIHARWAMLGALGCLTPELLA  121

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GG
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG  181

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  182  PLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  241

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPVANNAWAYATNF PG 
Sbjct  242  ENLNDHLADPVANNAWAYATNFTPGN  267



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   426 bits (1094),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 218/236 (92%), Gaps = 1/236 (0%)
 Frame = +2

Query  215  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  391
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  29   GNGRVSMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  392  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  571
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  572  NLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAEL  751
            +LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAEL
Sbjct  149  SLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  208

Query  752  KVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH++DPV NNAWAYATNFVPGK
Sbjct  209  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK  264



>dbj|BAJ87356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   423 bits (1088),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 200/215 (93%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = +2

Query  272  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  451
            YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGA
Sbjct  4    YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA  63

Query  452  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG  631
            LGCVFPEILSKNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG
Sbjct  64   LGCVFPEILSKNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMG  123

Query  632  FVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFV  811
            F+EGYRVGGGPLGEGLD +YPGGAFDPLGLADDP+  AELKVKELKNGRLAMFSMFGFFV
Sbjct  124  FIEGYRVGGGPLGEGLDIIYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFV  183

Query  812  QAIVTGKGPIENLFDHVADPVANNAWAYATNFVPG  916
            QAIVTGKGP+ENLFDH+ADPV NNAWA+ATNF PG
Sbjct  184  QAIVTGKGPVENLFDHIADPVNNNAWAFATNFAPG  218



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   425 bits (1093),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 211/271 (78%), Positives = 236/271 (87%), Gaps = 11/271 (4%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDR  286
            +S+MA   +   +FAGQ+  L   T  +     +G+ R TMR+ V KSAP S  WYGPDR
Sbjct  3    ASTMA---LSSPSFAGQAVKLSPSTSEI-----TGNGRITMRKAVAKSAPSSSPWYGPDR  54

Query  287  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  466
             KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  55   VKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  114

Query  467  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  646
            PE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGY
Sbjct  115  PELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGY  174

Query  647  RVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVT  826
            R+ GGPLGE +D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVT
Sbjct  175  RIAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVT  234

Query  827  GKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            GKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  235  GKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|NP_001147639.1| chlorophyll a-b binding protein 1, chloroplastic precursor [Zea 
mays]
 gb|ACG28217.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=262

 Score =   425 bits (1092),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 221/244 (91%), Gaps = 4/244 (2%)
 Frame = +2

Query  200  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  367
            KVGS G  R TMR+TV     +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  19   KVGSFGEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  78

Query  368  AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  547
            AGLSADP+TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEG
Sbjct  79   AGLSADPKTFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEG  138

Query  548  GLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLAD  727
            GLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+FDPLGLAD
Sbjct  139  GLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAD  198

Query  728  DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNF  907
            DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNF
Sbjct  199  DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNF  258

Query  908  VPGK  919
            VPG 
Sbjct  259  VPGN  262



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score =   425 bits (1092),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 216/274 (79%), Positives = 233/274 (85%), Gaps = 15/274 (5%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQT--DLLRKVGSSGSARFTMRRTV-KSAPQSI---WYG  277
            +SSMA   +   +FAGQ+   S T  DLL      G  R TMR+T  K  P S    WYG
Sbjct  3    ASSMA---LSSPSFAGQAVKLSPTASDLL------GEGRITMRKTAGKPKPVSSGSPWYG  53

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  54   PDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  113

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG V
Sbjct  114  CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAV  173

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA
Sbjct  174  EGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  233

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  234  IVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_008358195.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   425 bits (1092),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 232/269 (86%), Gaps = 8/269 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKS---APQSIWYGPDRPK  292
            MA+  +  S F G++  L +QT+        G+ R +MR+T K    +  S WYGPDR K
Sbjct  1    MATMALS-SPFTGKAIPLNTQTEF---SAVQGNGRVSMRKTAKKPAVSSGSPWYGPDRVK  56

Query  293  YLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPE  472
            YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE
Sbjct  57   YLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  116

Query  473  ILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRV  652
            +LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+
Sbjct  117  LLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRI  176

Query  653  GGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK  832
             GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK
Sbjct  177  AGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK  236

Query  833  GPIENLFDHVADPVANNAWAYATNFVPGK  919
            GPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  237  GPIENLADHLADPVTNNAWAYATNFVPGK  265



>ref|XP_001754234.1| predicted protein [Physcomitrella patens]
 dbj|BAD08518.1| light-harvesting chlorophyll a/b-binding protein 1 [Physcomitrella 
patens]
 gb|EDQ81135.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   425 bits (1092),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 204/255 (80%), Positives = 228/255 (89%), Gaps = 3/255 (1%)
 Frame = +2

Query  161  GQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRPKYLGPFSEQTPSYLT  334
            GQ+ L+   +L+RKVG+S  AR TMR+TV   S   SIWYG DRPK+LGPFS +TPSYL 
Sbjct  14   GQALLQPANELVRKVGTS-QARVTMRKTVSKSSGSDSIWYGADRPKFLGPFSGETPSYLN  72

Query  335  GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVW  514
            GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+K+GVKFGEAVW
Sbjct  73   GEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVW  132

Query  515  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYP  694
            FKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRV GGPLG+  D +YP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGDVTDPIYP  192

Query  695  GGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPV  874
            GG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV
Sbjct  193  GGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPV  252

Query  875  ANNAWAYATNFVPGK  919
            ANNAWAYATNFVPG 
Sbjct  253  ANNAWAYATNFVPGN  267



>ref|XP_006365572.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
 gb|AAA80589.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   424 bits (1091),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 208/266 (78%), Positives = 232/266 (87%), Gaps = 6/266 (2%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRPKYLG  301
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE +D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  180  PLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  239

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  240  ENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_006368026.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   424 bits (1091),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 208/266 (78%), Positives = 232/266 (87%), Gaps = 6/266 (2%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRPKYLG  301
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVSKSAPSSSPWYGPDRVKYLG  59

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE +D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  180  PLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  239

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  240  ENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   424 bits (1091),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 214/278 (77%), Positives = 235/278 (85%), Gaps = 23/278 (8%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQSI----  268
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T  S P+++    
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRVTMRKTA-SKPKNVSSGS  49

Query  269  -WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAML  445
             WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAML
Sbjct  50   PWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAML  109

Query  446  GALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVL  625
            GALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVL
Sbjct  110  GALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  169

Query  626  MGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF  805
            MG VEGYR+ GGPLGE  D +YPGG+FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGF
Sbjct  170  MGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGF  229

Query  806  FVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            FVQAIVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  230  FVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   424 bits (1090),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 202/236 (86%), Positives = 217/236 (92%), Gaps = 1/236 (0%)
 Frame = +2

Query  215  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  391
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  29   GNGRVSMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  392  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  571
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  572  NLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAEL  751
            +LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAEL
Sbjct  149  SLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  208

Query  752  KVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH++DPV NNAWAYATNF PGK
Sbjct  209  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFAPGK  264



>ref|XP_002515206.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47190.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=267

 Score =   424 bits (1090),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 209/262 (80%), Positives = 230/262 (88%), Gaps = 5/262 (2%)
 Frame = +2

Query  146  QSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIWYGPDRPKYLGPFSE  313
             S F G++  L +QT+L   V SS + R TMR+T     ++  S WYGPDR KYLGPFS 
Sbjct  7    SSTFTGKAVPLSAQTELPATVRSS-NGRVTMRKTAGKPAASSGSPWYGPDRVKYLGPFSG  65

Query  314  QTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGV  493
            + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGV
Sbjct  66   EPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGV  125

Query  494  KFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGE  673
            KFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE
Sbjct  126  KFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGE  185

Query  674  GLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLF  853
              D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL 
Sbjct  186  VTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLA  245

Query  854  DHVADPVANNAWAYATNFVPGK  919
            DH+ADPV NNAWAYATNFVPGK
Sbjct  246  DHLADPVNNNAWAYATNFVPGK  267



>ref|XP_011658281.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic 
[Cucumis sativus]
 gb|KGN49374.1| hypothetical protein Csa_6G522680 [Cucumis sativus]
Length=265

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 218/237 (92%), Gaps = 2/237 (1%)
 Frame = +2

Query  215  GSARFTMRRTVKSAPQS--IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADP  388
            G+A+FTMR+T   +  S   WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADP
Sbjct  29   GNAKFTMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  88

Query  389  ETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGN  568
            ETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGN
Sbjct  89   ETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGN  148

Query  569  PNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAE  748
            P+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAE
Sbjct  149  PSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAE  208

Query  749  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            LKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  209  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AAC25775.1| chlorophyll a/b binding protein [Medicago sativa]
Length=266

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 221/239 (92%), Gaps = 4/239 (2%)
 Frame = +2

Query  215  GSARFTMRRTVKS----APQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  382
            G+ARFTMR++  +    +  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  383  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  562
            DPETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  563  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAF  742
            GNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+FDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  743  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_004134608.2| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49375.1| hypothetical protein Csa_6G522690 [Cucumis sativus]
Length=265

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 218/237 (92%), Gaps = 2/237 (1%)
 Frame = +2

Query  215  GSARFTMRRTVKSAPQS--IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADP  388
            G+A+FTMR+T   +  S   WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADP
Sbjct  29   GNAKFTMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  88

Query  389  ETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGN  568
            ETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGN
Sbjct  89   ETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGN  148

Query  569  PNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAE  748
            P+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAE
Sbjct  149  PSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAE  208

Query  749  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            LKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  209  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004957570.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 220/244 (90%), Gaps = 4/244 (2%)
 Frame = +2

Query  200  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  367
            KVGS G  R TMR+T      +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  18   KVGSFGEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  77

Query  368  AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  547
            AGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEG
Sbjct  78   AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEG  137

Query  548  GLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLAD  727
            GLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+FDPLGLAD
Sbjct  138  GLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAD  197

Query  728  DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNF  907
            DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNF
Sbjct  198  DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNF  257

Query  908  VPGK  919
            VPG 
Sbjct  258  VPGN  261



>ref|XP_001754307.1| predicted protein [Physcomitrella patens]
 gb|EDQ80757.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 207/266 (78%), Positives = 232/266 (87%), Gaps = 3/266 (1%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRPKYLG  301
            A+  +  +A AGQS LK   +L RKVG+   AR +MR++   +  S  IWYG DRPKYLG
Sbjct  3    AATAMHSTALAGQSLLKPVNELSRKVGNV-EARVSMRKSASKSAASDSIWYGADRPKYLG  61

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLA  121

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYRV GG
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRVAGG  181

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLG+  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  182  PLGDVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  241

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPVANNAWAYATNFVPG 
Sbjct  242  ENLNDHLADPVANNAWAYATNFVPGN  267



>gb|AAA80591.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 208/266 (78%), Positives = 232/266 (87%), Gaps = 6/266 (2%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRPKYLG  301
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+LS
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLS  119

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE +D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  180  PLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  239

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  240  ENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 207/266 (78%), Positives = 232/266 (87%), Gaps = 6/266 (2%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRPKYLG  301
            A+  +   +FAGQ+   S +        +G+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEITGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE +D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  180  PLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  239

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  240  ENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_004303877.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   424 bits (1089),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 211/273 (77%), Positives = 232/273 (85%), Gaps = 13/273 (5%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKSAPQ----SIWYGP  280
            SS+MA   +   + AGQ+  L S T  L      G  R TMR+T   +      S WYGP
Sbjct  3    SSTMA---LSSPSLAGQAVKLGSSTSNLL-----GEGRVTMRKTAAKSKNVSSVSPWYGP  54

Query  281  DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC  460
            DR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC
Sbjct  55   DRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC  114

Query  461  VFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVE  640
            VFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VE
Sbjct  115  VFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVE  174

Query  641  GYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAI  820
            GYR+ GGPLGE +D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAI
Sbjct  175  GYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAI  234

Query  821  VTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VTGKGPIENL DH+ADPV NNAW+YATNFVPGK
Sbjct  235  VTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>gb|KCW75953.1| hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis]
Length=300

 Score =   425 bits (1092),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 214/300 (71%), Positives = 245/300 (82%), Gaps = 13/300 (4%)
 Frame = +2

Query  41   PISIHFIHSQLHTINSNRKLRRAEE-SSSMASCGIQQSA--FAGQSALKSQT--DLLRKV  205
            P S +     + T+  N + R + +  S+MA+  +  S+   AGQ+   S +  +LL   
Sbjct  7    PTSPNNHRQSISTLYFNTRQRSSSQIHSTMAASTMALSSPSLAGQAVKLSPSTPELL---  63

Query  206  GSSGSARFTMRRTVKS--APQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLS  379
               G+ R +MR+ V+   +  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLS
Sbjct  64   ---GNGRISMRKAVRKPVSSGSPWYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  120

Query  380  ADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDY  559
            ADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  121  ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDY  180

Query  560  LGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEA  739
            LGNPNLIHAQSILAIWA QV+LMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEA
Sbjct  181  LGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA  240

Query  740  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV+NNAWAYATNFVPGK
Sbjct  241  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK  300



>ref|XP_009363087.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=265

 Score =   423 bits (1088),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 232/269 (86%), Gaps = 8/269 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKS---APQSIWYGPDRPK  292
            MA+  +  S F G++  L +QT+        G+ R +MR+T K    +  S WYGPDR K
Sbjct  1    MATMALS-SPFTGKAIPLNTQTEF---SAVQGNGRVSMRKTGKKPAVSSGSPWYGPDRVK  56

Query  293  YLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPE  472
            YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE
Sbjct  57   YLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  116

Query  473  ILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRV  652
            +LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+
Sbjct  117  LLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRI  176

Query  653  GGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK  832
             GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK
Sbjct  177  AGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK  236

Query  833  GPIENLFDHVADPVANNAWAYATNFVPGK  919
            GPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  237  GPIENLADHLADPVTNNAWAYATNFVPGK  265



>ref|XP_002460622.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
 gb|EER97143.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
Length=262

 Score =   423 bits (1088),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 220/244 (90%), Gaps = 4/244 (2%)
 Frame = +2

Query  200  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  367
            KVGS G  R TMR+T      +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  19   KVGSFGEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  78

Query  368  AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  547
            AGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEG
Sbjct  79   AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEG  138

Query  548  GLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLAD  727
            GLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+FDPLGLAD
Sbjct  139  GLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAD  198

Query  728  DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNF  907
            DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNF
Sbjct  199  DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNF  258

Query  908  VPGK  919
            VPG 
Sbjct  259  VPGN  262



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score =   423 bits (1088),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 217/236 (92%), Gaps = 1/236 (0%)
 Frame = +2

Query  215  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  391
            G+ R +MR+T K     S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  29   GNGRVSMRKTTKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  392  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  571
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  572  NLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAEL  751
            +LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAEL
Sbjct  149  SLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAEL  208

Query  752  KVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  209  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_007215816.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
Length=267

 Score =   423 bits (1088),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 212/277 (77%), Positives = 232/277 (84%), Gaps = 21/277 (8%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQ----SI  268
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T   +      S 
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRVTMRKTASRSKNVSSGSP  50

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G VEGYR+ GGPLGE  D +YPGG+FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  267



>gb|AFK40061.1| unknown [Medicago truncatula]
 gb|KEH31368.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=266

 Score =   423 bits (1088),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 220/239 (92%), Gaps = 4/239 (2%)
 Frame = +2

Query  215  GSARFTMRRTVKS----APQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  382
            G+ARFTMR+   +    +  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GAARFTMRKAATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  383  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  562
            DPETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  563  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAF  742
            GNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+FDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  743  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score =   423 bits (1087),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 230/268 (86%), Gaps = 10/268 (4%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKS--QTDLLRKVGSSGSARFTMRRTV--KSAPQSIWYGPDRPKY  295
            AS  +    FAG++   S   T+L       G+ R +MR+T   K +  S WYGPDR KY
Sbjct  3    ASMALSSPTFAGKAVQLSPGATELF------GNGRVSMRKTATKKVSSGSPWYGPDRVKY  56

Query  296  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  475
            LGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+
Sbjct  57   LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL  116

Query  476  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  655
            LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ 
Sbjct  117  LSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIA  176

Query  656  GGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG  835
            GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG
Sbjct  177  GGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG  236

Query  836  PIENLFDHVADPVANNAWAYATNFVPGK  919
            P+ENL DH+ADPVANNAW YATNFVPGK
Sbjct  237  PLENLADHLADPVANNAWNYATNFVPGK  264



>ref|XP_006840304.2| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Amborella 
trichopoda]
Length=266

 Score =   423 bits (1087),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 208/267 (78%), Positives = 229/267 (86%), Gaps = 3/267 (1%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAP--QSIWYGPDRPKYL  298
            MA+  +   AFAG+ A+ + T     +G  G  R +MR++   AP   S WYG DR KYL
Sbjct  1    MATMALSSPAFAGK-AVPASTQSEFGIGVRGDGRVSMRKSTSRAPVSGSPWYGRDRVKYL  59

Query  299  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL  478
            GPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L
Sbjct  60   GPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELL  119

Query  479  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGG  658
            S+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV G
Sbjct  120  SRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG  179

Query  659  GPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP  838
            GPLGE  D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP
Sbjct  180  GPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP  239

Query  839  IENLFDHVADPVANNAWAYATNFVPGK  919
            +ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  240  LENLADHLADPVNNNAWAYATNFVPGK  266



>gb|EPS64140.1| chlorophyll a-b binding protein 21, chloroplastic [Genlisea aurea]
Length=265

 Score =   423 bits (1087),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 209/267 (78%), Positives = 228/267 (85%), Gaps = 8/267 (3%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKSAP--QSIWYGPDRPKYL  298
            A+  +   +FAGQ+  L   T  L     SG  R +MRRTV   P   S WYGPDR KYL
Sbjct  4    ATMALSSPSFAGQAVKLSPSTPEL-----SGKGRISMRRTVTKTPASSSPWYGPDRVKYL  58

Query  299  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL  478
            GPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH+RWAMLGALG +FPE+L
Sbjct  59   GPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGIIFPELL  118

Query  479  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGG  658
            +KNGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGYRV G
Sbjct  119  AKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAVQVILMGAVEGYRVAG  178

Query  659  GPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP  838
            GPLGE  D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFS+FGFFVQAIVTGKGP
Sbjct  179  GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSVFGFFVQAIVTGKGP  238

Query  839  IENLFDHVADPVANNAWAYATNFVPGK  919
            +ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  239  LENLSDHLADPVNNNAWAYATNFVPGK  265



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   423 bits (1087),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 209/267 (78%), Positives = 230/267 (86%), Gaps = 9/267 (3%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQT--DLLRKVGSSGSARFTMRRTVKSAPQ-SIWYGPDRPKYL  298
            A+  +   AFAG++   S +  +L+      G+ R +MR+T K     S WYGPDR KYL
Sbjct  4    ATMALSSPAFAGKAVKLSPSSPELM------GNGRVSMRKTTKPVSSGSPWYGPDRVKYL  57

Query  299  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL  478
            GPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L
Sbjct  58   GPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL  117

Query  479  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGG  658
            S+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ G
Sbjct  118  SRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAG  177

Query  659  GPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP  838
            GPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP
Sbjct  178  GPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP  237

Query  839  IENLFDHVADPVANNAWAYATNFVPGK  919
            +ENL DH+ADPV NNAWAYATNF PGK
Sbjct  238  LENLADHLADPVNNNAWAYATNFAPGK  264



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score =   423 bits (1087),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/277 (77%), Positives = 232/277 (84%), Gaps = 21/277 (8%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQ----SI  268
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T   +      S 
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRITMRKTASKSKNVSSGSP  50

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G VEGYRV GGPLGE  D +YPGG+FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEITDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGPIENL DH+ADPV NNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_008456347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Cucumis 
melo]
Length=267

 Score =   423 bits (1087),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 215/274 (78%), Positives = 232/274 (85%), Gaps = 15/274 (5%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQT--DLLRKVGSSGSARFTMRRTV-KSAPQSI---WYG  277
            +SSMA   +   + AGQ+   S T  DLL      G  R TMR+T  K  P S    WYG
Sbjct  3    ASSMA---LSSPSLAGQAVKLSPTASDLL------GEGRITMRKTAGKPKPVSSGSPWYG  53

Query  278  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  457
            PDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  54   PDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  113

Query  458  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  637
            CVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG V
Sbjct  114  CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAV  173

Query  638  EGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  817
            EGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA
Sbjct  174  EGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  233

Query  818  IVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            IVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  234  IVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_004233096.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233099.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233100.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316910.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316913.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 sp|P07370.1|CB2B_SOLLC RecName: Full=Chlorophyll a-b binding protein 1B, chloroplastic; 
AltName: Full=LHCII type I CAB-1B; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34147.1| chlorophyll a/b-binding protein Cab-1B [Solanum lycopersicum]
Length=265

 Score =   423 bits (1087),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 207/266 (78%), Positives = 232/266 (87%), Gaps = 6/266 (2%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRPKYLG  301
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE +D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  180  PLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  239

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  240  ENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   422 bits (1086),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/277 (77%), Positives = 232/277 (84%), Gaps = 21/277 (8%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQ----SI  268
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T   +      S 
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRVTMRKTASKSKNVSSGSP  50

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G VEGYRV GGPLGE  D +YPGG+FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEITDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGPIENL DH+ADPV NNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>emb|CAA57407.1| light harvesting chlorophyll a /b-binding protein Lhcb1*1 [Picea 
abies]
Length=278

 Score =   423 bits (1087),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 212/277 (77%), Positives = 235/277 (85%), Gaps = 9/277 (3%)
 Frame = +2

Query  116  SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  268
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNLIHAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLIHAQSILAILACQVILM  181

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G +EGYRV GGPLGE  D +YPGG FDPLG ADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGWADDPDAFAELKVKELKNGRLAMFSMFGFF  241

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  278



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score =   422 bits (1086),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 220/239 (92%), Gaps = 4/239 (2%)
 Frame = +2

Query  215  GSARFTMRRTV-KSAP---QSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  382
            G+++ TMR+T  KS P    S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNSKVTMRKTAAKSKPTVSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  383  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  562
            DPETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  563  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAF  742
            GNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  208

Query  743  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_007221496.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
 ref|XP_008227797.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ22695.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
Length=265

 Score =   422 bits (1085),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 210/269 (78%), Positives = 231/269 (86%), Gaps = 8/269 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKS---APQSIWYGPDRPK  292
            MA+  +  S F G++  L +QT+        G+ R +MRR  +    +  S WYGPDR K
Sbjct  1    MATMALS-SPFTGKAIPLNTQTEFST---VQGNGRVSMRRAARKPAVSSGSPWYGPDRVK  56

Query  293  YLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPE  472
            YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE
Sbjct  57   YLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  116

Query  473  ILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRV  652
            +LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+
Sbjct  117  LLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRI  176

Query  653  GGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK  832
             GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK
Sbjct  177  AGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK  236

Query  833  GPIENLFDHVADPVANNAWAYATNFVPGK  919
            GPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  237  GPIENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_001765456.1| predicted protein [Physcomitrella patens]
 gb|EDQ69717.1| predicted protein [Physcomitrella patens]
Length=266

 Score =   422 bits (1085),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 205/266 (77%), Positives = 230/266 (86%), Gaps = 4/266 (2%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRPKYLG  301
            A+  +  +  AGQS  +   +L  KVGSS  AR +MR+TV   S   SIWYG DRPK+LG
Sbjct  3    AATAMHSTTLAGQSLFRFN-ELSSKVGSS-QARVSMRKTVSKSSGSDSIWYGADRPKWLG  60

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+
Sbjct  61   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  120

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYRV GG
Sbjct  121  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRVAGG  180

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLG+  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  181  PLGDVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  240

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPVANNAWAYATNF PG 
Sbjct  241  ENLNDHLADPVANNAWAYATNFTPGN  266



>ref|XP_009782921.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   422 bits (1086),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/270 (76%), Positives = 233/270 (86%), Gaps = 12/270 (4%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSAL--KSQTDLLRKVGSSGSARFTMRRTVKSAPQ----SIWYGPDRP  289
            A+  +  S+FAG++     S ++++      G+ + TMR+TV  A      S WYGPDR 
Sbjct  4    ATMALSSSSFAGKAVKLSPSSSEII------GNGKVTMRKTVTKAKPVSSGSPWYGPDRV  57

Query  290  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  469
            KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFP
Sbjct  58   KYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFP  117

Query  470  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR  649
            E+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR
Sbjct  118  ELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYR  177

Query  650  VGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTG  829
            V GGPLGE +D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTG
Sbjct  178  VAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTG  237

Query  830  KGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  238  KGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score =   422 bits (1085),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 212/271 (78%), Positives = 232/271 (86%), Gaps = 12/271 (4%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQT--DLLRKVGSSGSARFTMRRTVKSAPQ-SIWYGPDR  286
            +S+MA   +   +FAG++   S    DLL      G+ R TMR+ VK A   S WYGPDR
Sbjct  3    ASTMA---LSSPSFAGKAVKLSPATPDLL------GNGRVTMRKAVKPASSGSPWYGPDR  53

Query  287  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  466
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  54   AKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  113

Query  467  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  646
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  114  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGY  173

Query  647  RVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVT  826
            RV GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVT
Sbjct  174  RVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVT  233

Query  827  GKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            GKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  234  GKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_008343203.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008362557.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=332

 Score =   425 bits (1092),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 232/269 (86%), Gaps = 8/269 (3%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKS---APQSIWYGPDRPK  292
            MA+  +  S F G++  L +QT+        G+ R +MR+T K    +  S WYGPDR K
Sbjct  68   MATMALS-SPFTGKAIPLNTQTEF---SAVQGNGRVSMRKTGKKPAVSSGSPWYGPDRVK  123

Query  293  YLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPE  472
            YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE
Sbjct  124  YLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  183

Query  473  ILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRV  652
            +LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+
Sbjct  184  LLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRI  243

Query  653  GGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK  832
             GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK
Sbjct  244  AGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGK  303

Query  833  GPIENLFDHVADPVANNAWAYATNFVPGK  919
            GPIENL DH+ADPV NNAWAYATNFVPGK
Sbjct  304  GPIENLADHLADPVTNNAWAYATNFVPGK  332



>gb|ACN40027.1| unknown [Picea sitchensis]
Length=278

 Score =   422 bits (1086),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 211/277 (76%), Positives = 235/277 (85%), Gaps = 9/277 (3%)
 Frame = +2

Query  116  SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  268
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEQPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILACQVILM  181

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G +EGYRV GGPLGE  D +YPGG FDPLG ADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGWADDPDAFAELKVKELKNGRLAMFSMFGFF  241

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  278



>ref|XP_006856963.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Amborella 
trichopoda]
 gb|ERN18430.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
Length=268

 Score =   422 bits (1085),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 207/272 (76%), Positives = 231/272 (85%), Gaps = 11/272 (4%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSALKS--QTDLLRKVGSSGSARFTMRRTVKSAPQSI-----WYGPD  283
            MA+  +  S FAG++   S   ++LL     SG  R +MR+ V    +++     WYGPD
Sbjct  1    MATMSLSSSTFAGKALALSPASSELL----GSGEGRVSMRKPVGKPSKAVSSGSPWYGPD  56

Query  284  RPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCV  463
            R KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCV
Sbjct  57   RVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCV  116

Query  464  FPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEG  643
            FPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEG
Sbjct  117  FPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEG  176

Query  644  YRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIV  823
            YR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIV
Sbjct  177  YRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIV  236

Query  824  TGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            TGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  237  TGKGPLENLADHLADPVNNNAWAYATNFVPGK  268



>ref|XP_010316911.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   422 bits (1085),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 234/268 (87%), Gaps = 10/268 (4%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSA--LKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRPKY  295
            A+  +   +FAGQ+   L S +++      +G+ R TMR+ V KSAP S  WYGPDR KY
Sbjct  4    ATMALSSPSFAGQAVKLLPSASEI------TGNGRITMRKAVAKSAPSSSPWYGPDRVKY  57

Query  296  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  475
            LGPFS ++PSYL GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+
Sbjct  58   LGPFSGESPSYLNGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL  117

Query  476  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  655
            L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ 
Sbjct  118  LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA  177

Query  656  GGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG  835
            GGPLGE +D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct  178  GGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG  237

Query  836  PIENLFDHVADPVANNAWAYATNFVPGK  919
            P+ENL DH+ADPV NNAW+YATNFVPGK
Sbjct  238  PLENLADHLADPVNNNAWSYATNFVPGK  265



>gb|ABK22330.1| unknown [Picea sitchensis]
Length=278

 Score =   422 bits (1086),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 211/277 (76%), Positives = 235/277 (85%), Gaps = 9/277 (3%)
 Frame = +2

Query  116  SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMR-----RTVKSAPQSI  268
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR     ++V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMREATGKKSVAASSDSP  61

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILACQVILM  181

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G +EGYRV GGPLGE  D +YPGG FDPLG ADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGWADDPDAFAELKVKELKNGRLAMFSMFGFF  241

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  278



>ref|XP_009597417.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana tomentosiformis]
Length=267

 Score =   422 bits (1085),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 231/268 (86%), Gaps = 8/268 (3%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQ----SIWYGPDRPKY  295
            A+  +  S+FAG++   S +        +G+ + TMR+TV  A      S WYGPDR KY
Sbjct  4    ATMALSSSSFAGKAVKLSPSS----SEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKY  59

Query  296  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  475
            LGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+
Sbjct  60   LGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL  119

Query  476  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  655
            L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV 
Sbjct  120  LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVA  179

Query  656  GGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG  835
            GGPLGE +D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct  180  GGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG  239

Query  836  PIENLFDHVADPVANNAWAYATNFVPGK  919
            P+ENL DH+ADPV NNAW+YATNFVPGK
Sbjct  240  PLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_010097596.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   422 bits (1084),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 211/270 (78%), Positives = 233/270 (86%), Gaps = 9/270 (3%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRP  289
            +S+MA   +   +FAG++     T    KV  +G  R +MR+T    ++  S WYGPDR 
Sbjct  3    ASTMA---LSSPSFAGKAV--ELTPTANKV--TGGGRVSMRKTGSRGASSGSPWYGPDRV  55

Query  290  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  469
            KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP
Sbjct  56   KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  115

Query  470  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR  649
            E+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWASQV+LMG VEGYR
Sbjct  116  ELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYR  175

Query  650  VGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTG  829
            + GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTG
Sbjct  176  IAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTG  235

Query  830  KGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  236  KGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|ABK26071.1| unknown [Picea sitchensis]
 gb|ABR17429.1| unknown [Picea sitchensis]
Length=278

 Score =   422 bits (1086),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 211/277 (76%), Positives = 235/277 (85%), Gaps = 9/277 (3%)
 Frame = +2

Query  116  SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  268
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILACQVILM  181

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G +EGYRV GGPLGE  D +YPGG FDPLG ADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGWADDPDAFAELKVKELKNGRLAMFSMFGFF  241

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  278



>gb|KCW75954.1| hypothetical protein EUGRSUZ_D00322 [Eucalyptus grandis]
Length=358

 Score =   426 bits (1094),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 218/303 (72%), Positives = 244/303 (81%), Gaps = 19/303 (6%)
 Frame = +2

Query  26   NTPPAPISIHFIHSQLHTINSNRKLRRAEESSSMASCGIQQSA--FAGQSALKSQT--DL  193
            N+PP+          + T  S++ L +     +MA+  +  S+  FAG++   S    DL
Sbjct  70   NSPPS--------HNISTSKSSKHLGKNSPLGTMAASTMALSSPSFAGKAVKLSPATPDL  121

Query  194  LRKVGSSGSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA  370
            L      G+ R TMR+ VK A   S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTA
Sbjct  122  L------GNGRVTMRKAVKPASSGSPWYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTA  175

Query  371  GLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGG  550
            GLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGG
Sbjct  176  GLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGG  235

Query  551  LDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADD  730
            LDYLGNP+LIHAQSILAIWA QV+LMG VEGYRV GGPLGE  D +YPGG+FDPLGLADD
Sbjct  236  LDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADD  295

Query  731  PEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFV  910
            PEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFV
Sbjct  296  PEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFV  355

Query  911  PGK  919
            PGK
Sbjct  356  PGK  358



>sp|P08221.1|CB21_CUCSA RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor, partial 
[Cucumis sativus]
 gb|AAA33124.1| chlorophyll a/b-binding protein, partial [Cucumis sativus]
Length=255

 Score =   421 bits (1083),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 218/237 (92%), Gaps = 2/237 (1%)
 Frame = +2

Query  215  GSARFTMRRTVKSAPQS--IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADP  388
            G+A+FTMR+T   +  S   WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADP
Sbjct  19   GNAKFTMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  78

Query  389  ETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGN  568
            ETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGN
Sbjct  79   ETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGN  138

Query  569  PNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAE  748
            P+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAE
Sbjct  139  PSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAE  198

Query  749  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            LKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  199  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  255



>sp|P27490.1|CB28_PEA RecName: Full=Chlorophyll a-b binding protein 8, chloroplastic; 
AltName: Full=LHCII type I CAB-8; Flags: Precursor [Pisum 
sativum]
 emb|CAA39883.1| chlorophyll a/b binding protein [Pisum sativum]
Length=268

 Score =   422 bits (1085),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 221/239 (92%), Gaps = 4/239 (2%)
 Frame = +2

Query  215  GSARFTMRRTVKS----APQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  382
            G ARFTMR++  +    +  S WYGPDR KYLGPFS ++PSYLTGEFPGDYGWDTAGLSA
Sbjct  30   GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  89

Query  383  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  562
            DPETF++NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  90   DPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  149

Query  563  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAF  742
            GNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+FDPLGLADDPEAF
Sbjct  150  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  209

Query  743  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH++DPV NNAW+YATNFVPGK
Sbjct  210  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK  268



>sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; 
AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 gb|AAA63413.1| cab precursor [Pisum sativum]
 gb|AAA33651.1| polypeptide 15 precursor [Pisum sativum]
 prf||1006296A protein,chlorophyll a/b binding
Length=269

 Score =   422 bits (1084),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 222/239 (93%), Gaps = 4/239 (2%)
 Frame = +2

Query  215  GSARFTMRRTVKS----APQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  382
            G+ARFTMR++  +    +  S WYGPDR KYLGPFS ++PSYLTGEFPGDYGWDTAGLSA
Sbjct  31   GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  90

Query  383  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  562
            DPETF++NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  91   DPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  150

Query  563  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAF  742
            GNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+FDPLGLADDPEAF
Sbjct  151  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  210

Query  743  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAW+YATNFVPGK
Sbjct  211  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  269



>ref|XP_006365573.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006365574.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=265

 Score =   422 bits (1084),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 206/266 (77%), Positives = 232/266 (87%), Gaps = 6/266 (2%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRPKYLG  301
            A+  +   +FAGQ+   S +        +G+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEITGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE +D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  180  PLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  239

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  240  ENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   422 bits (1084),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 233/270 (86%), Gaps = 11/270 (4%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRP  289
            +S+MA   +    FAG++   + T++       G+ R +MR+TV  A  S   WYGPDR 
Sbjct  3    ASTMA---LSSPTFAGKAVQLAPTEVF------GTGRISMRKTVGKAVSSGSPWYGPDRV  53

Query  290  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  469
            KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFP
Sbjct  54   KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFP  113

Query  470  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR  649
            E+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR
Sbjct  114  ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYR  173

Query  650  VGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTG  829
            + GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTG
Sbjct  174  IAGGPLGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTG  233

Query  830  KGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KGP+ENL DH+ADPV NNAW+YATNFVPGK
Sbjct  234  KGPLENLADHLADPVNNNAWSYATNFVPGK  263



>ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer 
arietinum]
 emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum]
Length=266

 Score =   422 bits (1084),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 220/239 (92%), Gaps = 4/239 (2%)
 Frame = +2

Query  215  GSARFTMRRTVKS----APQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  382
            G++RFTMR++  +    +  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GASRFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  383  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  562
            DPETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  563  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAF  742
            GNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  207

Query  743  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH++DPV NNAWAYATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK  266



>ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis sativus]
 gb|KGN58532.1| hypothetical protein Csa_3G664560 [Cucumis sativus]
Length=265

 Score =   422 bits (1084),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 210/261 (80%), Positives = 228/261 (87%), Gaps = 5/261 (2%)
 Frame = +2

Query  146  QSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRPKYLGPFSEQ  316
             S F G+   L + T+L   V S+G  R TMR++ K A  S   WYGPDR KYLGPFS +
Sbjct  7    SSTFTGKVVPLNAFTELSSSVRSNG--RVTMRKSGKPAASSGSPWYGPDRVKYLGPFSGE  64

Query  317  TPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVK  496
             PSYL GEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVK
Sbjct  65   PPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVK  124

Query  497  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEG  676
            FGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWASQVVLMG VEGYR+ GGPLGE 
Sbjct  125  FGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEI  184

Query  677  LDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFD  856
             D +YPGG+FDPLGLADDPEAF+ELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL D
Sbjct  185  TDPIYPGGSFDPLGLADDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLAD  244

Query  857  HVADPVANNAWAYATNFVPGK  919
            H+ADPV NNAWAYATNFVPGK
Sbjct  245  HLADPVNNNAWAYATNFVPGK  265



>ref|XP_004294267.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   422 bits (1084),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 210/273 (77%), Positives = 231/273 (85%), Gaps = 13/273 (5%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKSAPQ----SIWYGP  280
            SS+MA   +   + AGQ+  L   T  L      G  R TMR+T   +      S WYGP
Sbjct  3    SSAMA---LSSPSLAGQAVKLSPSTSTLF-----GEGRVTMRKTAAKSKNVSSGSPWYGP  54

Query  281  DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC  460
            DR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC
Sbjct  55   DRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC  114

Query  461  VFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVE  640
            VFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VE
Sbjct  115  VFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVE  174

Query  641  GYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAI  820
            GYR+ GGPLGE +D +YPGG+FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFFVQAI
Sbjct  175  GYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAI  234

Query  821  VTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VTGKGPIENL DH+ADPV NNAW+YATNFVPGK
Sbjct  235  VTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>prf||1204205B protein 1B,chlorophyll binding
Length=265

 Score =   421 bits (1083),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 206/266 (77%), Positives = 232/266 (87%), Gaps = 6/266 (2%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRPKYLG  301
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            +NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE +D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  180  PLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL  239

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  240  ENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_006449644.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
 gb|ESR62884.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
Length=303

 Score =   423 bits (1087),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 210/286 (73%), Positives = 232/286 (81%), Gaps = 4/286 (1%)
 Frame = +2

Query  74   HTINSNRKLRRAEESSSMASCGIQQSAFAGQSALKSQTDLLRKVGS--SGSARFTMRRTV  247
            H  NS    R  E +++   C +  S  A  S+   +   L   G+  S   R +MR+T 
Sbjct  18   HGSNSPLNTRTLELTNNSDHCKMATSTMALSSSFVGKAVNLAPSGNELSNGGRISMRKTG  77

Query  248  KSAPQS--IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEV  421
              +  S   WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEV
Sbjct  78   SKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEV  137

Query  422  IHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA  601
            IH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILA
Sbjct  138  IHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILA  197

Query  602  IWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRL  781
            IWA QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRL
Sbjct  198  IWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRL  257

Query  782  AMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  258  AMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  303



>gb|ABK23849.1| unknown [Picea sitchensis]
Length=278

 Score =   422 bits (1085),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 211/277 (76%), Positives = 235/277 (85%), Gaps = 9/277 (3%)
 Frame = +2

Query  116  SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  268
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AAAMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  269  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  448
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  449  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  628
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILACQVILM  181

Query  629  GFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  808
            G +EGYRV GGPLGE  D +YPGG FDPLG ADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGWADDPDAFAELKVKELKNGRLAMFSMFGFF  241

Query  809  VQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            VQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  278



>gb|ABW70800.1| chloroplast light harvesting chlorophyll a/b binding protein 
[Populus euphratica]
Length=263

 Score =   421 bits (1083),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 202/236 (86%), Positives = 216/236 (92%), Gaps = 1/236 (0%)
 Frame = +2

Query  215  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  391
            G+   +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  28   GNGCISMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  392  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  571
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  147

Query  572  NLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAEL  751
            +LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAEL
Sbjct  148  SLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  207

Query  752  KVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KVKELKNGRLAMFSM GFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  208  KVKELKNGRLAMFSMLGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_006361530.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006361531.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   421 bits (1083),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 229/268 (85%), Gaps = 8/268 (3%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQ----SIWYGPDRPKY  295
            A+  +  S FAG++   S +        +G+ RFTMR+T   A      S WYGPDR KY
Sbjct  4    ATMALSSSTFAGKAVKLSPSS----SEITGNGRFTMRKTATKAKPVSSGSPWYGPDRVKY  59

Query  296  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  475
            LGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+
Sbjct  60   LGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL  119

Query  476  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  655
            L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ 
Sbjct  120  LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA  179

Query  656  GGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG  835
            GGPLGE +D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct  180  GGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG  239

Query  836  PIENLFDHVADPVANNAWAYATNFVPGK  919
            P+ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  240  PLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_004233101.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   421 bits (1083),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 201/238 (84%), Positives = 221/238 (93%), Gaps = 2/238 (1%)
 Frame = +2

Query  212  SGSARFTMRRTV-KSAPQSI-WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSAD  385
            SG+ R TMR+ V KSAP S  WYGPDR KYLGPFS ++PSYLTGEFPGDYGWDTAGLSAD
Sbjct  28   SGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSAD  87

Query  386  PETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLG  565
            PETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLG
Sbjct  88   PETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLG  147

Query  566  NPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFA  745
            NP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+FDPLGLA+DPEAFA
Sbjct  148  NPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFA  207

Query  746  ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            ELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  208  ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>gb|AIR93785.1| chloroplast light harvesting chlorophyll A/B binding protein 
[Kalanchoe fedtschenkoi]
Length=267

 Score =   421 bits (1083),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 213/275 (77%), Positives = 236/275 (86%), Gaps = 17/275 (6%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALK---SQTDLLRKVGSSGSARFTMRRT-VKSAPQSI---WY  274
            +S+MA   +   + AGQ A+K   S +D+L      G  R +MR+T  K  P S    WY
Sbjct  3    ASTMA---LSSPSLAGQ-AIKLAPSASDIL------GEGRISMRKTGAKPKPVSSGSPWY  52

Query  275  GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGAL  454
            GPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGAL
Sbjct  53   GPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGAL  112

Query  455  GCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGF  634
            GCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG 
Sbjct  113  GCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGA  172

Query  635  VEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQ  814
            VEGYRV GGPLGE +D +YPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQ
Sbjct  173  VEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQ  232

Query  815  AIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  233  AIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum]
Length=266

 Score =   421 bits (1083),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 221/239 (92%), Gaps = 4/239 (2%)
 Frame = +2

Query  215  GSARFTMRRTVKS----APQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  382
            G ARFTMR++  +    +  S WYGPDR KYLGPFS ++PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  87

Query  383  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  562
            DPETF++NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  563  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAF  742
            GNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+FDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  743  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH++DPV NNAW+YATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK  266



>ref|XP_008356026.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
 ref|XP_008364190.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 218/237 (92%), Gaps = 2/237 (1%)
 Frame = +2

Query  215  GSARFTMRRTV--KSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADP  388
            G+ R +MR+T   K +  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADP
Sbjct  29   GNGRVSMRKTATKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  88

Query  389  ETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGN  568
            ETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGN
Sbjct  89   ETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGN  148

Query  569  PNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAE  748
            P+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAE
Sbjct  149  PSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAE  208

Query  749  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            LKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPVANNAW YATNFVPGK
Sbjct  209  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  265



>gb|ACL50948.1| putative chloroplast chlorophyll a/b binding protein [Solanum 
nigrum]
Length=249

 Score =   421 bits (1081),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 202/238 (85%), Positives = 221/238 (93%), Gaps = 2/238 (1%)
 Frame = +2

Query  212  SGSARFTMRRTV-KSAPQSI-WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSAD  385
            SG+ R TMR+ V KSAP S  WYGPDR KYLGPFS ++PSYLTGEFPGDYGWDTAGLSAD
Sbjct  12   SGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSAD  71

Query  386  PETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLG  565
            PETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLG
Sbjct  72   PETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLG  131

Query  566  NPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEAFA  745
            NP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+FDPLGLADDPEAFA
Sbjct  132  NPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFA  191

Query  746  ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            ELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct  192  ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  249



>ref|XP_010316912.1| PREDICTED: chlorophyll a-b binding protein 1A, chloroplastic 
[Solanum lycopersicum]
Length=265

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 206/262 (79%), Positives = 231/262 (88%), Gaps = 6/262 (2%)
 Frame = +2

Query  140  IQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRPKYLGPFSE  313
            +   +FAGQ+   S +       +SG+ R TMR+ V KSAP S  WYGPDR KYLGPFS 
Sbjct  8    LSSPSFAGQAVKLSPS----ASENSGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSG  63

Query  314  QTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGV  493
            ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGV
Sbjct  64   ESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGV  123

Query  494  KFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGE  673
            KFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE
Sbjct  124  KFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGE  183

Query  674  GLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLF  853
             +D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL 
Sbjct  184  VVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLA  243

Query  854  DHVADPVANNAWAYATNFVPGK  919
            DH+ADPV NNAWA+ATNFVPGK
Sbjct  244  DHLADPVNNNAWAFATNFVPGK  265



>ref|XP_006844081.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Amborella 
trichopoda]
 gb|ERN05756.1| hypothetical protein AMTR_s00006p00251360 [Amborella trichopoda]
Length=266

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 231/268 (86%), Gaps = 5/268 (2%)
 Frame = +2

Query  125  MASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRPKY  295
            MA+  +   +FAG++  + ++++    V   G  R +MR++   AP S   WYGPDR KY
Sbjct  1    MATMSLSSPSFAGKAVPVATRSEFGSTV--RGDGRVSMRKSASRAPVSGSPWYGPDRVKY  58

Query  296  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  475
            LGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+
Sbjct  59   LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL  118

Query  476  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  655
            LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA+QV+LM  VEGYRV 
Sbjct  119  LSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVILMSAVEGYRVA  178

Query  656  GGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG  835
            GGPLGE  D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct  179  GGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG  238

Query  836  PIENLFDHVADPVANNAWAYATNFVPGK  919
            P+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  239  PLENLADHLADPVNNNAWAYATNFVPGK  266



>gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 234/270 (87%), Gaps = 9/270 (3%)
 Frame = +2

Query  116  SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQSI-WYGPDRP  289
            +S+MA   +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR 
Sbjct  3    ASTMA---LSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRV  55

Query  290  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  469
            KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFP
Sbjct  56   KYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFP  115

Query  470  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR  649
            E+L++NGVKFGE VWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR
Sbjct  116  ELLARNGVKFGEVVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYR  175

Query  650  VGGGPLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTG  829
            + GGPLGE +D +YPGG+FDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTG
Sbjct  176  IAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTG  235

Query  830  KGPIENLFDHVADPVANNAWAYATNFVPGK  919
            KGP+ENL DH+ADPV NNAW+YATNFVPGK
Sbjct  236  KGPLENLADHLADPVNNNAWSYATNFVPGK  265



>ref|XP_009772885.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 4/240 (2%)
 Frame = +2

Query  212  SGSARFTMRRTVKSAPQ----SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLS  379
            +G+ + TMR+TV  A      S WYGPDR KYLGPFS ++PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  380  ADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDY  559
            ADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  560  LGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPEA  739
            LGNP+L+HAQSILAIWA QVVLMG VEGYRV GGPLGE +D +YPGG+FDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  740  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK  919
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_003548104.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Glycine max]
Length=264

 Score =   421 bits (1082),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/264 (78%), Positives = 228/264 (86%), Gaps = 3/264 (1%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  307
            ++  +  S+ AGQ+   + +     VG   S R T  +TV S   S WYGPDR KYLGPF
Sbjct  4    STMALSSSSLAGQAIKLAPSTPQLGVGRV-SMRKTASKTVTSG--SPWYGPDRVKYLGPF  60

Query  308  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  487
            S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LS+N
Sbjct  61   SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRN  120

Query  488  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPL  667
            GVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYR+ GGPL
Sbjct  121  GVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPL  180

Query  668  GEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIEN  847
            GE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+EN
Sbjct  181  GEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLEN  240

Query  848  LFDHVADPVANNAWAYATNFVPGK  919
            L DH+ADPV NNAWAYATNFVPGK
Sbjct  241  LADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_001775090.1| predicted protein [Physcomitrella patens]
 ref|XP_001775114.1| predicted protein [Physcomitrella patens]
 gb|EDQ60062.1| predicted protein [Physcomitrella patens]
 gb|EDQ60086.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   421 bits (1081),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 226/253 (89%), Gaps = 3/253 (1%)
 Frame = +2

Query  161  GQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGE  340
            GQS LK   +L R+VG++  AR TMR++  S   SIWYG DRPK+LGPFS +TPSYL GE
Sbjct  14   GQSLLKPVNELSRRVGAN-EARVTMRKSAGS--DSIWYGADRPKFLGPFSGETPSYLNGE  70

Query  341  FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFK  520
            F GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+K+GVKFGEAVWFK
Sbjct  71   FAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVWFK  130

Query  521  AGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGG  700
            AGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRV GGPLGE  D +YPGG
Sbjct  131  AGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPIYPGG  190

Query  701  AFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVAN  880
            +FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPVAN
Sbjct  191  SFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPVAN  250

Query  881  NAWAYATNFVPGK  919
            NAWAYATNFVPG 
Sbjct  251  NAWAYATNFVPGN  263



>ref|NP_001240146.1| chlorophyll a-b binding protein 21, chloroplastic-like [Glycine 
max]
 gb|AAA50172.1| photosystem II type I chlorophyll a/b-binding protein [Glycine 
max]
 gb|ACU18421.1| unknown [Glycine max]
 gb|KHN41285.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   421 bits (1082),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/266 (77%), Positives = 226/266 (85%), Gaps = 7/266 (3%)
 Frame = +2

Query  128  ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKS--APQSIWYGPDRPKYLG  301
            ++  +  S+ AGQ+       L       G  R +MR+T     +  S WYGPDR KYLG
Sbjct  4    STMALSSSSLAGQA-----IKLAPSTPELGVGRVSMRKTASKTVSSGSPWYGPDRVKYLG  58

Query  302  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  481
            PFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LS
Sbjct  59   PFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLS  118

Query  482  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  661
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYR+ GG
Sbjct  119  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGG  178

Query  662  PLGEGLDKVYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI  841
            PLGE  D +YPGG+FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct  179  PLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPL  238

Query  842  ENLFDHVADPVANNAWAYATNFVPGK  919
            ENL DH+ADPV NNAWAYATNFVPGK
Sbjct  239  ENLADHLADPVNNNAWAYATNFVPGK  264



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3219410483011