BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1833

Length=798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAA34096.1|  plasma membrane H+ ATPase                               237   2e-71   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001234477.1|  plasma membrane H+-ATPase                          238   2e-68   Solanum lycopersicum
gb|AAA34052.1|  H+-translocating ATPase                                 238   4e-68   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                237   4e-68   Nicotiana tomentosiformis
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                237   4e-68   Nicotiana sylvestris
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      237   5e-68   Solanum tuberosum [potatoes]
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           237   5e-68   Solanum tuberosum [potatoes]
sp|P23980.1|PMA2_SOLLC  RecName: Full=Plasma membrane ATPase 2; A...    234   5e-68   Solanum lycopersicum
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                237   7e-68   
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                237   7e-68   Nicotiana sylvestris
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    236   9e-68   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|EYU35892.1|  hypothetical protein MIMGU_mgv1a0008592mg               222   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                234   4e-67   Nicotiana tomentosiformis
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                234   5e-67   Nicotiana sylvestris
emb|CDP14881.1|  unnamed protein product                                234   6e-67   Coffea canephora [robusta coffee]
ref|NP_001183637.1|  uncharacterized protein LOC100502231               217   4e-65   
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    228   9e-65   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                227   1e-64   Sesamum indicum [beniseed]
ref|NP_001234775.1|  plasma membrane ATPase 1                           227   2e-64   Solanum lycopersicum
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         227   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           227   2e-64   Solanum tuberosum [potatoes]
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    226   5e-64   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             224   1e-63   Prunus persica
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    224   1e-63   
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         224   1e-63   Prunus mume [ume]
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    223   4e-63   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         223   4e-63   Populus euphratica
ref|XP_012080196.1|  PREDICTED: ATPase 11, plasma membrane-type         223   7e-63   Jatropha curcas
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    222   9e-63   Sesamum indicum [beniseed]
gb|AAQ55291.1|  plasma membrane H+-ATPase                               222   9e-63   Juglans regia
emb|CDY30730.1|  BnaA02g33520D                                          221   1e-62   Brassica napus [oilseed rape]
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         221   2e-62   Eucalyptus grandis [rose gum]
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    221   2e-62   Pyrus x bretschneideri [bai li]
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein            219   2e-62   Gossypium arboreum [tree cotton]
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         221   2e-62   Fragaria vesca subsp. vesca
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          221   2e-62   Oryza sativa Japonica Group [Japonica rice]
emb|CAB41144.1|  H+-transporting ATPase-like protein                    221   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190378.2|  H(+)-ATPase 4                                         221   3e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EEC69747.1|  hypothetical protein OsI_39279                          221   3e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    221   3e-62   Populus euphratica
dbj|BAC77533.1|  plasma membrane H+-ATPase                              212   3e-62   Sesbania rostrata
emb|CDY45757.1|  BnaC02g42250D                                          221   3e-62   Brassica napus [oilseed rape]
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             221   3e-62   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    221   3e-62   Brassica rapa
ref|NP_001067382.1|  Os12g0638700                                       221   3e-62   
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    221   3e-62   Brassica rapa
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    221   3e-62   Brassica rapa
ref|XP_011651238.1|  PREDICTED: ATPase 11, plasma membrane-type         220   5e-62   Cucumis sativus [cucumbers]
ref|NP_201073.1|  H(+)-ATPase 11                                        220   6e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             220   6e-62   Capsella rubella
ref|XP_002864812.1|  AHA11-ATPASE 11                                    220   6e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_012082827.1|  PREDICTED: plasma membrane ATPase 1-like           219   7e-62   Jatropha curcas
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    219   7e-62   
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    219   8e-62   
gb|KJB19302.1|  hypothetical protein B456_003G094300                    219   9e-62   Gossypium raimondii
dbj|BAC77532.1|  plasma membrane H+-ATPase                              219   1e-61   Sesbania rostrata
emb|CAC29435.1|  P-type H+-ATPase                                       219   1e-61   Vicia faba [broad bean]
gb|AFC88896.1|  plasma membrane H+-ATPase                               219   1e-61   Melastoma malabathricum
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           219   1e-61   Oryza brachyantha
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    219   1e-61   Nelumbo nucifera [Indian lotus]
dbj|BAD16686.1|  plasma membrane H+-ATPase                              219   1e-61   Daucus carota [carrots]
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    219   2e-61   Nelumbo nucifera [Indian lotus]
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       217   2e-61   Cucumis sativus [cucumbers]
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                218   3e-61   Elaeis guineensis
gb|KJB33641.1|  hypothetical protein B456_006G023600                    218   3e-61   Gossypium raimondii
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    218   3e-61   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          218   3e-61   Sorghum bicolor [broomcorn]
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    218   3e-61   
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         218   3e-61   Cucumis melo [Oriental melon]
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           218   3e-61   Elaeis guineensis
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     218   3e-61   Phoenix dactylifera
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            216   4e-61   Gossypium arboreum [tree cotton]
dbj|BAD16689.1|  plasma membrane H+-ATPase                              217   5e-61   Daucus carota [carrots]
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    217   6e-61   Glycine max [soybeans]
ref|NP_001169535.1|  uncharacterized protein LOC100383411               206   6e-61   
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           217   6e-61   Setaria italica
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         217   7e-61   Pyrus x bretschneideri [bai li]
ref|XP_006838797.1|  PREDICTED: plasma membrane ATPase 3                217   8e-61   Amborella trichopoda
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    217   8e-61   Cicer arietinum [garbanzo]
gb|KEH24965.1|  plasma membrane H+-ATPase                               217   8e-61   Medicago truncatula
ref|XP_007032428.1|  H(+)-ATPase 4 isoform 2                            216   9e-61   
gb|KEH24964.1|  plasma membrane H+-ATPase                               216   9e-61   Medicago truncatula
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             216   9e-61   Phaseolus vulgaris [French bean]
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         216   1e-60   Phoenix dactylifera
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         216   1e-60   
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             216   1e-60   Citrus clementina [clementine]
ref|XP_007032427.1|  H(+)-ATPase 4 isoform 1                            216   1e-60   
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             216   2e-60   Capsella rubella
gb|KGN63646.1|  hypothetical protein Csa_1G008520                       215   2e-60   Cucumis sativus [cucumbers]
gb|KEH31901.1|  plasma membrane H+-ATPase                               216   2e-60   Medicago truncatula
gb|AEQ27823.1|  PM H+-ATPase L                                          216   2e-60   Eichhornia crassipes
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             216   2e-60   Citrus clementina [clementine]
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like           216   2e-60   Citrus sinensis [apfelsine]
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                215   3e-60   Cucumis melo [Oriental melon]
ref|XP_011659953.1|  PREDICTED: plasma membrane ATPase 3                215   3e-60   Cucumis sativus [cucumbers]
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         215   3e-60   Glycine soja [wild soybean]
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    215   3e-60   Glycine max [soybeans]
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    215   3e-60   Citrus sinensis [apfelsine]
gb|ACN49187.1|  plasma membrane ATPase 1-like protein                   212   4e-60   Triticum aestivum [Canadian hard winter wheat]
gb|EMT31912.1|  Plasma membrane ATPase 1                                215   4e-60   
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                215   4e-60   Brachypodium distachyon [annual false brome]
ref|XP_002517457.1|  H(\+)-transporting atpase plant/fungi plasma...    213   5e-60   
ref|XP_010548837.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 11, p...    201   5e-60   Tarenaya hassleriana [spider flower]
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           215   5e-60   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    214   6e-60   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    214   6e-60   Cucumis melo [Oriental melon]
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             213   1e-59   Phaseolus vulgaris [French bean]
ref|XP_002875872.1|  predicted protein                                  197   2e-59   
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     213   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN52442.1|  hypothetical protein Csa_5G635370                       212   2e-59   Cucumis sativus [cucumbers]
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     213   2e-59   Vitis vinifera
ref|XP_009398400.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     213   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK04567.1|  predicted protein                                      213   3e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    213   3e-59   Cucumis sativus [cucumbers]
dbj|BAJ92653.1|  predicted protein                                      213   3e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           212   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type          211   1e-58   Vitis vinifera
ref|XP_006595243.1|  PREDICTED: plasma membrane ATPase 1-like           211   1e-58   
gb|KHN13245.1|  Plasma membrane ATPase 1                                211   1e-58   Glycine soja [wild soybean]
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    211   1e-58   Nelumbo nucifera [Indian lotus]
tpg|DAA50741.1|  TPA: hypothetical protein ZEAMMB73_722190              212   2e-58   
ref|XP_003561110.1|  PREDICTED: plasma membrane ATPase 1-like           210   2e-58   Brachypodium distachyon [annual false brome]
dbj|BAA01058.1|  H-ATPase                                               210   3e-58   Oryza sativa Japonica Group [Japonica rice]
gb|EMT26085.1|  Plasma membrane ATPase 1                                210   3e-58   
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     209   3e-58   Eucalyptus grandis [rose gum]
ref|NP_001050947.1|  Os03g0689300                                       209   3e-58   
gb|EEC75974.1|  hypothetical protein OsI_13084                          209   3e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           209   5e-58   
gb|EMS45119.1|  Plasma membrane ATPase 1                                209   7e-58   Triticum urartu
ref|XP_010087815.1|  hypothetical protein L484_001526                   197   9e-58   
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...    208   1e-57   
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     207   2e-57   Eucalyptus grandis [rose gum]
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    207   2e-57   Eucalyptus grandis [rose gum]
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    207   3e-57   Glycine max [soybeans]
gb|KHN34200.1|  ATPase 11, plasma membrane-type                         207   3e-57   Glycine soja [wild soybean]
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like           207   3e-57   Glycine max [soybeans]
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                206   4e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011466246.1|  PREDICTED: plasma membrane ATPase 1-like iso...    206   4e-57   Fragaria vesca subsp. vesca
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           206   7e-57   Sesamum indicum [beniseed]
ref|XP_004302360.1|  PREDICTED: plasma membrane ATPase 1-like iso...    206   9e-57   Fragaria vesca subsp. vesca
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    205   1e-56   
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           205   1e-56   Setaria italica
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    205   2e-56   Glycine max [soybeans]
ref|XP_007151191.1|  hypothetical protein PHAVU_004G025700g             204   3e-56   Phaseolus vulgaris [French bean]
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg             203   6e-56   
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           203   6e-56   Setaria italica
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like     202   9e-56   Tarenaya hassleriana [spider flower]
gb|KJB19306.1|  hypothetical protein B456_003G094300                    203   1e-55   Gossypium raimondii
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like           202   1e-55   Prunus mume [ume]
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                202   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           202   2e-55   Pyrus x bretschneideri [bai li]
gb|ACR38028.1|  unknown                                                 193   2e-55   Zea mays [maize]
ref|XP_002466646.1|  hypothetical protein SORBIDRAFT_01g011610          199   4e-55   
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           200   8e-55   
ref|NP_001136587.1|  uncharacterized protein LOC100216710               193   1e-54   
tpg|DAA59899.1|  TPA: membrane H(+)-ATPase1                             193   1e-54   
tpg|DAA59901.1|  TPA: membrane H(+)-ATPase1                             193   2e-54   
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...    198   2e-53   
emb|CAH58642.1|  plasma membrane H+-ATPase                              183   4e-53   Plantago major [cart-track plant]
gb|ACN34067.1|  unknown                                                 193   6e-53   Zea mays [maize]
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          194   2e-52   Sorghum bicolor [broomcorn]
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...    193   3e-52   
gb|KGN62871.1|  hypothetical protein Csa_2G378530                       179   6e-52   Cucumis sativus [cucumbers]
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    190   3e-51   Brachypodium distachyon [annual false brome]
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    190   4e-51   Brachypodium distachyon [annual false brome]
gb|AFK46374.1|  unknown                                                 179   2e-50   Lotus japonicus
gb|ABR18001.1|  unknown                                                 186   6e-50   Picea sitchensis
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             185   2e-49   Citrus sinensis [apfelsine]
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             185   2e-49   Citrus clementina [clementine]
gb|KHN35778.1|  Plasma membrane ATPase 4                                177   5e-49   Glycine soja [wild soybean]
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type         184   6e-49   Eucalyptus grandis [rose gum]
gb|KCW83494.1|  hypothetical protein EUGRSUZ_B00400                     184   6e-49   Eucalyptus grandis [rose gum]
gb|KJB55190.1|  hypothetical protein B456_009G068100                    184   6e-49   Gossypium raimondii
gb|AAY42948.1|  plasma membrane H+ ATPase                               184   7e-49   Lupinus albus
gb|AAB17186.1|  plasma membrane H+-ATPase                               183   8e-49   Solanum lycopersicum
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                183   8e-49   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      183   8e-49   Solanum tuberosum [potatoes]
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          183   9e-49   Fragaria vesca subsp. vesca
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            181   9e-49   Gossypium arboreum [tree cotton]
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   182   1e-48   Citrus sinensis [apfelsine]
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          182   1e-48   Pyrus x bretschneideri [bai li]
emb|CDP02191.1|  unnamed protein product                                183   2e-48   Coffea canephora [robusta coffee]
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          182   2e-48   
gb|KJB55189.1|  hypothetical protein B456_009G068100                    182   2e-48   Gossypium raimondii
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                182   2e-48   Nicotiana tomentosiformis
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                182   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  182   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD16685.1|  plasma membrane H+-ATPase                              182   3e-48   Daucus carota [carrots]
gb|KJB19303.1|  hypothetical protein B456_003G094300                    182   3e-48   Gossypium raimondii
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                     182   3e-48   Eucalyptus grandis [rose gum]
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                182   3e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                182   3e-48   Nicotiana sylvestris
ref|XP_006428674.1|  hypothetical protein CICLE_v10011040mg             181   3e-48   
gb|ABM68570.1|  plasma membrane H+ ATPase                               169   3e-48   Lilium longiflorum [Easter lily]
gb|AAY42950.1|  plasma membrane H+ ATPase                               182   3e-48   Lupinus albus
gb|EPS66977.1|  hypothetical protein M569_07799                         181   3e-48   Genlisea aurea
gb|KHN22686.1|  Plasma membrane ATPase 4                                182   3e-48   Glycine soja [wild soybean]
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type          181   4e-48   Cucumis sativus [cucumbers]
ref|XP_006480481.1|  PREDICTED: ATPase 4, plasma membrane-type-like     181   4e-48   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           181   4e-48   Oryza brachyantha
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 181   6e-48   
gb|KEH39623.1|  plasma membrane H+-ATPase                               181   6e-48   Medicago truncatula
emb|CAB69823.1|  plasma membrane H+ ATPase                              181   6e-48   Prunus persica
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             181   6e-48   
emb|CDP04837.1|  unnamed protein product                                170   6e-48   Coffea canephora [robusta coffee]
ref|XP_010094202.1|  Plasma membrane ATPase 4                           181   7e-48   Morus notabilis
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             181   7e-48   Elaeis guineensis
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                181   8e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012075128.1|  PREDICTED: plasma membrane ATPase 4                181   8e-48   
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             181   8e-48   Phaseolus vulgaris [French bean]
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           181   9e-48   Phoenix dactylifera
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    181   9e-48   Glycine max [soybeans]
emb|CAC29436.1|  P-type H+-ATPase                                       181   9e-48   Vicia faba [broad bean]
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    180   1e-47   Prunus mume [ume]
gb|AAB41898.1|  H+-transporting ATPase                                  180   1e-47   Mesembryanthemum crystallinum
ref|XP_003594954.1|  Plasma membrane ATPase                             180   1e-47   Medicago truncatula
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       179   1e-47   Cucumis sativus [cucumbers]
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          180   1e-47   Medicago truncatula
emb|CDP14278.1|  unnamed protein product                                181   1e-47   Coffea canephora [robusta coffee]
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    180   1e-47   Populus euphratica
gb|KHN17608.1|  Plasma membrane ATPase 4                                180   1e-47   Glycine soja [wild soybean]
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             180   1e-47   Elaeis guineensis
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           180   2e-47   Cicer arietinum [garbanzo]
gb|KEH35952.1|  plasma membrane H+-ATPase                               180   2e-47   Medicago truncatula
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    180   2e-47   Glycine max [soybeans]
gb|AFW04239.1|  plasma membrane H+-ATPase                               180   2e-47   Sesuvium portulacastrum [sea-purslane]
emb|CAD29579.1|  proton-exporting ATPase                                171   2e-47   Zea mays [maize]
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                180   2e-47   Phoenix dactylifera
emb|CAD62443.1|  proton-exporting ATPase                                171   2e-47   Zea mays [maize]
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    179   2e-47   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           179   2e-47   Cucumis melo [Oriental melon]
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     179   2e-47   Glycine max [soybeans]
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          179   2e-47   Glycine soja [wild soybean]
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      179   2e-47   Glycine max [soybeans]
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    179   2e-47   Glycine max [soybeans]
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           179   2e-47   Malus domestica [apple tree]
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     179   2e-47   Populus euphratica
gb|KHN15309.1|  Plasma membrane ATPase 4                                179   2e-47   Glycine soja [wild soybean]
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    179   2e-47   Glycine max [soybeans]
gb|KHN16462.1|  Plasma membrane ATPase 4                                179   2e-47   Glycine soja [wild soybean]
gb|KHF98166.1|  Plasma membrane ATPase 4                                177   2e-47   Gossypium arboreum [tree cotton]
ref|NP_001059093.1|  Os07g0191200                                       179   3e-47   
gb|EEC81667.1|  hypothetical protein OsI_25220                          179   3e-47   Oryza sativa Indica Group [Indian rice]
dbj|BAA06629.1|  plasma membrane H+-ATPase                              179   3e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           179   3e-47   Elaeis guineensis
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             179   3e-47   Phaseolus vulgaris [French bean]
emb|CDP14275.1|  unnamed protein product                                176   4e-47   Coffea canephora [robusta coffee]
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    179   4e-47   Glycine max [soybeans]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           179   4e-47   Elaeis guineensis
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             179   4e-47   Prunus persica
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  179   4e-47   Elaeis guineensis
ref|XP_007023380.1|  H(+)-ATPase 9                                      178   4e-47   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          178   4e-47   Glycine soja [wild soybean]
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             178   5e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           178   5e-47   Cicer arietinum [garbanzo]
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             178   5e-47   Phaseolus vulgaris [French bean]
emb|CBW30173.1|  Plasma membrane ATPase 4                               178   5e-47   Musa balbisiana [starchy banana]
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          178   5e-47   Medicago truncatula
gb|KEH39758.1|  plasma membrane H+-ATPase                               178   5e-47   Medicago truncatula
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             178   5e-47   Phaseolus vulgaris [French bean]
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           178   5e-47   Sesamum indicum [beniseed]
gb|ACN33231.1|  unknown                                                 175   5e-47   Zea mays [maize]
ref|XP_011649762.1|  PREDICTED: plasma membrane ATPase 4                178   6e-47   Cucumis sativus [cucumbers]
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type          178   6e-47   Cucumis sativus [cucumbers]
emb|CAA59799.1|  H(+)-transporting ATPase                               178   6e-47   Phaseolus vulgaris [French bean]
gb|EPS59184.1|  hypothetical protein M569_15622                         174   6e-47   Genlisea aurea
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             178   6e-47   Vitis vinifera
emb|CBW30211.1|  Plasma membrane ATPase                                 178   7e-47   Musa balbisiana [starchy banana]
emb|CAN78639.1|  hypothetical protein VITISV_031738                     178   7e-47   Vitis vinifera
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           178   7e-47   Pyrus x bretschneideri [bai li]
emb|CBI35956.3|  unnamed protein product                                178   7e-47   Vitis vinifera
emb|CAG28306.1|  proton-exporting ATPase                                170   7e-47   Cucumis sativus [cucumbers]
gb|KJB65971.1|  hypothetical protein B456_010G123000                    178   9e-47   Gossypium raimondii
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             177   9e-47   Oryza brachyantha
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          177   9e-47   Prunus mume [ume]
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    177   1e-46   Ricinus communis
dbj|BAA37150.1|  p-type H+-ATPase                                       177   1e-46   Vicia faba [broad bean]
gb|KJB33642.1|  hypothetical protein B456_006G023600                    177   1e-46   Gossypium raimondii
gb|KJB82763.1|  hypothetical protein B456_013G212200                    177   1e-46   Gossypium raimondii
dbj|BAC77531.1|  plasma membrane H+-ATPase                              177   1e-46   
ref|XP_011625064.1|  PREDICTED: plasma membrane ATPase 4 isoform X4     177   1e-46   
dbj|BAM20990.1|  plasma membrane H+-ATPase                              177   1e-46   
emb|CDP02997.1|  unnamed protein product                                177   1e-46   
ref|XP_006404985.1|  hypothetical protein EUTSA_v10000729mg             166   1e-46   
dbj|BAO45902.1|  plasma membrane H+-ATPase                              177   1e-46   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       177   1e-46   
ref|XP_006848755.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     177   1e-46   
ref|XP_011625063.1|  PREDICTED: plasma membrane ATPase 4 isoform X3     177   2e-46   
ref|XP_002309321.1|  ATPase 6 family protein                            177   2e-46   
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           177   2e-46   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             177   2e-46   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       177   2e-46   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          177   2e-46   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           177   2e-46   
ref|XP_011625062.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     177   2e-46   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     177   2e-46   
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    177   2e-46   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          176   2e-46   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             176   2e-46   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           176   2e-46   
gb|AAY42949.1|  plasma membrane H+ ATPase                               176   2e-46   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    176   3e-46   
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                  176   3e-46   
gb|KJB70727.1|  hypothetical protein B456_011G089100                    176   3e-46   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          176   3e-46   
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           176   3e-46   
dbj|BAD16684.1|  plasma membrane H+-ATPase                              176   4e-46   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                175   4e-46   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                176   4e-46   
ref|XP_002324564.1|  ATPase 6 family protein                            176   4e-46   
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  172   5e-46   
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       175   5e-46   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             176   5e-46   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           176   5e-46   
gb|AEQ27822.1|  PM H+-ATPase R                                          176   5e-46   
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     176   5e-46   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  175   6e-46   
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           175   6e-46   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             175   7e-46   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             175   7e-46   
ref|XP_006845683.1|  PREDICTED: plasma membrane ATPase 4                175   7e-46   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           175   7e-46   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             174   8e-46   
ref|XP_006382164.1|  H+-ATPase family protein                           175   8e-46   
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                175   8e-46   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           175   8e-46   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           175   8e-46   
emb|CAD29313.1|  plasma membrane H+-ATPase                              175   8e-46   
ref|NP_001054118.1|  Os04g0656100                                       175   8e-46   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          175   8e-46   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          175   9e-46   
dbj|BAD16687.1|  plasma membrane H+-ATPase                              175   9e-46   
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             174   9e-46   
gb|KHN01287.1|  Plasma membrane ATPase 4                                174   1e-45   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             175   1e-45   
gb|KHG28536.1|  Plasma membrane ATPase 4                                172   1e-45   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          174   1e-45   
emb|CAN64375.1|  hypothetical protein VITISV_014422                     174   1e-45   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   174   1e-45   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             174   1e-45   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           174   1e-45   
gb|KJB22049.1|  hypothetical protein B456_004G027300                    172   1e-45   
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    172   1e-45   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             174   2e-45   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           174   2e-45   
ref|XP_012076337.1|  PREDICTED: plasma membrane ATPase 4                174   2e-45   
gb|EMS63640.1|  Plasma membrane ATPase 1                                174   2e-45   
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    174   2e-45   
dbj|BAC77530.1|  plasma membrane H+-ATPase                              174   2e-45   
ref|XP_010429928.1|  PREDICTED: ATPase 9, plasma membrane-type-like     165   2e-45   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                174   2e-45   
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        174   2e-45   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       174   2e-45   
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       174   2e-45   
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    172   2e-45   
gb|KHG26452.1|  Plasma membrane ATPase 4                                171   3e-45   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                174   3e-45   
ref|XP_012067540.1|  PREDICTED: ATPase 9, plasma membrane-type          174   3e-45   
gb|AEO22063.1|  plasma membrane H+-ATPase                               174   3e-45   
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    173   3e-45   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                173   3e-45   
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             173   4e-45   
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    173   4e-45   
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 172   4e-45   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             173   4e-45   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              173   5e-45   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             173   5e-45   
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                173   5e-45   
ref|NP_001292696.1|  plasma membrane ATPase 4                           173   5e-45   
gb|KJB22047.1|  hypothetical protein B456_004G027300                    172   5e-45   
ref|XP_007023381.1|  H(+)-ATPase 9                                      173   5e-45   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              172   6e-45   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          172   6e-45   
gb|AAB84202.2|  plasma membrane proton ATPase                           172   6e-45   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     172   6e-45   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 172   6e-45   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     172   7e-45   
gb|KJB22048.1|  hypothetical protein B456_004G027300                    172   7e-45   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          172   7e-45   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             172   7e-45   
gb|AAK31799.2|  plasma membrane H+ ATPase                               172   7e-45   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                172   8e-45   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          172   9e-45   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    172   9e-45   
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     172   9e-45   
dbj|BAG94605.1|  unnamed protein product                                172   1e-44   
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   172   1e-44   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                172   1e-44   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                172   1e-44   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    171   1e-44   
gb|ACL54575.1|  unknown                                                 171   1e-44   
ref|NP_001292777.1|  proton-exporting ATPase4                           171   1e-44   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          172   1e-44   
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                171   1e-44   
ref|NP_001292776.1|  plasma membrane ATPase                             171   2e-44   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             171   2e-44   
gb|AHK23067.1|  plasma membrane ATPase 4                                171   2e-44   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       171   2e-44   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     171   2e-44   
gb|KJB56561.1|  hypothetical protein B456_009G125200                    171   2e-44   
ref|XP_002307856.1|  ATPase 6 family protein                            171   2e-44   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          171   2e-44   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     171   2e-44   
ref|NP_189850.1|  H(+)-ATPase 8                                         171   2e-44   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     171   3e-44   
dbj|BAD94367.1|  plasma membrane proton ATPase                          161   3e-44   
gb|ABA18112.1|  putative plasma membrane ATPase                         171   3e-44   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             171   3e-44   
gb|KJB53771.1|  hypothetical protein B456_009G004200                    170   3e-44   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             171   3e-44   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   171   3e-44   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    171   3e-44   
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    170   3e-44   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           170   4e-44   
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             170   4e-44   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     170   5e-44   
gb|KHN38020.1|  Plasma membrane ATPase                                  169   5e-44   
emb|CAG28305.1|  proton-exporting ATPase                                162   5e-44   
ref|XP_010467151.1|  PREDICTED: ATPase 6, plasma membrane-type-like     161   5e-44   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          169   7e-44   
gb|AFM52333.1|  plasma membrane H+-ATPase                               169   7e-44   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     169   7e-44   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     169   7e-44   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           169   7e-44   
dbj|BAF03589.1|  P-type H+-ATPase                                       169   7e-44   
gb|KDO37765.1|  hypothetical protein CISIN_1g048662mg                   159   8e-44   
ref|XP_006428675.1|  hypothetical protein CICLE_v10013498mg             169   9e-44   
ref|XP_011621190.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     169   9e-44   
ref|XP_011621189.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     169   9e-44   
gb|ABA18090.1|  putative plasma membrane ATPase                         169   9e-44   
gb|AAO22672.1|  putative plasma membrane proton ATPase                  162   1e-43   
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             169   1e-43   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    169   1e-43   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              169   1e-43   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                169   1e-43   
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    169   1e-43   
gb|ERN00217.1|  hypothetical protein AMTR_s00111p00107570               169   1e-43   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             168   2e-43   
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    168   2e-43   
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    168   2e-43   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          168   2e-43   
gb|EPS65442.1|  hypothetical protein M569_09334                         168   2e-43   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             168   2e-43   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                168   2e-43   
emb|CDY39956.1|  BnaC06g40340D                                          167   3e-43   
ref|XP_002979990.1|  hypothetical protein SELMODRAFT_419690             168   3e-43   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       167   3e-43   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             167   3e-43   
ref|NP_180028.1|  H(+)-ATPase 5                                         167   4e-43   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    167   4e-43   
ref|XP_002324397.1|  H+-ATPase family protein                           167   4e-43   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     167   4e-43   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     167   4e-43   
ref|NP_178181.1|  H(+)-ATPase 9                                         167   4e-43   
ref|XP_007012006.1|  H(+)-ATPase 8                                      167   5e-43   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    167   5e-43   
ref|NP_001185450.1|  H(+)-ATPase 9                                      167   5e-43   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     167   5e-43   
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    167   5e-43   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          167   6e-43   
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      164   6e-43   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           167   6e-43   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     167   7e-43   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     167   7e-43   
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    167   7e-43   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    167   7e-43   
gb|KJB66333.1|  hypothetical protein B456_010G136300                    167   7e-43   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             166   8e-43   
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                166   8e-43   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     166   8e-43   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  166   8e-43   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          166   9e-43   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          166   9e-43   
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     166   9e-43   
emb|CAC50884.1|  plasma membrane H+-ATPase                              164   1e-42   
emb|CBI20766.3|  unnamed protein product                                166   1e-42   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       165   1e-42   
ref|NP_001292679.1|  plasma membrane ATPase 4                           166   1e-42   
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           166   1e-42   
emb|CDX87330.1|  BnaA07g35430D                                          165   1e-42   
gb|KJB19305.1|  hypothetical protein B456_003G094300                    166   1e-42   
ref|XP_008666713.1|  PREDICTED: plasma membrane ATPase-like             154   1e-42   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  166   1e-42   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    166   1e-42   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     166   2e-42   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          166   2e-42   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                166   2e-42   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             165   2e-42   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           165   2e-42   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          165   2e-42   
ref|XP_010914191.1|  PREDICTED: plasma membrane ATPase-like             165   2e-42   
emb|CDO98206.1|  unnamed protein product                                165   3e-42   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     165   3e-42   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          165   3e-42   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             165   3e-42   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                165   3e-42   
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    164   3e-42   
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     164   4e-42   
ref|NP_178762.1|  H(+)-ATPase 6                                         164   4e-42   
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                164   4e-42   



>gb|AAA34096.1| plasma membrane H+ ATPase, partial [Nicotiana plumbaginifolia]
Length=440

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA+W+FAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  279  LVVAFLIAQLVATLIAVYANWAFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALS  338

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLA
Sbjct  339  GRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLA  398

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  399  EEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQSYTV  440



>ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersicum]
 gb|AAD55399.1|AF179442_1 plasma membrane H+-ATPase isoform LHA2 [Solanum lycopersicum]
 gb|AAF98344.1|AF275745_1 plasma membrane H+-ATPase [Solanum lycopersicum]
Length=956

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA WSFAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVVAFLIAQLVATLIAVYASWSFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLA
Sbjct  855  GRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   238 bits (606),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA+W+FAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVVAFLIAQLVATLIAVYANWAFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLA
Sbjct  855  GRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_009607762.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana tomentosiformis]
Length=957

 Score =   237 bits (605),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AFVIAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYNLV Y PLD+IKFF RYALS
Sbjct  796  LVIAFVIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNLVFYIPLDIIKFFIRYALS  855

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV E+RIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLA
Sbjct  856  GRAWDLVFERRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLA  915

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV
Sbjct  916  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV  957



>ref|XP_009798932.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana sylvestris]
Length=957

 Score =   237 bits (605),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AFVIAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYNLV Y PLD+IKFF RYALS
Sbjct  796  LVIAFVIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNLVFYIPLDIIKFFIRYALS  855

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV E+RIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLA
Sbjct  856  GRAWDLVFERRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLA  915

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV
Sbjct  916  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV  957



>ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuberosum]
 emb|CAA54046.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=956

 Score =   237 bits (605),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA WSFAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVVAFLIAQLVATLIAVYASWSFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSE+TNFN+LNQLA
Sbjct  855  GRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSESTNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   237 bits (605),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA WSFAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVVAFLIAQLVATLIAVYASWSFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSE+TNFN+LNQLA
Sbjct  855  GRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSESTNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>sp|P23980.1|PMA2_SOLLC RecName: Full=Plasma membrane ATPase 2; AltName: Full=Proton 
pump 2, partial [Solanum lycopersicum]
Length=704

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VA ++AQLVATLIAVYA WSFAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  543  LVVALIVAQLVATLIAVYASWSFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALS  602

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD KLFSEATNFN+LNQLA
Sbjct  603  GRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDIKLFSEATNFNELNQLA  662

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  663  EEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQSYTV  704



>ref|XP_009610426.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana tomentosiformis]
Length=956

 Score =   237 bits (604),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA W+FAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVVAFLIAQLVATLIAVYASWAFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLA
Sbjct  855  GRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_009793289.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana sylvestris]
Length=956

 Score =   237 bits (604),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA W+FAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVVAFLIAQLVATLIAVYASWAFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLA
Sbjct  855  GRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>sp|Q08435.1|PMA1_NICPL RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Nicotiana plumbaginifolia]
 gb|AAA34094.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=957

 Score =   236 bits (603),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AFVIAQLVATLIAVYA+WSFAAIEGIGWGWAGVIW+YNLV Y PLD+IKFF RYALS
Sbjct  796  LVIAFVIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWIYNLVFYIPLDIIKFFIRYALS  855

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV E+RIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLA
Sbjct  856  GRAWDLVFERRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLA  915

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV
Sbjct  916  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV  957



>gb|EYU35892.1| hypothetical protein MIMGU_mgv1a0008592mg, partial [Erythranthe 
guttata]
Length=267

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF IAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD+IKF TRYALS
Sbjct  106  LVAAFFIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIIKFLTRYALS  165

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTR+KDFGKEQREL+WAHAQRTLHGLQVPDTKLF+E  NF++LNQLA
Sbjct  166  GRAWDLVLEQRIAFTRQKDFGKEQRELKWAHAQRTLHGLQVPDTKLFNENNNFSELNQLA  225

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  226  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  267



>ref|XP_009626987.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana tomentosiformis]
Length=956

 Score =   234 bits (598),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLDL+KFF RYALS
Sbjct  795  LVVAFLIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLVKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLA
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV  956



>ref|XP_009799220.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana sylvestris]
Length=956

 Score =   234 bits (597),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLDLIKFF RYALS
Sbjct  795  LVVAFLIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLA
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>emb|CDP14881.1| unnamed protein product [Coffea canephora]
Length=950

 Score =   234 bits (597),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYNL+ Y PLD IKFFTRYALS
Sbjct  789  LVVAFVIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNLIFYIPLDFIKFFTRYALS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTR+KDFGKEQREL+WAHAQRTLHGLQVPDTKLFSEATNF +LNQLA
Sbjct  849  GRAWDLVLEQRIAFTRQKDFGKEQRELKWAHAQRTLHGLQVPDTKLFSEATNFTELNQLA  908

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  909  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  950



>ref|NP_001183637.1| uncharacterized protein LOC100502231 [Zea mays]
 gb|ACR37835.1| unknown [Zea mays]
Length=311

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW+F +I+GIGWGWAG++WLYN++ YFPLD+IKF  RYALS
Sbjct  150  LVFAFLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNIIFYFPLDIIKFLIRYALS  209

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFG+E+REL+WAHAQRTLHGLQ PD K+F E   +N+LNQ+A
Sbjct  210  GKAWDLVIEQRIAFTRKKDFGREERELKWAHAQRTLHGLQAPDAKMFPEKAGYNELNQMA  269

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  270  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  311



>sp|Q08436.1|PMA3_NICPL RecName: Full=Plasma membrane ATPase 3; AltName: Full=Proton 
pump 3 [Nicotiana plumbaginifolia]
 gb|AAA34098.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   228 bits (581),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF IAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLDL  F  RYALS
Sbjct  795  LVVAFFIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLXXFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLA
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQAYTV  956



>ref|XP_011087207.1| PREDICTED: plasma membrane ATPase 3 [Sesamum indicum]
Length=956

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD+IKFF RYALS
Sbjct  795  LVAAFVIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTR+KDFGKEQREL+WAHAQRTLHGLQVPDTKLF+E TNF++LNQLA
Sbjct  855  GRAWDLVLEQRIAFTRQKDFGKEQRELKWAHAQRTLHGLQVPDTKLFNETTNFSELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|NP_001234775.1| plasma membrane ATPase 1 [Solanum lycopersicum]
 sp|P22180.1|PMA1_SOLLC RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Solanum lycopersicum]
 gb|AAA34173.1| H+-ATPase [Solanum lycopersicum]
 prf||1803518A H ATPase
Length=956

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLDLIKF  RYALS
Sbjct  795  LVFAFFVAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDLIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLVLEQRIAFTRKKDFGKE RELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLA
Sbjct  855  GKAWDLVLEQRIAFTRKKDFGKELRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_010550649.1| PREDICTED: ATPase 11, plasma membrane-type [Tarenaya hassleriana]
Length=956

 Score =   227 bits (578),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 140/162 (86%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLDLIKFF RYALS
Sbjct  795  LVIAFIIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+ ++LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHVHELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_006367061.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLDLIKF  RYALS
Sbjct  795  LVFAFFVAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDLIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLVLEQRIAFTRKKDFGKE RELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLA
Sbjct  855  GKAWDLVLEQRIAFTRKKDFGKELRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_010112580.1| ATPase 11, plasma membrane-type [Morus notabilis]
 gb|EXC34215.1| ATPase 11, plasma membrane-type [Morus notabilis]
Length=950

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AFV+AQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYN++ Y PLDLIKFF RYALS
Sbjct  789  LLMAFVVAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNIIFYIPLDLIKFFIRYALS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+FN+LNQ+A
Sbjct  849  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFNELNQMA  908

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  909  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  950



>ref|XP_007210395.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
 emb|CAB69824.1| plasma membrane H+ ATPase [Prunus persica]
 gb|EMJ11594.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
Length=956

 Score =   224 bits (572),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVVAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFMIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL++EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+A
Sbjct  855  GKAWDLLIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_002511508.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF52110.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=801

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQLVATLIAVYA WSFAAIEGIGWGWAGVIWLYNL+ YFPLD IKFF RYALS
Sbjct  640  LVVAFVIAQLVATLIAVYASWSFAAIEGIGWGWAGVIWLYNLIFYFPLDFIKFFIRYALS  699

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +A
Sbjct  700  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNNMA  759

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  760  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  801



>ref|XP_008239652.1| PREDICTED: ATPase 11, plasma membrane-type [Prunus mume]
Length=956

 Score =   224 bits (572),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVVAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFMIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL++EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+A
Sbjct  855  GKAWDLLIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_002318614.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEE96834.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=966

 Score =   223 bits (569),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQL+ATLIAVYA+WSFAAI+GIGWGWAGVIWLYN++ YFPLD IKFF RYALS
Sbjct  805  LVVAFIIAQLIATLIAVYANWSFAAIKGIGWGWAGVIWLYNIIFYFPLDFIKFFIRYALS  864

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGL +PDTK+F+E T+F +LNQ+A
Sbjct  865  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLPLPDTKMFTERTHFTELNQMA  924

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  925  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  966



>ref|XP_011042618.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
 ref|XP_011042619.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
Length=956

 Score =   223 bits (568),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ YFPLD IKFF RYALS
Sbjct  795  LVVAFIIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYFPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGL +PDTK+F+E T+F +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLPLPDTKMFTERTHFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_012080196.1| PREDICTED: ATPase 11, plasma membrane-type [Jatropha curcas]
 gb|KDP31195.1| hypothetical protein JCGZ_11571 [Jatropha curcas]
Length=956

 Score =   223 bits (567),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD IKFF RYALS
Sbjct  795  LVVAFLIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_011071717.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 3 [Sesamum 
indicum]
Length=952

 Score =   222 bits (566),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD+IKF  RYALS
Sbjct  791  LVAAFFVAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIIKFLIRYALS  850

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFGKEQREL+WAHAQRTLHGLQVPDTKLF+E  NF++LNQLA
Sbjct  851  GRAWDLVLEQRIAFTRKKDFGKEQRELKWAHAQRTLHGLQVPDTKLFNETNNFSELNQLA  910

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  911  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  952



>gb|AAQ55291.1| plasma membrane H+-ATPase [Juglans regia]
Length=956

 Score =   222 bits (566),  Expect = 9e-63, Method: Composition-based stats.
 Identities = 137/162 (85%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQL+ATLIAVYA WSFAAIEGIGWGWAGVIWLYN++ YFPLD IKFF RYALS
Sbjct  795  LVVAFIIAQLIATLIAVYASWSFAAIEGIGWGWAGVIWLYNIIFYFPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PD+K+F+E T+F +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDSKMFTERTHFTELNQIA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL+TLKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELNTLKGHVESVVRLKGLDIDTIQQSYTV  956



>emb|CDY30730.1| BnaA02g33520D [Brassica napus]
Length=787

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  626  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  685

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  686  GRAWDLVIEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  745

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  746  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQSYTV  787



>ref|XP_010037634.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW49371.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=956

 Score =   221 bits (564),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQL+ATLIAVYA WSFAAIEGIGWGWAGVIWLYN++ Y PLDLIKFFTRYALS
Sbjct  795  LVVAFIIAQLIATLIAVYASWSFAAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFTRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E  +F +LN +A
Sbjct  855  GRAWDLVLEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERAHFTELNHIA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESV+++KGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVLRIKGLDIETIQQAYTV  956



>ref|XP_009343433.1| PREDICTED: ATPase 11, plasma membrane-type-like [Pyrus x bretschneideri]
Length=956

 Score =   221 bits (564),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 136/162 (84%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LMVAF+IAQL+ATLIAVYA+WSFAAI+GIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LMVAFIIAQLIATLIAVYANWSFAAIKGIGWGWAGVIWLYNIVTYIPLDIIKFMIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL++EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+A
Sbjct  855  GKAWDLLIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQIA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELTTLKGHVESVVRLKGLDIDTIQQSYTV  956



>gb|KHG12451.1| ATPase 4, plasma membrane-type -like protein [Gossypium arboreum]
Length=693

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  532  LLAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  591

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+A
Sbjct  592  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDTKMFTERTHFTELNQMA  651

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LK LDI+TIQQAYTV
Sbjct  652  EEAKRRAEIARLRELHTLKGHVESVVRLKNLDIDTIQQAYTV  693



>ref|XP_004299601.1| PREDICTED: ATPase 11, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=957

 Score =   221 bits (563),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 138/162 (85%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L VAF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  796  LFVAFLIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFMIRYALS  855

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL++EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +A
Sbjct  856  GKAWDLLIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMA  915

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  916  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  957



>gb|EAZ21357.1| hypothetical protein OsJ_37014 [Oryza sativa Japonica Group]
Length=931

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW+F +I+GIGWGWAG++WLYNL+ YFPLD+IKF  RYALS
Sbjct  770  LVFAFLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNLIFYFPLDIIKFLIRYALS  829

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+FSE   +N+LNQ+A
Sbjct  830  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKMFSEKAGYNELNQMA  889

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  890  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  931



>emb|CAB41144.1| H+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=960

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM+AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  799  LMIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  858

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F++ T+ ++LNQ+A
Sbjct  859  GRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDTKMFTDRTHVSELNQMA  918

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  919  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  960



>ref|NP_190378.2| H(+)-ATPase 4 [Arabidopsis thaliana]
 sp|Q9SU58.2|PMA4_ARATH RecName: Full=ATPase 4, plasma membrane-type; AltName: Full=Proton 
pump 4 [Arabidopsis thaliana]
 dbj|BAC42716.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE78350.1| H(+)-ATPase 4 [Arabidopsis thaliana]
Length=960

 Score =   221 bits (563),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM+AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  799  LMIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  858

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F++ T+ ++LNQ+A
Sbjct  859  GRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDTKMFTDRTHVSELNQMA  918

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  919  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  960



>gb|EEC69747.1| hypothetical protein OsI_39279 [Oryza sativa Indica Group]
Length=931

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW+F +I+GIGWGWAG++WLYNL+ YFPLD+IKF  RYALS
Sbjct  770  LVFAFLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNLIFYFPLDIIKFLIRYALS  829

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+FSE   +N+LNQ+A
Sbjct  830  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKMFSEKAGYNELNQMA  889

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  890  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  931



>ref|XP_011028703.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
 ref|XP_011028704.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
Length=956

 Score =   221 bits (563),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 139/162 (86%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLDLIKF  RYALS
Sbjct  795  LVVAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLIKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFT +KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +A
Sbjct  855  GRAWDLVIEQRIAFTTQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>dbj|BAC77533.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=386

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNL+ Y PLD IKF  RYALS
Sbjct  225  LVAAFIVAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLIFYIPLDFIKFIIRYALS  284

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  P+ ++FSE TN+ + NQ+A
Sbjct  285  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPEPRMFSERTNYTEFNQMA  344

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  345  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  386



>emb|CDY45757.1| BnaC02g42250D [Brassica napus]
Length=962

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  801  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  860

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  861  GRAWDLVIEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  920

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  921  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQSYTV  962



>ref|XP_006394361.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
 dbj|BAJ34039.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31647.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
Length=956

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF+IAQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LLIAFIIAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQSYTV  956



>ref|XP_009130229.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Brassica 
rapa]
Length=956

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  855  GRAWDLVIEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQSYTV  956



>ref|NP_001067382.1| Os12g0638700 [Oryza sativa Japonica Group]
 emb|CAD29296.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|ABA99607.1| Plasma membrane ATPase 1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30401.1| Os12g0638700 [Oryza sativa Japonica Group]
Length=956

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW+F +I+GIGWGWAG++WLYNL+ YFPLD+IKF  RYALS
Sbjct  795  LVFAFLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNLIFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+FSE   +N+LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKMFSEKAGYNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_009130228.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Brassica 
rapa]
Length=979

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  818  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  877

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  878  GRAWDLVIEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  937

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  938  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQSYTV  979



>ref|XP_009130230.1| PREDICTED: ATPase 11, plasma membrane-type isoform X3 [Brassica 
rapa]
Length=939

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  778  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  837

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  838  GRAWDLVIEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  897

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  898  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQSYTV  939



>ref|XP_011651238.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis sativus]
Length=956

 Score =   220 bits (561),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 138/162 (85%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALS
Sbjct  795  LVVAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFAIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL+LEQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +A
Sbjct  855  GKAWDLMLEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  956



>ref|NP_201073.1| H(+)-ATPase 11 [Arabidopsis thaliana]
 sp|Q9LV11.1|PMA11_ARATH RecName: Full=ATPase 11, plasma membrane-type; AltName: Full=Proton 
pump 11 [Arabidopsis thaliana]
 dbj|BAA97214.1| plasma membrane proton ATPase-like [Arabidopsis thaliana]
 gb|AAM78085.1| AT5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AAR23718.1| At5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AED97641.1| H(+)-ATPase 11 [Arabidopsis thaliana]
Length=956

 Score =   220 bits (560),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVVAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  855  GRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_006279959.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
 gb|EOA12857.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
Length=956

 Score =   220 bits (560),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  855  GRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_002864812.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41071.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
Length=956

 Score =   220 bits (560),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  855  GRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_012082827.1| PREDICTED: plasma membrane ATPase 1-like [Jatropha curcas]
 ref|XP_012082835.1| PREDICTED: plasma membrane ATPase 1-like [Jatropha curcas]
 gb|KDP45466.1| hypothetical protein JCGZ_09715 [Jatropha curcas]
Length=956

 Score =   219 bits (559),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA WSFAAIEGIGWGWAGV+WLYNL+ YFPLD IKFFTRYALS
Sbjct  795  LVAAFVIAQLIATLIAVYAKWSFAAIEGIGWGWAGVVWLYNLIFYFPLDFIKFFTRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  PDTK+F+E  +FN+LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPDTKMFNERGSFNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR REL TLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARFRELTTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_010459221.1| PREDICTED: ATPase 11, plasma membrane-type-like [Camelina sativa]
Length=956

 Score =   219 bits (559),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  855  GRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_010444121.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=956

 Score =   219 bits (559),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  855  GRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  956



>gb|KJB19302.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   219 bits (559),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  795  LLAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDTKMFTERTHFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LK LDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKNLDIDTIQQAYTV  956



>dbj|BAC77532.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=956

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF++AQL+ATLIAVYA WSFAAIEGIGWGWAGVIWLYNL+ Y PLD IKF  RYALS
Sbjct  795  LVVAFIVAQLIATLIAVYASWSFAAIEGIGWGWAGVIWLYNLIFYIPLDFIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+ N+LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHVNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>emb|CAC29435.1| P-type H+-ATPase [Vicia faba]
Length=958

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFFTRYALS
Sbjct  797  LVAAFIVAQLIATLIAVYASWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFTRYALS  856

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+  +LNQ+A
Sbjct  857  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHVTELNQMA  916

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  917  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  958



>gb|AFC88896.1| plasma membrane H+-ATPase [Melastoma malabathricum]
Length=956

 Score =   219 bits (558),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 138/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA W FAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  795  LIAAFVIAQLIATLIAVYASWGFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T F +LN +A
Sbjct  855  GKAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKIFTERTRFAELNHIA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL+TLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELNTLKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_006664787.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=956

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW+F +I+GIGWGWAG++WLYNL+ YFPLD+IKF  RYALS
Sbjct  795  LVFAFLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNLIFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+F E   +N+LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKMFPEKAGYNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_010256132.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Nelumbo 
nucifera]
Length=956

 Score =   219 bits (557),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 134/162 (83%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFV+AQL+ATLIAVYA+W FAAIEGIGWGWAG++WLYN++ Y PLD+IKF  RYALS
Sbjct  795  LVVAFVVAQLIATLIAVYANWGFAAIEGIGWGWAGIVWLYNIIVYIPLDVIKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGLQ PDTK+FSE T F +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLQPPDTKMFSERTTFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   219 bits (557),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYA+W+FAAIEGIGWGWAGVIWLYN++ YFPLD+IKF TRYALS
Sbjct  795  LVAAFAVAQLIATLIAVYANWNFAAIEGIGWGWAGVIWLYNIIFYFPLDIIKFLTRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLE+RIAFTR+KDFGKEQREL+WAHAQRTLHGL+VPDTK+F++ TNF +LNQ+A
Sbjct  855  GRAWDLVLERRIAFTRQKDFGKEQRELRWAHAQRTLHGLEVPDTKMFNDRTNFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_010256122.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Nelumbo 
nucifera]
Length=970

 Score =   219 bits (557),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 134/162 (83%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFV+AQL+ATLIAVYA+W FAAIEGIGWGWAG++WLYN++ Y PLD+IKF  RYALS
Sbjct  809  LVVAFVVAQLIATLIAVYANWGFAAIEGIGWGWAGIVWLYNIIVYIPLDVIKFIIRYALS  868

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGLQ PDTK+FSE T F +LNQ+A
Sbjct  869  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLQPPDTKMFSERTTFTELNQMA  928

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  929  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  970



>gb|KGN64262.1| hypothetical protein Csa_1G045600 [Cucumis sativus]
Length=762

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALS
Sbjct  601  LVVAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFAIRYALS  660

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL+LEQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +A
Sbjct  661  GKAWDLMLEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMA  720

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  721  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  762



>ref|XP_010933786.1| PREDICTED: plasma membrane ATPase 3 [Elaeis guineensis]
Length=956

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVATLIAVYADW FAAI+GIGWGWAGVIWLYN++ YFPLD+IKF  RYALS
Sbjct  795  LVTAFLVAQLVATLIAVYADWGFAAIKGIGWGWAGVIWLYNIIFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGL  PDTK+FSE T+F DLNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLHPPDTKMFSERTSFTDLNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>gb|KJB33641.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=956

 Score =   218 bits (555),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 136/162 (84%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AFV+AQL+ATLIAVYA+W FAAIEGIGWGWAGVIWLYNL+ Y PLD IKFF RYALS
Sbjct  795  LVLAFVVAQLIATLIAVYANWGFAAIEGIGWGWAGVIWLYNLIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PDTK+F + T++N+LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDTKMFGDRTSYNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELTTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_002322127.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF06254.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=967

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLDLIKF  RYALS
Sbjct  806  LVVAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLIKFIIRYALS  865

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFT +KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +A
Sbjct  866  GRAWDLVIEQRIAFTTQKDFGKEQRELQWAHAQRTLHGLQAPDTKMFTERTHFTELNHMA  925

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  926  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  967



>ref|XP_002442618.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
 gb|EES16456.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
Length=956

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW+F +I+GIGWGWAG++WLYN++ YFPLD+IKF  RYALS
Sbjct  795  LVFAFLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNIIFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFG+E+REL+WAHAQRTLHGLQ PD K+F E   +N+LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGREERELKWAHAQRTLHGLQAPDAKMFPEKAGYNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_008673350.1| PREDICTED: uncharacterized protein LOC100502231 isoform X1 [Zea 
mays]
 tpg|DAA54786.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=956

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW+F +I+GIGWGWAG++WLYN++ YFPLD+IKF  RYALS
Sbjct  795  LVFAFLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNIIFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFG+E+REL+WAHAQRTLHGLQ PD K+F E   +N+LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGREERELKWAHAQRTLHGLQAPDAKMFPEKAGYNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_008437674.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis melo]
Length=956

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFV+AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALS
Sbjct  795  LVVAFVLAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFAIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL+LEQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +A
Sbjct  855  GKAWDLMLEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_010923303.1| PREDICTED: plasma membrane ATPase 3-like [Elaeis guineensis]
Length=956

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW FAAI+GIGWGWAGVIWLYN++ YFPLD+IKF  RYALS
Sbjct  795  LVTAFLVAQLIATLIAVYADWGFAAIKGIGWGWAGVIWLYNIIFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGL  PDTK+FSE TNF +LNQLA
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLHPPDTKMFSERTNFTELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_008796652.1| PREDICTED: plasma membrane ATPase 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008796653.1| PREDICTED: plasma membrane ATPase 3 isoform X2 [Phoenix dactylifera]
Length=956

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW FAAI+GIGWGWAGVIWLYN++ YFPLD+IKF  RYALS
Sbjct  795  LVAAFLVAQLIATLIAVYADWGFAAIKGIGWGWAGVIWLYNIIFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGL  PDTK+FSE TNF +LNQLA
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLHPPDTKMFSERTNFTELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>gb|KHG14131.1| ATPase 4, plasma membrane-type -like protein [Gossypium arboreum]
Length=721

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AFV+AQL+ATLIAVYA+W FAAIEGIGWGWAGVIWLYNL+ Y PLD IKFF RYALS
Sbjct  560  LVLAFVVAQLIATLIAVYANWGFAAIEGIGWGWAGVIWLYNLIFYIPLDFIKFFIRYALS  619

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PDTK+F + T++N+LNQ+A
Sbjct  620  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDTKMFGDRTSYNELNQMA  679

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  680  EEAKRRAEIARLRELTTLKGHVESVVRLKGLDIDTIQQAYTV  721



>dbj|BAD16689.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   217 bits (553),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYA+W+FAAIEGIGWGWAGVIWLYN++ YFPLD+IKFF RYALS
Sbjct  795  LVAAFAVAQLIATLIAVYANWNFAAIEGIGWGWAGVIWLYNIIFYFPLDIIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLE+R+AFTR+KDFGKEQREL+WAHAQRTLHGL+VPDTK+F++ +NF +LNQ+A
Sbjct  855  GRAWDLVLERRVAFTRQKDFGKEQRELKWAHAQRTLHGLEVPDTKMFNDKSNFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_003523043.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN08862.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   217 bits (553),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALS
Sbjct  795  LVTAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+FN+LNQ+A
Sbjct  855  GRAWELVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESV+KLKG+D++TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVLKLKGIDVDTIQQAYTV  956



>ref|NP_001169535.1| uncharacterized protein LOC100383411 [Zea mays]
 gb|ACN34046.1| unknown [Zea mays]
Length=309

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%), Gaps = 2/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATL+AVYADW F +IEGIGWGWAGV+WLYNLV YFPLDL+KF  RYALS
Sbjct  150  LVFAFLVAQLIATLVAVYADWGFTSIEGIGWGWAGVVWLYNLVFYFPLDLLKFLIRYALS  209

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+R L+WAHAQRTLHGLQ PD KLF +    N+LNQ+A
Sbjct  210  GKAWDLVIEQRIAFTRKKDFGKEERALKWAHAQRTLHGLQPPDAKLFPD--RVNELNQMA  267

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  268  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQSYTV  309



>ref|XP_004963335.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   217 bits (553),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW+F +I+GIGWGWAG++WLYN++ YFPLD+IKF  RY LS
Sbjct  795  LVFAFLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNIIFYFPLDIIKFLIRYVLS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+F E   +N+LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQAPDAKMFPEKAGYNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_009369365.1| PREDICTED: ATPase 11, plasma membrane-type [Pyrus x bretschneideri]
Length=956

 Score =   217 bits (552),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVVAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDIIKFMIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL++EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+A
Sbjct  855  GKAWDLLIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQIA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELTTLKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_006838797.1| PREDICTED: plasma membrane ATPase 3 [Amborella trichopoda]
 gb|ERN01366.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
Length=956

 Score =   217 bits (552),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 133/162 (82%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLIAVYA+W FAAIEGIGWGWAGV+WLYN++ YFPLD+IKF TRYALS
Sbjct  795  LVTAFIIAQLIATLIAVYANWGFAAIEGIGWGWAGVVWLYNIITYFPLDIIKFITRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGL  P+TK+FSE T++ DLNQ+A
Sbjct  855  GKAWDLVMEQRIAFTRQKDFGKEARELKWAHAQRTLHGLHPPETKMFSERTSYTDLNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRE  TLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLREFTTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_004508789.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X3 [Cicer 
arietinum]
Length=958

 Score =   217 bits (552),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  797  LVAAFIVAQLIATLIAVYASWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  856

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+  +LNQ+A
Sbjct  857  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHVTELNQMA  916

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  917  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  958



>gb|KEH24965.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   217 bits (552),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 133/162 (82%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAG++WLYNL+ Y PLD IKF  RY LS
Sbjct  790  LVAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGIVWLYNLIFYIPLDFIKFIIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  P+TK+FSE TN+ +LNQ+A
Sbjct  850  GRAWDLVFEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPETKMFSERTNYTELNQMA  909

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR+RELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  910  EEAKRRAEIARIRELHTLKGHVESVVRLKGLDIDTIQQAYTV  951



>ref|XP_007032428.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY03354.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
Length=956

 Score =   216 bits (551),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFV AQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYNLV Y PLD IKFF RYALS
Sbjct  795  LVTAFVAAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNLVFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PDTK+FS+ T+F +LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQAPDTKMFSDRTSFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELTTLKGHVESVVRLKGLDIDTIQQAYTV  956



>gb|KEH24964.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=956

 Score =   216 bits (551),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 133/162 (82%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAG++WLYNL+ Y PLD IKF  RY LS
Sbjct  795  LVAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGIVWLYNLIFYIPLDFIKFIIRYILS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  P+TK+FSE TN+ +LNQ+A
Sbjct  855  GRAWDLVFEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPETKMFSERTNYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIAR+RELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARIRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_007138219.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
 gb|ESW10213.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
Length=956

 Score =   216 bits (551),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALS
Sbjct  795  LVTAFIIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+FN+LNQ+A
Sbjct  855  GRAWELVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESV+KLKG+D++TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVLKLKGIDVDTIQQAYTV  956



>ref|XP_008807875.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807876.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807878.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807879.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
Length=956

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVATLIAVYADW FAAI+GIGWGWAGVIWLYN++ YFPLD+IKF TRYALS
Sbjct  795  LVAAFLVAQLVATLIAVYADWGFAAIKGIGWGWAGVIWLYNIIFYFPLDIIKFLTRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGL  P+TK+F E T+F DLNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLHPPETKMFGERTSFADLNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_008374513.1| PREDICTED: ATPase 11, plasma membrane-type [Malus domestica]
Length=956

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVVAFIIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDIIKFMIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL++EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+A
Sbjct  855  GKAWDLLIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQIA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELTTLKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_006431062.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
 gb|ESR44302.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
Length=956

 Score =   216 bits (551),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 133/162 (82%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF +AQL+ATLIAVYA+WSFAAIEG+GWGWAGV+WLYNL+ Y PLD IKFF RYALS
Sbjct  795  LVLAFAVAQLIATLIAVYANWSFAAIEGVGWGWAGVVWLYNLIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  PDTK+FSE   F +LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHAPDTKMFSEHNKFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL+TLKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELNTLKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_007032427.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY03353.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
Length=994

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFV AQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYNLV Y PLD IKFF RYALS
Sbjct  833  LVTAFVAAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNLVFYIPLDFIKFFIRYALS  892

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PDTK+FS+ T+F +LNQ+A
Sbjct  893  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQAPDTKMFSDRTSFTELNQMA  952

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  953  EEAKRRAEIARLRELTTLKGHVESVVRLKGLDIDTIQQAYTV  994



>ref|XP_006290560.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
 gb|EOA23458.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
Length=956

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RY LS
Sbjct  795  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYTLS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F++ ++ ++LNQ+A
Sbjct  855  GRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDTKMFTDRSHVSELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIETIQQAYTV  956



>gb|KGN63646.1| hypothetical protein Csa_1G008520 [Cucumis sativus]
Length=801

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W FAAIEGIGWGWAGVIWLYN++ Y PLDLIKFF RYALS
Sbjct  640  LVAAFLVAQLIATLIAVYANWGFAAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFIRYALS  699

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F + T+F +LNQ+A
Sbjct  700  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFHDRTHFTELNQMA  759

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  760  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  801



>gb|KEH31901.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLIAVYA WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  797  LVAAFIIAQLIATLIAVYASWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  856

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+  T+  +LNQ+A
Sbjct  857  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTGGTHVTELNQMA  916

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  917  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  958



>gb|AEQ27823.1| PM H+-ATPase L [Eichhornia crassipes]
Length=956

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYADW FAAI+GIGWGWAGVIWLYN++ Y PLD+IKF  RYALS
Sbjct  795  LLTAFFVAQLIATLIAVYADWGFAAIKGIGWGWAGVIWLYNIIFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGLQ P+TK+F+E TNFN+LNQ+A
Sbjct  855  GGAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLQPPETKMFNERTNFNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_006439665.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
 gb|ESR52905.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
Length=954

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 2/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYN++ Y PLD IKFF RYALS
Sbjct  795  LLVAFLIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNIIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T  ++LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERT--HELNQMA  912

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  913  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  954



>ref|XP_006482527.1| PREDICTED: plasma membrane ATPase 1-like [Citrus sinensis]
Length=956

 Score =   216 bits (549),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 132/162 (81%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF +AQL+ATLIAVYA+WSFA IEG+GWGWAGV+WLYNL+ Y PLD IKFF RYALS
Sbjct  795  LVLAFAVAQLIATLIAVYANWSFAEIEGVGWGWAGVVWLYNLIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  PDTK+FSE   F +LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHAPDTKMFSEHNKFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELSTLKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_008453171.1| PREDICTED: plasma membrane ATPase 3 [Cucumis melo]
Length=959

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W FAAIEGIGWGWAGVIWLYN++ Y PLDLIKFF RYALS
Sbjct  798  LVAAFLVAQLIATLIAVYANWGFAAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFIRYALS  857

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F + T+F +LNQ+A
Sbjct  858  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFHDRTHFTELNQMA  917

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  918  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  959



>ref|XP_011659953.1| PREDICTED: plasma membrane ATPase 3 [Cucumis sativus]
Length=959

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W FAAIEGIGWGWAGVIWLYN++ Y PLDLIKFF RYALS
Sbjct  798  LVAAFLVAQLIATLIAVYANWGFAAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFIRYALS  857

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F + T+F +LNQ+A
Sbjct  858  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFHDRTHFTELNQMA  917

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  918  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  959



>gb|KHN19372.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALS
Sbjct  795  LVTAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E  +FN+LNQ+A
Sbjct  855  GRAWELVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERPHFNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESV+KLKG+D++TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVLKLKGIDVDTIQQAYTV  956



>ref|XP_003527056.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
Length=956

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALS
Sbjct  795  LVTAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E  +FN+LNQ+A
Sbjct  855  GRAWELVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERPHFNELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESV+KLKG+D++TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVLKLKGIDVDTIQQAYTV  956



>ref|XP_006476664.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=954

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 2/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYN++ Y PLD IKFF RYALS
Sbjct  795  LVVAFLIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNIIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T  ++LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERT--HELNQMA  912

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  913  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  954



>gb|ACN49187.1| plasma membrane ATPase 1-like protein [Triticum aestivum]
Length=620

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW F  I+GIGWGWAGV+WLYN++ Y PLD+IKF  RY LS
Sbjct  459  LVFAFLVAQLIATLIAVYADWRFTQIKGIGWGWAGVVWLYNIITYLPLDIIKFLIRYTLS  518

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+FSE   +N+LN +A
Sbjct  519  GKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKMFSEKGGYNELNHMA  578

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  579  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  620



>gb|EMT31912.1| Plasma membrane ATPase 1 [Aegilops tauschii]
Length=1004

 Score =   215 bits (548),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 128/162 (79%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW F  I+GIGWGWAGV+WLYN++ Y PLD+IKF  RY LS
Sbjct  827  LVFAFLVAQLIATLIAVYADWRFTQIKGIGWGWAGVVWLYNIITYLPLDIIKFLIRYTLS  886

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+FSE   +N+LN +A
Sbjct  887  GKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKMFSEKGGYNELNHMA  946

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YT+
Sbjct  947  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTI  988



>ref|XP_003578172.1| PREDICTED: plasma membrane ATPase 1 [Brachypodium distachyon]
Length=959

 Score =   215 bits (547),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYADW+F +I+GIGWGWAG++WLYN++ YFPLD+IKF  RY LS
Sbjct  798  LVFAFFVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNIITYFPLDIIKFLIRYTLS  857

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+FSE   +N+LN +A
Sbjct  858  GKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKMFSEKAGYNELNHMA  917

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  918  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  959



>ref|XP_002517457.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF44999.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=762

 Score =   213 bits (543),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNL+ YFPLD IKF  RYALS
Sbjct  601  LVAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLIFYFPLDFIKFIIRYALS  660

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  PD K+F++ +++ +LNQ+A
Sbjct  661  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPDIKMFNDRSSYTELNQMA  720

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  721  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  762



>ref|XP_010548837.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 11, plasma membrane-type 
[Tarenaya hassleriana]
Length=222

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATL  VYA+WSF AIEGIGWGWAGVIWLYN++ Y PLDLIKFF   ALS
Sbjct  61   LVMAFIVAQLVATLTVVYANWSFTAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFICXALS  120

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRK+DFGKEQRELQWA AQRTLHGLQ  DTK+F+E T+FN+LNQ+A
Sbjct  121  GRAWDLVIEQRIAFTRKRDFGKEQRELQWAQAQRTLHGLQPXDTKMFTERTHFNELNQMA  180

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARL+ELHT KGHVE VV+LKGLD ETIQQAYTV
Sbjct  181  EEAKRRAEIARLQELHTPKGHVELVVRLKGLDTETIQQAYTV  222



>ref|XP_006651704.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=997

 Score =   215 bits (547),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+F +I+GIGWGWAG++WLYNLV YFPLD+IKF  RYALS
Sbjct  836  LVFAFLVAQLIATLIAVYANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFLIRYALS  895

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD KLF E T +++LNQ+A
Sbjct  896  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDVKLFPEKTGYSELNQMA  955

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TI Q+YTV
Sbjct  956  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIHQSYTV  997



>ref|XP_010444120.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=959

 Score =   214 bits (546),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 153/165 (93%), Gaps = 3/165 (2%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+A
Sbjct  855  GRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMA  914

Query  437  eeakrraeiar---lreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIA    LRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  915  EEAKRRAEIASFDRLRELHTLKGHVESVVRLKGLDIETIQQAYTV  959



>ref|XP_008459294.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis melo]
Length=956

 Score =   214 bits (546),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L  AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNLV YFPLD+IKF  RYA+S
Sbjct  795  LFAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLVFYFPLDIIKFAIRYAIS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ P+ K+FSE T + +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPEAKMFSERTTYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDINTIQQSYTV  956



>ref|XP_007155353.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27347.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=955

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 154/162 (95%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF++AQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD+IKF  RYALS
Sbjct  795  LVVAFIVAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PD+K F+E T+ N+LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDSK-FNERTHVNELNQMA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  914  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  955



>ref|XP_002875872.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52131.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=154

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -2

Query  767  VATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQ  588
            VATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF  Y LSG+AWDLV+EQ
Sbjct  3    VATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYVPLDFIKFFICYTLSGRAWDLVIEQ  62

Query  587  RIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeia  408
            R+AFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F++ T+  +LNQ+AEEAKRRAEIA
Sbjct  63   RVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDTKMFTDRTHVCELNQMAEEAKRRAEIA  122

Query  407  rlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            RLRELHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  123  RLRELHTLKGHVESVVRLKGLDIETIQQAYTV  154



>ref|XP_009398401.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=961

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADWSF+AI+GIGWGWAGVIWLYN++ YFPLD+IKF  RYALS
Sbjct  800  LVTAFLVAQLIATLIAVYADWSFSAIKGIGWGWAGVIWLYNIIFYFPLDIIKFLIRYALS  859

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGLQ PDTK+F + ++  +LNQ+A
Sbjct  860  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLQPPDTKMFGDRSSVTELNQMA  919

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  920  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  961



>gb|KGN52442.1| hypothetical protein Csa_5G635370 [Cucumis sativus]
Length=802

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNL+ YFPLD+IKF  RYA+S
Sbjct  641  LVAAFIIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLIFYFPLDIIKFAIRYAIS  700

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ P+ K+FS+ T + +LNQ+A
Sbjct  701  GRAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPEAKMFSDRTTYTELNQMA  760

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI TIQQ+YTV
Sbjct  761  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDINTIQQSYTV  802



>ref|XP_002270344.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Vitis vinifera]
 ref|XP_010663416.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Vitis vinifera]
 emb|CBI15286.3| unnamed protein product [Vitis vinifera]
Length=956

 Score =   213 bits (542),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 134/162 (83%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALS
Sbjct  795  LVGAFLVAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGLQ PDTK+F++ TNF +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLQPPDTKMFTDRTNFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI TI QAYTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDINTIPQAYTV  956



>ref|XP_009398400.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=989

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADWSF+AI+GIGWGWAGVIWLYN++ YFPLD+IKF  RYALS
Sbjct  828  LVTAFLVAQLIATLIAVYADWSFSAIKGIGWGWAGVIWLYNIIFYFPLDIIKFLIRYALS  887

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGLQ PDTK+F + ++  +LNQ+A
Sbjct  888  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLQPPDTKMFGDRSSVTELNQMA  947

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  948  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  989



>dbj|BAK04567.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   213 bits (541),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYADW FAAI+GIGWGWAGV+WLYN++ YFPLD+IKF  RY LS
Sbjct  797  LVFAFFVAQLIATLIAVYADWKFAAIKGIGWGWAGVVWLYNIITYFPLDIIKFLIRYTLS  856

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+FS+   +N+LN +A
Sbjct  857  GKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKMFSDKGGYNELNHMA  916

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  917  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  958



>ref|XP_004148685.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   213 bits (541),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNL+ YFPLD+IKF  RYA+S
Sbjct  795  LVAAFIIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLIFYFPLDIIKFAIRYAIS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ P+ K+FS+ T + +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPEAKMFSDRTTYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDINTIQQSYTV  956



>dbj|BAJ92653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   213 bits (541),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYADW FAAI+GIGWGWAGV+WLYN++ YFPLD+IKF  RY LS
Sbjct  797  LVFAFFVAQLIATLIAVYADWKFAAIKGIGWGWAGVVWLYNIITYFPLDIIKFLIRYTLS  856

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PD K+FS+   +N+LN +A
Sbjct  857  GKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKMFSDKGGYNELNHMA  916

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  917  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV  958



>ref|XP_009398402.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=961

 Score =   212 bits (540),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 129/162 (80%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW F AI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALS
Sbjct  800  LVTAFLVAQLIATLIAVYADWGFTAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALS  859

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHGLQ PDTK+F + ++F +LNQ+A
Sbjct  860  GRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHGLQPPDTKMFGDRSSFTELNQIA  919

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAEIARLREL+TLKGH+ESVV+LKGLDI+TIQQAYTV
Sbjct  920  EEARRRAEIARLRELNTLKGHMESVVRLKGLDIDTIQQAYTV  961



>ref|XP_002282263.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 ref|XP_010661009.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 emb|CBI35033.3| unnamed protein product [Vitis vinifera]
Length=955

 Score =   211 bits (537),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 137/162 (85%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYNLVCY PLD IKF  RYALS
Sbjct  795  LVVAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNLVCYIPLDFIKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE REL+WA AQRTLHGL  P+TK+F++  N  +LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEARELKWALAQRTLHGLHPPETKMFTDH-NITELNQMA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI TIQQAYTV
Sbjct  914  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDINTIQQAYTV  955



>ref|XP_006595243.1| PREDICTED: plasma membrane ATPase 1-like [Glycine max]
Length=918

 Score =   211 bits (536),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 131/162 (81%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNL+ Y PLD IKF  RYALS
Sbjct  757  LVAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLIFYIPLDFIKFIIRYALS  816

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  P+TK+F+E T++ +LNQ+A
Sbjct  817  GRAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPETKMFNERTSYTELNQMA  876

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAEIARLRELHTLKG VESVV+LKGL+I+TIQQAYTV
Sbjct  877  EEARRRAEIARLRELHTLKGRVESVVRLKGLNIDTIQQAYTV  918



>gb|KHN13245.1| Plasma membrane ATPase 1 [Glycine soja]
Length=956

 Score =   211 bits (536),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 131/162 (81%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNL+ Y PLD IKF  RYALS
Sbjct  795  LVAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLIFYIPLDFIKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  P+TK+F+E T++ +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPETKMFNERTSYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAEIARLRELHTLKG VESVV+LKGL+I+TIQQAYTV
Sbjct  915  EEARRRAEIARLRELHTLKGRVESVVRLKGLNIDTIQQAYTV  956



>ref|XP_010272214.1| PREDICTED: ATPase 11, plasma membrane-type-like [Nelumbo nucifera]
Length=955

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 151/162 (93%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFV+AQL+ATLIAVYA+W FAAIEGIGWGWAGV+W+YN++ Y PLD IKF  RYALS
Sbjct  795  LIVAFVVAQLIATLIAVYANWGFAAIEGIGWGWAGVVWIYNVIFYIPLDFIKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE REL+WAHAQRTLHGLQ PDT +F+E T+F DLNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRKKDFGKEARELKWAHAQRTLHGLQPPDT-MFNERTSFTDLNQMA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  914  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  955



>tpg|DAA50741.1| TPA: hypothetical protein ZEAMMB73_722190 [Zea mays]
Length=1149

 Score =   212 bits (539),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 132/162 (81%), Positives = 148/162 (91%), Gaps = 2/162 (1%)
 Frame = -2

Query  797   LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
             L+ AF++AQL+ATL+AVYADW F +IEGIGWGWAGV+WLYNLV YFPLDL+KF  RYALS
Sbjct  990   LVFAFLVAQLIATLVAVYADWGFTSIEGIGWGWAGVVWLYNLVFYFPLDLLKFLIRYALS  1049

Query  617   GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
             GKAWDLV+EQRIAFTRKKDFGKE+R L+WAHAQRTLHGLQ PD KLF +    N+LNQ+A
Sbjct  1050  GKAWDLVIEQRIAFTRKKDFGKEERALKWAHAQRTLHGLQPPDAKLFPD--RVNELNQMA  1107

Query  437   eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
             EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  1108  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQSYTV  1149



>ref|XP_003561110.1| PREDICTED: plasma membrane ATPase 1-like [Brachypodium distachyon]
Length=956

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYADW F +I+GIGWGWAG +WLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVFAFFVAQLIATLIAVYADWGFTSIKGIGWGWAGTVWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV++QR+AFTRKK FGKE+REL+WAHAQRTLHGLQ PD KLF E   ++++NQ+A
Sbjct  855  GKAWDLVIDQRVAFTRKKHFGKEERELKWAHAQRTLHGLQPPDAKLFPEKAGYSEMNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQSYTV  956



>dbj|BAA01058.1| H-ATPase [Oryza sativa Japonica Group]
 prf||1906387A H ATPase
Length=956

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYA+W+F +I+GIGWGWAG++WLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVFAFFVAQLIATLIAVYANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHA RTLHGLQ PD K F E T +++LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAHRTLHGLQPPDAKPFPEKTGYSELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TI Q+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIHQSYTV  956



>gb|EMT26085.1| Plasma membrane ATPase 1 [Aegilops tauschii]
Length=969

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW F +I+GIGWGWAG++WLYN+V YFPLD+IKFF RYALS
Sbjct  808  LVFAFLVAQLIATLIAVYADWGFTSIKGIGWGWAGIVWLYNIVFYFPLDIIKFFIRYALS  867

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV++QRIAFTRKK FGKE+REL+WAHAQRTLHGLQ P+ KLF E   +N+L Q+A
Sbjct  868  GKAWDLVIDQRIAFTRKKHFGKEERELKWAHAQRTLHGLQPPNAKLFPEKAGYNELCQMA  927

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            +EAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  928  DEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQSYTV  969



>gb|KCW49372.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=920

 Score =   209 bits (533),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  791  VAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGK  612
            +A  I   +ATLIAVYA WSFAAIEGIGWGWAGVIWLYN++ Y PLDLIKFFTRYALSG+
Sbjct  761  LASAIYLQIATLIAVYASWSFAAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFTRYALSGR  820

Query  611  AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaee  432
            AWDLVLEQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E  +F +LN +AEE
Sbjct  821  AWDLVLEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERAHFTELNHIAEE  880

Query  431  akrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AKRRAEIARLRELHTLKGHVESV+++KGLDIETIQQAYTV
Sbjct  881  AKRRAEIARLRELHTLKGHVESVLRIKGLDIETIQQAYTV  920



>ref|NP_001050947.1| Os03g0689300 [Oryza sativa Japonica Group]
 emb|CAD29294.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|AAT81733.1| H-ATPase [Oryza sativa Japonica Group]
 gb|ABF98274.1| Plasma membrane ATPase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12861.1| Os03g0689300 [Oryza sativa Japonica Group]
Length=956

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYA+W+F +I+GIGWGWAG++WLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVFAFFVAQLIATLIAVYANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHA RTLHGLQ PD K F E T +++LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAHRTLHGLQPPDAKPFPEKTGYSELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TI Q+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIHQSYTV  956



>gb|EEC75974.1| hypothetical protein OsI_13084 [Oryza sativa Indica Group]
 gb|EEE59727.1| hypothetical protein OsJ_12166 [Oryza sativa Japonica Group]
Length=966

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYA+W+F +I+GIGWGWAG++WLYNLV YFPLD+IKF  RYALS
Sbjct  805  LVFAFFVAQLIATLIAVYANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFLIRYALS  864

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHA RTLHGLQ PD K F E T +++LNQ+A
Sbjct  865  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAHRTLHGLQPPDAKPFPEKTGYSELNQMA  924

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TI Q+YTV
Sbjct  925  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIHQSYTV  966



>ref|XP_009417143.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=955

 Score =   209 bits (531),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 133/162 (82%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+ AQL+ATLIAVYADW FAAI+GIGW WAGVIWLYNL+ YFPLD+IKFF RYALS
Sbjct  795  LVTAFLAAQLIATLIAVYADWGFAAIKGIGWRWAGVIWLYNLIFYFPLDIIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAW+LV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ PDTK FSE +   +LNQ+A
Sbjct  855  GKAWELVIEQRIAFTRKKDFGKEERELRWAHAQRTLHGLQPPDTK-FSERSTVTELNQIA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL+TLKGHVESVV+LKGLDI TIQQ+YTV
Sbjct  914  EEAKRRAEIARLRELNTLKGHVESVVRLKGLDIGTIQQSYTV  955



>gb|EMS45119.1| Plasma membrane ATPase 1 [Triticum urartu]
Length=973

 Score =   209 bits (531),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYADW F +I+GIGWGWAG++WLYN+V YFPLD+IKFF RYALS
Sbjct  812  LVFAFFVAQLIATLIAVYADWGFTSIKGIGWGWAGIVWLYNIVFYFPLDIIKFFIRYALS  871

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAW LV++QRIAFTRKK FGKE+REL+WAHAQRTLHGLQ PD KLF E   +N+L+Q+A
Sbjct  872  GKAWGLVIDQRIAFTRKKHFGKEERELKWAHAQRTLHGLQPPDAKLFPEKAAYNELSQMA  931

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  932  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQSYTV  973



>ref|XP_010087815.1| hypothetical protein L484_001526 [Morus notabilis]
 gb|EXB30122.1| hypothetical protein L484_001526 [Morus notabilis]
Length=297

 Score =   197 bits (502),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -2

Query  794  MVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSG  615
            ++   + + +ATLIAVYA+WSFAAI GIGWGWAGV+WLYN + YFPLD IKFF RYALSG
Sbjct  137  LLKLFVGEQIATLIAVYANWSFAAIAGIGWGWAGVVWLYNFIFYFPLDFIKFFIRYALSG  196

Query  614  KAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlae  435
            +AWDLV+EQRIAFTRKKDFG+E+REL+WAHAQRTLHGL  P+TK+F+E T + +LNQ+AE
Sbjct  197  RAWDLVIEQRIAFTRKKDFGREERELKWAHAQRTLHGLHPPETKMFTERTTYPELNQMAE  256

Query  434  eakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EAKRRAEIARLREL TLKGH+ESVV+LKGLDI+TIQQAYTV
Sbjct  257  EAKRRAEIARLRELTTLKGHMESVVRLKGLDIDTIQQAYTV  297



>ref|XP_008644894.1| PREDICTED: uncharacterized protein LOC100383411 isoform X1 [Zea 
mays]
Length=954

 Score =   208 bits (529),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%), Gaps = 2/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATL+AVYADW F +IEGIGWGWAGV+WLYNLV YFPLDL+KF  RYALS
Sbjct  795  LVFAFLVAQLIATLVAVYADWGFTSIEGIGWGWAGVVWLYNLVFYFPLDLLKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+R L+WAHAQRTLHGLQ PD KLF +    N+LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERALKWAHAQRTLHGLQPPDAKLFPD--RVNELNQMA  912

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  913  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQSYTV  954



>gb|KCW56159.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=963

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 152/162 (94%), Gaps = 2/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATL+AVYA+WSFAAIEGIGWGWAG++WLYNL+ Y PLD IKFFTRYALS
Sbjct  804  LVAAFVIAQLIATLMAVYANWSFAAIEGIGWGWAGIVWLYNLIFYIPLDFIKFFTRYALS  863

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  P+TK+F   +++ +LNQ+A
Sbjct  864  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPETKMF--GSSYTELNQMA  921

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL+TLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  922  EEAKRRAEIARLRELNTLKGHVESVVRLKGLDIDTIQQAYTV  963



>ref|XP_010029279.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 ref|XP_010029280.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW56160.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=954

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 152/162 (94%), Gaps = 2/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATL+AVYA+WSFAAIEGIGWGWAG++WLYNL+ Y PLD IKFFTRYALS
Sbjct  795  LVAAFVIAQLIATLMAVYANWSFAAIEGIGWGWAGIVWLYNLIFYIPLDFIKFFTRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGL  P+TK+F   +++ +LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPETKMF--GSSYTELNQMA  912

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL+TLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  913  EEAKRRAEIARLRELNTLKGHVESVVRLKGLDIDTIQQAYTV  954



>ref|XP_003549657.1| PREDICTED: ATPase 11, plasma membrane-type-like [Glycine max]
 gb|KHN18516.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   207 bits (526),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVY +WSF +IEGIGWGWAGVIWLYN++ Y PLD+IKF  RYALS
Sbjct  795  LVFAFIVAQLIATLIAVYGNWSFCSIEGIGWGWAGVIWLYNIIFYIPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ  DTK F+E T+ N+LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPADTK-FNERTHVNELNQMA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  914  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTV  955



>gb|KHN34200.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   207 bits (526),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNLV Y PLD IKF  RYALS
Sbjct  795  LVAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLVFYIPLDFIKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE+REL+WAHA RTLHGL  P+TK+F+E T++ +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRKKDFGKEERELKWAHAHRTLHGLHPPETKMFNERTSYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRA IARLRELHTL GHVESV +LKGLDI+TIQQAYT+
Sbjct  915  EEARRRANIARLRELHTLTGHVESVFRLKGLDIDTIQQAYTI  956



>ref|XP_003554288.1| PREDICTED: plasma membrane ATPase 1-like [Glycine max]
Length=956

 Score =   207 bits (526),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNLV Y PLD IKF  RYALS
Sbjct  795  LVAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLVFYIPLDFIKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE+REL+WAHA RTLHGL  P+TK+F+E T++ +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRKKDFGKEERELKWAHAHRTLHGLHPPETKMFNERTSYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRA IARLRELHTL GHVESV +LKGLDI+TIQQAYT+
Sbjct  915  EEARRRANIARLRELHTLTGHVESVFRLKGLDIDTIQQAYTI  956



>ref|XP_010678593.1| PREDICTED: plasma membrane ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=963

 Score =   206 bits (525),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 129/162 (80%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVATLIAVYA+W+FAAIEGIGWGWAGVIWLYN++ Y PLD +KFFT Y LS
Sbjct  802  LVGAFMIAQLVATLIAVYANWAFAAIEGIGWGWAGVIWLYNVIFYIPLDFVKFFTSYVLS  861

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFT+KKDFGKE+REL+WAHAQRTLHGLQ P+ K+F+E TN+++LNQ+A
Sbjct  862  GRAWDLVIEQRIAFTKKKDFGKEERELKWAHAQRTLHGLQAPEAKMFTERTNYHELNQMA  921

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAE+ARLREL TLKGHV+SVVKLKGLDIETIQ +YTV
Sbjct  922  EEAKRRAEMARLRELLTLKGHVDSVVKLKGLDIETIQGSYTV  963



>ref|XP_011466246.1| PREDICTED: plasma membrane ATPase 1-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=966

 Score =   206 bits (525),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYADWSFAAIEGIGWGWAGV+WLYNLV Y PLD++KF  RYALS
Sbjct  795  LVAAFVIAQLIATLIAVYADWSFAAIEGIGWGWAGVVWLYNLVFYLPLDILKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV EQRIAFTRKK FGKE+REL+WAHAQRTLHGLQ PD+K F E +++ +LNQ+A
Sbjct  855  GRAWDLVFEQRIAFTRKKHFGKEERELRWAHAQRTLHGLQPPDSKKFGERSSYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL+TLKGHVESVV++KGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELNTLKGHVESVVRMKGLDIDTIQQSYTV  956



>ref|XP_011098566.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
 ref|XP_011098567.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
Length=955

 Score =   206 bits (523),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 130/162 (80%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLI+VYA+WSFAAIEGIGWGWAGVIWLYN++ YFPLDLIKFF RYALS
Sbjct  795  LVGAFLIAQLIATLISVYANWSFAAIEGIGWGWAGVIWLYNIIFYFPLDLIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE REL+WA AQRTLHGL  P T+ F E  N+N+LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRKKDFGKEDRELKWAQAQRTLHGLHPPQTQ-FGERNNYNELNQIA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAE+ARLRELHTLKGHVESV+K+K LDI+TIQQ+YTV
Sbjct  914  EEAKRRAEMARLRELHTLKGHVESVIKMKNLDIDTIQQSYTV  955



>ref|XP_004302360.1| PREDICTED: plasma membrane ATPase 1-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=956

 Score =   206 bits (523),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYADWSFAAIEGIGWGWAGV+WLYNLV Y PLD++KF  RYALS
Sbjct  795  LVAAFVIAQLIATLIAVYADWSFAAIEGIGWGWAGVVWLYNLVFYLPLDILKFIIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV EQRIAFTRKK FGKE+REL+WAHAQRTLHGLQ PD+K F E +++ +LNQ+A
Sbjct  855  GRAWDLVFEQRIAFTRKKHFGKEERELRWAHAQRTLHGLQPPDSKKFGERSSYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRE  TLKGHVESVV++KGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLREFGTLKGHVESVVRMKGLDIDTIQQSYTV  956



>ref|XP_011082991.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 1-like 
[Sesamum indicum]
Length=951

 Score =   205 bits (522),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 130/162 (80%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLI+VYA+WSFAAIEGIGWGWAGVIWLYN++ YFPLDLIKFF RYALS
Sbjct  791  LVGAFLIAQLIATLISVYANWSFAAIEGIGWGWAGVIWLYNIIFYFPLDLIKFFIRYALS  850

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE REL+WA AQRTLHGL  P T+ F E  N+N+LNQ+A
Sbjct  851  GRAWDLVIEQRIAFTRKKDFGKEDRELKWAQAQRTLHGLHPPQTQ-FGERNNYNELNQIA  909

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAE+ARLRELHTLKGHVESV+K+K LDI+TIQQ+YTV
Sbjct  910  EEAKRRAEMARLRELHTLKGHVESVIKMKNLDIDTIQQSYTV  951



>ref|XP_004982139.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=954

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 2/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W F +I+GIGWGWAGV+WLYNL+ YFPLD++KF  RYALS
Sbjct  795  LVFAFLVAQLIATLIAVYANWGFTSIKGIGWGWAGVVWLYNLIFYFPLDILKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFT KKDFGKE+REL+WAHAQRTLHGLQ PD KLF E    N+LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTMKKDFGKEERELKWAHAQRTLHGLQPPDAKLFPE--RVNELNQMA  912

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  913  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQSYTV  954



>ref|XP_003525017.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN48653.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 152/162 (94%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFV+AQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD++KF  RYALS
Sbjct  795  LVFAFVVAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIVKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ  DTK F+E T+ ++LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPADTK-FNERTHVSELNQMA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQAYT+
Sbjct  914  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQAYTL  955



>ref|XP_007151191.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
 gb|ESW23185.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
Length=956

 Score =   204 bits (519),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFV+AQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNL+ Y PLD IKF  RYALS
Sbjct  795  LVAAFVVAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLIFYMPLDFIKFVIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKK+FG+E+REL+WAHAQRTLHGL  P+TK+F E T   +LN +A
Sbjct  855  GRAWDLVIEQRIAFTRKKNFGREERELKWAHAQRTLHGLHPPETKMFGERTPHTELNHMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_007214948.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
 gb|EMJ16147.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
Length=956

 Score =   203 bits (517),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAI+GIGWGWAGV+WLYNLV YFPLD IKF  RYALS
Sbjct  795  LVAAFVIAQLIATLIAVYANWSFAAIKGIGWGWAGVVWLYNLVFYFPLDFIKFVVRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDL+++QRIAFTRKKDFGKE+REL+WAHAQRTLHGL  P+  +F + +N+++LNQ+A
Sbjct  855  GRAWDLIIDQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPEANIFGDRSNYSELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+ KGLDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELSTLKGHVESVVRNKGLDIDTIQQSYTV  956



>ref|XP_004955721.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   203 bits (517),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF TRYALS
Sbjct  795  LVFAFLVAQLIATLIAVYANWAFAAIKGIGWGWAGVIWLYNVVFYFPLDVIKFLTRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVLEQRIAFTRKKDFG+E+REL+WAHAQRTLHGLQ P+  +F   T FN+LNQLA
Sbjct  855  GRAWDLVLEQRIAFTRKKDFGREERELKWAHAQRTLHGLQAPEASIFENKTTFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAE+ARLRE++TLKG +ESVV+ KGLD+ETIQQ+YTV
Sbjct  915  EEARRRAEMARLREVNTLKGKMESVVRQKGLDMETIQQSYTV  956



>ref|XP_010531800.1| PREDICTED: ATPase 4, plasma membrane-type-like [Tarenaya hassleriana]
Length=954

 Score =   202 bits (515),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM AF++AQLVATLIAVYA+W FA IEGIGW WAGV+WLYNL+ YFPLD +KFF RYALS
Sbjct  794  LMAAFIVAQLVATLIAVYANWGFAFIEGIGWRWAGVVWLYNLIFYFPLDPLKFFIRYALS  853

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHGLQ P+T  F+E +++ +LN+LA
Sbjct  854  GRAWDLVIEQRIAFTRKKDFGKEERELRWAHAQRTLHGLQPPETG-FTERSSYVELNRLA  912

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEI RLREL TLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  913  EEAKRRAEITRLRELRTLKGHVESVVKLKGLDIDTIQQSYTV  954



>gb|KJB19306.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=987

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 153/193 (79%), Gaps = 31/193 (16%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  795  LLAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQR-------------------------------IAFTRKKDFGKEQRELQW  531
            G+AWDLV+EQR                               IAFTR+KDFGKEQRELQW
Sbjct  855  GRAWDLVIEQRVCIPLSYRVHCYCCCLIRHIGLSDEFLFDAQIAFTRQKDFGKEQRELQW  914

Query  530  AHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLK  351
            AHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LK
Sbjct  915  AHAQRTLHGLQAPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLK  974

Query  350  GLDIETIQQAYTV  312
             LDI+TIQQAYTV
Sbjct  975  NLDIDTIQQAYTV  987



>ref|XP_008230721.1| PREDICTED: plasma membrane ATPase 1-like [Prunus mume]
Length=959

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAA++GIGWGWAGV+WLYNLV YFPLD IKF  RYALS
Sbjct  798  LVAAFVIAQLIATLIAVYANWSFAAVKGIGWGWAGVVWLYNLVFYFPLDFIKFVIRYALS  857

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDL+++QRIAFTRKKDFGKE+REL+WAHAQRTLHGL  P+  +F + +N+ +LNQ+A
Sbjct  858  GRAWDLIIDQRIAFTRKKDFGKEERELKWAHAQRTLHGLHPPEANIFGDRSNYTELNQMA  917

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKGHVESVV+ KGLDI+TIQQ+YTV
Sbjct  918  EEAKRRAEIARLRELSTLKGHVESVVRNKGLDIDTIQQSYTV  959



>gb|EYU34115.1| hypothetical protein MIMGU_mgv1a000867mg [Erythranthe guttata]
Length=955

 Score =   202 bits (513),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 129/162 (80%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+FAAIEGIGWGWAGVIWLYN+V YFPLD+IKFF RYALS
Sbjct  795  LVGAFLVAQLIATLIAVYANWNFAAIEGIGWGWAGVIWLYNIVFYFPLDMIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKKDFGKE REL+WA AQRTLHGL  P+ K   + TN+N+LNQ+A
Sbjct  855  GKAWDLVIEQRIAFTRKKDFGKEDRELKWAQAQRTLHGLHPPE-KQSGDRTNYNELNQIA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAE+ARLRELHTLKGHVESV+K+K LDI+TIQQ+YTV
Sbjct  914  EEAKRRAEMARLRELHTLKGHVESVIKMKNLDIDTIQQSYTV  955



>ref|XP_009335819.1| PREDICTED: plasma membrane ATPase 1-like [Pyrus x bretschneideri]
Length=956

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGV+WLYNL+ YFPLD IKFF RYALS
Sbjct  795  LVAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVVWLYNLIFYFPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR AFTRKKDFGKE+REL+WAHAQRTLHGL  P+  +FS+ T + +LNQ+A
Sbjct  855  GRAWDLVIEQRTAFTRKKDFGKEERELKWAHAQRTLHGLHPPEATMFSDRTTYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKG VESVV+LK LDI+TIQQ+YTV
Sbjct  915  EEAKRRAEIARLRELQTLKGRVESVVRLKNLDIDTIQQSYTV  956



>gb|ACR38028.1| unknown [Zea mays]
Length=368

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALS
Sbjct  207  LVFAFLVAQLIATLIAVYANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALS  266

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LVLEQRIAFT KK+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLA
Sbjct  267  GRAWNLVLEQRIAFTSKKNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLA  326

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAE+ARLRE+ TLKG +ESVVK KGLDIETIQQ+YTV
Sbjct  327  EEARRRAEMARLREVSTLKGRMESVVKQKGLDIETIQQSYTV  368



>ref|XP_002466646.1| hypothetical protein SORBIDRAFT_01g011610 [Sorghum bicolor]
 gb|EER93644.1| hypothetical protein SORBIDRAFT_01g011610 [Sorghum bicolor]
Length=749

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 147/162 (91%), Gaps = 2/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLI VYA+W F +I+GIGWGWAGV+WLYNLV YFPLD++KF  RYA+S
Sbjct  590  LVFAFLVAQLIATLIVVYANWGFTSIKGIGWGWAGVVWLYNLVFYFPLDILKFLIRYAMS  649

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV+EQRIAFTRKK+FGKE+R L+WAHAQRTLHGLQ PD KLF E    ++LNQ+A
Sbjct  650  GKAWDLVVEQRIAFTRKKNFGKEERALKWAHAQRTLHGLQPPDAKLFPE--RVHELNQMA  707

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  708  EEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQSYTV  749



>ref|XP_008341531.1| PREDICTED: plasma membrane ATPase 1-like [Malus domestica]
Length=956

 Score =   200 bits (509),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA WSFAAIEGIGWGWAG +WLYNL+ YFPLDLIKFF RYALS
Sbjct  795  LVAAFVIAQLIATLIAVYASWSFAAIEGIGWGWAGXVWLYNLIFYFPLDLIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQR AFTRKKDFGKE+R L+WAHAQRTLHGL  P+   FS+ T + +LNQ+A
Sbjct  855  GRAWDLVIEQRTAFTRKKDFGKEERALKWAHAQRTLHGLHPPEATXFSDRTTYTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAEIARLREL TLKG VESVV+LK LDI+TIQQAYTV
Sbjct  915  EEAKRRAEIARLRELQTLKGRVESVVRLKNLDIDTIQQAYTV  956



>ref|NP_001136587.1| uncharacterized protein LOC100216710 [Zea mays]
 gb|ACF82226.1| unknown [Zea mays]
Length=422

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALS
Sbjct  261  LVFAFLVAQLIATLIAVYANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALS  320

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LVLEQRIAFT KK+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLA
Sbjct  321  GRAWNLVLEQRIAFTSKKNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLA  380

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAE+ARLRE+ TLKG +ESVVK KGLDIETIQQ+YTV
Sbjct  381  EEARRRAEMARLREVSTLKGRMESVVKQKGLDIETIQQSYTV  422



>tpg|DAA59899.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=426

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALS
Sbjct  265  LVFAFLVAQLIATLIAVYANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALS  324

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LVLEQRIAFT KK+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLA
Sbjct  325  GRAWNLVLEQRIAFTSKKNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLA  384

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAE+ARLRE+ TLKG +ESVVK KGLDIETIQQ+YTV
Sbjct  385  EEARRRAEMARLREVSTLKGRMESVVKQKGLDIETIQQSYTV  426



>tpg|DAA59901.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=444

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALS
Sbjct  283  LVFAFLVAQLIATLIAVYANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALS  342

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LVLEQRIAFT KK+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLA
Sbjct  343  GRAWNLVLEQRIAFTSKKNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLA  402

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAE+ARLRE+ TLKG +ESVVK KGLDIETIQQ+YTV
Sbjct  403  EEARRRAEMARLREVSTLKGRMESVVKQKGLDIETIQQSYTV  444



>ref|XP_007037195.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
 gb|EOY21696.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
Length=1607

 Score =   198 bits (504),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 124/146 (85%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFV+AQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  795  LVVAFVVAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+A
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDTKMFTERTHFTELNQMA  914

Query  437  eeakrraeiarlreLHTLKGHVESVV  360
            EEAKRRAEIARLRELHTLKGHVESV+
Sbjct  915  EEAKRRAEIARLRELHTLKGHVESVL  940



>emb|CAH58642.1| plasma membrane H+-ATPase [Plantago major]
Length=218

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN+V Y PLD IKF  RY LS
Sbjct  58   LLGAFLIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDFIKFAIRYVLS  117

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDLV EQRIAFTRKKDFGKE REL+WA AQRTLHGL  P  +   E T+  +LNQ+A
Sbjct  118  GKAWDLVFEQRIAFTRKKDFGKEDRELKWAQAQRTLHGLNPPQEQ-SGERTHVTELNQIA  176

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAKRRAE+ARLREL TLKGHVESVVKLK LDI+TIQQ+YTV
Sbjct  177  EEAKRRAEMARLRELLTLKGHVESVVKLKNLDIDTIQQSYTV  218



>gb|ACN34067.1| unknown [Zea mays]
Length=698

 Score =   193 bits (491),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALS
Sbjct  537  LVFAFLVAQLIATLIAVYANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALS  596

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LVLEQRIAFT KK+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLA
Sbjct  597  GRAWNLVLEQRIAFTSKKNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLA  656

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAE+ARLRE+ TLKG +ESVVK KGLDIETIQQ+YTV
Sbjct  657  EEARRRAEMARLREVSTLKGRMESVVKQKGLDIETIQQSYTV  698



>ref|XP_002459489.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
 gb|EER96010.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
Length=956

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+FA+I+GIGWGWAGVIWLYNLV YFPLD+IKF  RYALS
Sbjct  795  LVFAFLVAQLIATLIAVYANWAFASIKGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LVLEQRIAFT KK+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLA
Sbjct  855  GRAWNLVLEQRIAFTSKKNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAE+ARLRE+ TLKG +ESVVK KGLDIETIQQ+YTV
Sbjct  915  EEARRRAEMARLREVSTLKGKMESVVKQKGLDIETIQQSYTV  956



>ref|XP_008650970.1| PREDICTED: uncharacterized protein LOC100216710 isoform X1 [Zea 
mays]
 tpg|DAA59903.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=956

 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYA+W+FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALS
Sbjct  795  LVFAFLVAQLIATLIAVYANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AW+LVLEQRIAFT KK+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLA
Sbjct  855  GRAWNLVLEQRIAFTSKKNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAE+ARLRE+ TLKG +ESVVK KGLDIETIQQ+YTV
Sbjct  915  EEARRRAEMARLREVSTLKGRMESVVKQKGLDIETIQQSYTV  956



>gb|KGN62871.1| hypothetical protein Csa_2G378530 [Cucumis sativus]
Length=170

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVAT+IAVYA+W FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RYA S
Sbjct  8    LVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHS  67

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ + LF E +++ +L+++
Sbjct  68   GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEI  127

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  128  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  170



>ref|XP_010228254.1| PREDICTED: plasma membrane ATPase 3-like isoform X2 [Brachypodium 
distachyon]
Length=956

 Score =   190 bits (483),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW FAAI+GIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVFAFLVAQLIATLIAVYADWGFAAIKGIGWGWAGVIWLYNIVFYLPLDVIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVL+QRIAFTRKKDFG+E+REL+WA AQRTLHGLQ P++  F   T++++LNQLA
Sbjct  855  GRAWDLVLDQRIAFTRKKDFGREERELKWATAQRTLHGLQPPESTTFQGMTSYSELNQLA  914

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            +EA+RRAEIARLREL+TLKG +ESVV+ KGLD+ETIQQ+YTV
Sbjct  915  DEARRRAEIARLRELNTLKGRMESVVRQKGLDLETIQQSYTV  956



>ref|XP_010228253.1| PREDICTED: plasma membrane ATPase 3-like isoform X1 [Brachypodium 
distachyon]
Length=991

 Score =   190 bits (482),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQL+ATLIAVYADW FAAI+GIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  830  LVFAFLVAQLIATLIAVYADWGFAAIKGIGWGWAGVIWLYNIVFYLPLDVIKFLIRYALS  889

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDLVL+QRIAFTRKKDFG+E+REL+WA AQRTLHGLQ P++  F   T++++LNQLA
Sbjct  890  GRAWDLVLDQRIAFTRKKDFGREERELKWATAQRTLHGLQPPESTTFQGMTSYSELNQLA  949

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            +EA+RRAEIARLREL+TLKG +ESVV+ KGLD+ETIQQ+YTV
Sbjct  950  DEARRRAEIARLRELNTLKGRMESVVRQKGLDLETIQQSYTV  991



>gb|AFK46374.1| unknown [Lotus japonicus]
Length=289

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVAT +AVYA+WSFA I G+GWGWAGVIWLY +V Y PLDL+KF  RYALS
Sbjct  127  LLGAFMIAQLVATFLAVYANWSFARINGMGWGWAGVIWLYTIVTYIPLDLLKFAIRYALS  186

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  +F+E  ++ +L+++
Sbjct  187  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNVFNEKNSYRELSEI  246

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  247  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  289



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =   186 bits (473),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM AF+IAQL+AT +AVYAD+SFA I+ IGWGWAGVIWLY+LV YFPLD+ KF  RYALS
Sbjct  794  LMTAFIIAQLIATFLAVYADFSFANIKPIGWGWAGVIWLYSLVFYFPLDIFKFAVRYALS  853

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWD ++E++ AFT KKD+GKE+RE QWAHAQRTLHGL  P+T LF+E +++ +L+++A
Sbjct  854  GKAWDNLIERKTAFTSKKDYGKEEREAQWAHAQRTLHGLHPPETHLFNERSSYRELSEIA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            E+AKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  914  EQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQSYTV  955



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   185 bits (470),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L  AFVIAQLVAT IAVYA+WSFA IEG GWGWAGVIWLY+LV YFPLD++KF  RY LS
Sbjct  792  LATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  +FS+  ++ +L+++
Sbjct  852  GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   185 bits (470),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L  AFVIAQLVAT IAVYA+WSFA IEG GWGWAGVIWLY+LV YFPLD++KF  RY LS
Sbjct  792  LATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  +FS+  ++ +L+++
Sbjct  852  GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHN35778.1| Plasma membrane ATPase 4 [Glycine soja]
Length=365

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+AT+IAVYA+W FA I+GIGWGWAGVIWLY++V YFPLD++KF  RY LS
Sbjct  203  LVTAFVIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMKFAIRYILS  262

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAW+ +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  +F+E +++ +L ++
Sbjct  263  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEI  322

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  323  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  365



>ref|XP_010028675.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW83493.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=955

 Score =   184 bits (466),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQL+ATLIAVYA+W FAAIEGIGWGWAGV+WLYN++CY PLD IKFF RYA+S
Sbjct  795  LVVAFVIAQLIATLIAVYANWGFAAIEGIGWGWAGVVWLYNIICYIPLDFIKFFIRYAMS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDL+ EQRIAFTR+KDFGKE RE +WAHAQRTLHGLQ PD K FSE ++  +L Q+A
Sbjct  855  GRAWDLMFEQRIAFTRQKDFGKEHREREWAHAQRTLHGLQPPDVK-FSERSHATELTQMA  913

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAK RAEIARLREL T K H+ SVV+ K LDI+TI Q YTV
Sbjct  914  EEAKTRAEIARLRELRTFKDHLNSVVRDKRLDIDTIPQGYTV  955



>gb|KCW83494.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=954

 Score =   184 bits (466),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAFVIAQL+ATLIAVYA+W FAAIEGIGWGWAGV+WLYN++CY PLD IKFF RYA+S
Sbjct  794  LVVAFVIAQLIATLIAVYANWGFAAIEGIGWGWAGVVWLYNIICYIPLDFIKFFIRYAMS  853

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            G+AWDL+ EQRIAFTR+KDFGKE RE +WAHAQRTLHGLQ PD K FSE ++  +L Q+A
Sbjct  854  GRAWDLMFEQRIAFTRQKDFGKEHREREWAHAQRTLHGLQPPDVK-FSERSHATELTQMA  912

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEAK RAEIARLREL T K H+ SVV+ K LDI+TI Q YTV
Sbjct  913  EEAKTRAEIARLRELRTFKDHLNSVVRDKRLDIDTIPQGYTV  954



>gb|KJB55190.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=954

 Score =   184 bits (466),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQLVATLIAVYA+W FA I+G+GWGWAGVIWLY++V Y PLDLIKF  RY LS
Sbjct  792  LLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  LF+E +++ +L+++
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   184 bits (466),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 119/163 (73%), Positives = 144/163 (88%), Gaps = 2/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM AFVIAQL+AT+IAVYA+W FA I+G+GWGWAGVIWLY++V YFPLDL+KF  RY LS
Sbjct  795  LMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKFAIRYVLS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAW + +E + AFT KKD+GKE+RE QWAHAQRTLHGLQ P+T  +F+E+ N+ +L+++
Sbjct  855  GKAW-VNIENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNYRELSEI  913

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  914  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   183 bits (465),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM+AF+IAQLVATLIAVYADW+FA ++G GWGWAGVIW++++V YFPLD++KF  RY LS
Sbjct  790  LMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAW+ +L+ + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ + LF+E  ++ +L+++
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEI  909

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   183 bits (465),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM+AF+IAQLVATLIAVYADW+FA ++G GWGWAGVIW++++V YFPLD++KF  RY LS
Sbjct  790  LMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAW+ +L+ + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ + LF+E  ++ +L+++
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEI  909

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   183 bits (465),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM+AF+IAQLVATLIAVYADW+FA ++G GWGWAGVIW++++V YFPLD++KF  RY LS
Sbjct  790  LMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAW+ +L+ + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ + LF+E  ++ +L+++
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEI  909

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=954

 Score =   183 bits (465),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM+AF+IAQL+AT++AVYA+W FA I+G+GWGWAGVIWLY++V Y PLD++KF  RYALS
Sbjct  792  LMIAFLIAQLLATILAVYANWGFARIKGMGWGWAGVIWLYSIVTYIPLDILKFMIRYALS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAWD VLE + AFT KKD+GK +RE QWA AQRTLHGLQ P+T  +F++  N+ +L+++
Sbjct  852  GKAWDNVLENKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSDIFNDKNNYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQLVATLIAVYA+W FA I+G+GWGWAGVIWLY++V Y PLDLIKF  RY LS
Sbjct  497  LLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLS  556

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  LF+E +++ +L+++
Sbjct  557  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEI  616

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  617  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  659



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L  AFVIAQLVAT IAVYA+WSFA IEG GWGWAGVIWLY+LV YFPLD++KF  RY LS
Sbjct  723  LATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILS  782

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  +FS+  ++ +L+++
Sbjct  783  GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEI  842

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  843  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   182 bits (463),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 118/163 (72%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+AT+IAVYA+W FA I GIGWGWAGVIWLY+L+ Y PLD++KF  RY LS
Sbjct  792  LLGAFVIAQLIATIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFIIRYVLS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD VLE++ AFT KKD+GK +RE QWA AQRTLHGLQ P+T +LF++  N+ +L+++
Sbjct  852  GKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNYGELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CDP02191.1| unnamed protein product [Coffea canephora]
Length=967

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L +AFV AQL+ATLIAVY +W+FAAIEGIGWGWAGV+WLYN+VCY PLD +KFF RY LS
Sbjct  807  LGLAFVGAQLIATLIAVYCNWNFAAIEGIGWGWAGVVWLYNIVCYIPLDFLKFFVRYILS  866

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWDL++EQR+AFT+KKDFGKE+REL+W  AQRTLHGL  P+T  F + +   DLNQ+A
Sbjct  867  GKAWDLLIEQRVAFTKKKDFGKEERELKWVQAQRTLHGLHPPETH-FGDHSRAADLNQIA  925

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAE+ARLREL TLKGHVESVVK K LDI+TIQQ+YTV
Sbjct  926  EEARRRAEMARLRELRTLKGHVESVVKSKNLDIDTIQQSYTV  967



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   182 bits (463),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 118/163 (72%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+AT+IAVYA+W FA I GIGWGWAGVIWLY+L+ Y PLD++KF  RY LS
Sbjct  792  LLGAFVIAQLIATIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFIIRYVLS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD VLE++ AFT KKD+GK +RE QWA AQRTLHGLQ P+T +LF++  N+ +L+++
Sbjct  852  GKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KJB55189.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=956

 Score =   182 bits (462),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 119/162 (73%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQLVATLIAVYA+W FA I+G+GWGWAGVIWLY++V Y PLDLIKF  RY LS
Sbjct  792  LLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  LF+E +++ +L+++
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYT  315
            AE+AKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ YT
Sbjct  912  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYT  953



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   182 bits (462),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 117/163 (72%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF+IAQLVATLIAVYA+W+FA ++G GWGWAGVIWLY++V YFPLD++KF  RY LS
Sbjct  790  LVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIVFYFPLDIMKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAW+ +L+ + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T LF+E  ++ +L+++
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEI  909

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVATLIAVYADWSFA I+G GWGWAGVIWLY++V YFPLD++KF  RY LS
Sbjct  792  LLGAFLIAQLVATLIAVYADWSFAKIKGCGWGWAGVIWLYSIVTYFPLDILKFCIRYVLS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE R AFT K ++GKE+RE QWA +QRTLHGLQ P+T  LF+E +++ +L+++
Sbjct  852  GKAWDNLLENRTAFTTKSNYGKEEREAQWAASQRTLHGLQPPETANLFAEKSSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   182 bits (462),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQLVAT+IAVYA+WSFA I+GIGWGWAGVIWLY++V +FPLD  KF  RY LS
Sbjct  792  LVTAFVIAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFFFPLDCFKFAIRYILS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE R AFT KKD+G+E+RE QWA AQRTLHGLQ P+T  LFS+  ++ +L+++
Sbjct  852  GKAWDNLLENRTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETANLFSDKNSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 147/164 (90%), Gaps = 2/164 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLIAVYA+W FA IEG GWGWAGVIW+Y++V YFPLD++KF TRYALS
Sbjct  788  LLGAFLIAQLIATLIAVYANWGFARIEGCGWGWAGVIWIYSVVFYFPLDIMKFGTRYALS  847

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEA-TNFNDLNQ  444
            GKAW+ ++EQR+AFT KKD+GKE+RE QWAH QRTLHGLQ P+ T +F++  +N+ +L++
Sbjct  848  GKAWNNMIEQRVAFTTKKDYGKEEREAQWAHVQRTLHGLQPPEATNIFNDKNSNYRELSE  907

Query  443  laeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            +AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  908  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KJB19303.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
 gb|KJB19304.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=925

 Score =   182 bits (461),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 98/118 (83%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+ATLIAVYA+WSFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALS
Sbjct  795  LLAAFVIAQLIATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQ  444
            G+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ
Sbjct  855  GRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDTKMFTERTHFTELNQ  912



>gb|KCW49373.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=925

 Score =   182 bits (461),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF+IAQL+ATLIAVYA WSFAAIEGIGWGWAGVIWLYN++ Y PLDLIKFFTRYALS
Sbjct  795  LVVAFIIAQLIATLIAVYASWSFAAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFTRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQ  444
            G+AWDLVLEQRIAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E  +F +LN 
Sbjct  855  GRAWDLVLEQRIAFTRQKDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERAHFTELNH  912



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVATLIAVYA+W F+ I+GIGWGWAGVIWLY +V Y PLD+IKFF RY LS
Sbjct  792  LVSAFIIAQLVATLIAVYANWGFSRIKGIGWGWAGVIWLYTIVSYVPLDIIKFFIRYVLS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  LF++ +++ +L+++
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKSSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   182 bits (461),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF+IAQLVATLIAVYA+W+FA ++G GWGWAGVIWLY+++ YFPLD++KF  RY LS
Sbjct  790  LVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYFPLDIMKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAW+ +L+ + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T LF+E  ++ +L+++
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEI  909

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_006428674.1| hypothetical protein CICLE_v10011040mg [Citrus clementina]
 gb|ESR41914.1| hypothetical protein CICLE_v10011040mg [Citrus clementina]
Length=889

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L +AF +AQL ATLIAVYA WSFA IEGIGWGWAGVIWLYN+V Y PLD IKFF RY LS
Sbjct  728  LALAFFVAQLTATLIAVYATWSFATIEGIGWGWAGVIWLYNIVFYIPLDFIKFFIRYVLS  787

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
               WDLV EQR AFT KKDFGKE+REL WAHAQRTLHGLQ PDT +FS  +++ +L+ +A
Sbjct  788  RNFWDLVTEQRTAFTSKKDFGKEERELLWAHAQRTLHGLQPPDTSMFSVRSSYGELSWMA  847

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAEIARLRELHTLKGHVES+++LKGLDI+ IQQ+Y+V
Sbjct  848  EEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQSYSV  889



>gb|ABM68570.1| plasma membrane H+ ATPase [Lilium longiflorum]
Length=191

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+ AQLVAT+I+VYA W FA I+GIGW WAGVIW++++V YFPLD++KF  RYALS
Sbjct  29   LVTAFLAAQLVATVISVYASWGFARIDGIGWRWAGVIWIFSIVTYFPLDILKFIIRYALS  88

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GK WD +++ + AFT KKD+GK +RE QWA AQRTLHGLQ  DT  LF++  ++ +L+++
Sbjct  89   GKTWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQTADTSSLFNDKNSYRELSEI  148

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  149  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  191



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =   182 bits (461),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 119/163 (73%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM AFVIAQL+AT+IAVYA+W FA I+G+GWGWAGVIWLY++V YFPLDL+KF  RY LS
Sbjct  792  LMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKFAIRYVLS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAW + +E + AFT KKD GKE+RE QWAHAQRTLHGLQ P+T  +F+E+ N+ +L+++
Sbjct  852  GKAW-VNIENKTAFTTKKDCGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNYRELSEI  910

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|EPS66977.1| hypothetical protein M569_07799, partial [Genlisea aurea]
Length=922

 Score =   181 bits (460),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 98/118 (83%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVATLI+VY +WSFAAIEGIGWGWAGVIWLYN++ Y PLD+IKFF RY+LS
Sbjct  792  LVAAFIVAQLVATLISVYGNWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIIKFFIRYSLS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQ  444
            GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLF+E  +F++LNQ
Sbjct  852  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFNETNSFSELNQ  909



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+AT+IAVYADW FA ++GIGWGWAGVIWLY++V Y PLD++KF TRY LS
Sbjct  791  LVCAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSIVFYIPLDVMKFATRYVLS  850

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHGLQ P+T  +F+E  ++ +L+++
Sbjct  851  GKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSYRELSEI  910

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis sativus]
Length=948

 Score =   181 bits (460),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 114/162 (70%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF+ AQLVATLIAVY++W+FA I+GIGWGWAG IW++++V YFPLD++KF  RY LS
Sbjct  788  LVIAFIAAQLVATLIAVYSEWNFARIKGIGWGWAGAIWVFSIVTYFPLDVLKFAIRYGLS  847

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWD +LE + AFT KKD+GK +RE QWA AQRT+HGLQ P+T +F E +N+ DL+++A
Sbjct  848  GKAWDNMLENKTAFTTKKDYGKGEREAQWAIAQRTMHGLQPPET-IFHEKSNYEDLSEIA  906

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            E+AK+RAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  907  EQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  948



>ref|XP_006480481.1| PREDICTED: ATPase 4, plasma membrane-type-like [Citrus sinensis]
Length=935

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L +AF +AQL ATLIAVYA WSFA IEGIGWGWAGVIWLYN+V Y PLD IKFF RY LS
Sbjct  774  LALAFFVAQLTATLIAVYATWSFATIEGIGWGWAGVIWLYNIVFYIPLDFIKFFIRYVLS  833

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
               WDLV EQR AFT KKDFGKE+REL WAHAQRTLHGLQ PDT +FS  +++ +L+ +A
Sbjct  834  RNFWDLVTEQRTAFTSKKDFGKEERELLWAHAQRTLHGLQPPDTSMFSVRSSYGELSWMA  893

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            EEA+RRAEIARLRELHTLKGHVES+++LKGLDI+ IQQ+Y+V
Sbjct  894  EEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQSYSV  935



>ref|XP_006658357.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=957

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYA+W+FAAI+GIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVFAFFVAQLIATLIAVYANWAFAAIKGIGWGWAGVIWLYNIVFYLPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWDLVLEQRIAFTRKKDFG ++ +L+WA AQRT+HGLQ   T  +F + T++NDLNQL
Sbjct  855  GKAWDLVLEQRIAFTRKKDFGTQENQLKWATAQRTIHGLQPATTAGVFRDMTSYNDLNQL  914

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AEEA+RRAEIARLREL+TLKG +ESVVK KGLD+ETIQQ+YTV
Sbjct  915  AEEARRRAEIARLRELNTLKGRMESVVKQKGLDLETIQQSYTV  957



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   181 bits (459),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQLVATLIAVYA+W FA I+G+GWGWAGVIWLY++V + PLDLIKF TRY LS
Sbjct  792  LVSAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTFVPLDLIKFATRYVLS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  +FSE +++ +L+++
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSERSSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   181 bits (459),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LMVAF+IAQL+ATLIAVYA+W FA+++GIGWGWAGVIWLY+++ Y PLD++KF  RYALS
Sbjct  787  LMVAFLIAQLIATLIAVYANWEFASMKGIGWGWAGVIWLYSIIFYIPLDVLKFVIRYALS  846

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAW+ + E R AFT KKD+GK +RE QWA AQRTLHGL  P+T ++ +E+ N+ +L++L
Sbjct  847  GKAWNNITENRTAFTSKKDYGKGEREAQWAAAQRTLHGLNPPETDQVLNESNNYRELSEL  906

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            A++AK+RAEIARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  907  ADQAKKRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   181 bits (459),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVATLIAVYA+W+FA IEG GWGWAGVIWL+++V YFPLDL+KF  RY LS
Sbjct  792  LLGAFMVAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  LFSE  ++ +L+++
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   181 bits (459),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVATLIAVYA+W+FA IEG GWGWAGVIWL+++V YFPLDL+KF  RY LS
Sbjct  781  LLGAFMVAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILS  840

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  LFSE  ++ +L+++
Sbjct  841  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEI  900

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  901  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  943



>emb|CDP04837.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQLVATLIAVYA+WSFA I+G GWGWAGVIWLY++V Y PLD +KFF RY LS
Sbjct  65   LLTAFVIAQLVATLIAVYANWSFARIKGCGWGWAGVIWLYSVVFYVPLDFLKFFIRYVLS  124

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
             KAW  +++ +IAFT KKD+GKE+RE QWA AQRTLHGLQ PD + +  E +++ +L+++
Sbjct  125  RKAWLNLIDNKIAFTTKKDYGKEEREAQWAVAQRTLHGLQPPDASGILDEKSSYRELSEI  184

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ  TV
Sbjct  185  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHCTV  227



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   181 bits (458),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVATLIAVYADWSFA I+GI WGWAGVIW+Y++V Y PLD++KF TRY LS
Sbjct  795  LVSAFIIAQLVATLIAVYADWSFARIKGIDWGWAGVIWIYSIVFYVPLDIMKFATRYILS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAW  +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T LF E +++ +L+++
Sbjct  855  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETTNLFPEKSSYRELSEI  914

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  915  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  957



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   181 bits (458),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AFV+AQLVATLIAVYADW FA I+GIGWGWAGVIWLY++V +FPLDL KF  RY LS
Sbjct  792  LVIAFVVAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSIVFFFPLDLFKFAIRYILS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE++ AFT KKD+G+E+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++
Sbjct  852  GKAWDNLLEKKTAFTSKKDYGREEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   181 bits (458),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LMVAF+IAQLVATLIAVY +W+FA I+G GWGWAGV+WLYN+V YFPLD+IKF  RY LS
Sbjct  790  LMVAFLIAQLVATLIAVYPNWAFAEIKGCGWGWAGVVWLYNIVFYFPLDVIKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK--LFSEATNFNDLNQ  444
            GKAW  + E + AFT KKD+GKE+RE QWA AQRTLHGLQ P++   LF++  ++ +L++
Sbjct  850  GKAWLNLFESKTAFTSKKDYGKEEREAQWALAQRTLHGLQAPESSATLFNDKNSYRELSE  909

Query  443  laeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            +AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  910  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>ref|XP_012075128.1| PREDICTED: plasma membrane ATPase 4 [Jatropha curcas]
 gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   181 bits (458),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM AF+IAQLVATLIAVYADW FA I+GIGWGWAGVIW+Y++V Y PLDL+KF  RY LS
Sbjct  790  LMSAFLIAQLVATLIAVYADWGFARIKGIGWGWAGVIWIYSIVFYIPLDLLKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAW+ +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  +F+E  ++ +L+++
Sbjct  850  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETASIFNEKNSYRELSEI  909

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF+IAQ++AT+IAVYADWSFA ++GIGWGWAGVIWLY++V YFPLDL+KF  RY LS
Sbjct  791  LIIAFMIAQMIATIIAVYADWSFAKVKGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILS  850

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAW  +LE + AFT KKD+G+E+RE QWAHAQRTLHGLQ P+ T +F+E  ++ +L+++
Sbjct  851  GKAWVNLLENKTAFTTKKDYGREEREAQWAHAQRTLHGLQPPETTSIFNEKNSYRELSEI  910

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+A +RAE+ARLRELHTLKGHVESVVKLKGLDI+ IQQ YTV
Sbjct  911  AEQAMKRAEVARLRELHTLKGHVESVVKLKGLDIDNIQQHYTV  953



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   181 bits (458),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVATLIAVYADW FA I+GIGWGWAGVIWLY++V +FPLDL KF  RY LS
Sbjct  792  LVTAFIVAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSVVFFFPLDLFKFAIRYILS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE++ AFT KKD+G+E+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++
Sbjct  852  GKAWDNLLEKKTAFTSKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNDKNSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   181 bits (458),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 118/163 (72%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF IAQLVAT IAVYA+WSFA I+G+GWGWAGVIWLY++V Y PLDL+KF  RY LS
Sbjct  789  LLGAFFIAQLVATFIAVYANWSFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  LF++  ++ +L+++
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEI  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   181 bits (458),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVAT IAVYA+W FA I+G+GWGWAGVIW+Y+LV YFPLD++KF  RY LS
Sbjct  789  LLGAFMIAQLVATFIAVYANWGFARIKGMGWGWAGVIWVYSLVTYFPLDILKFVIRYVLS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPETTNLFNDKNSYRELSEI  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T+QQ YTV
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVATLIAVYA+W+FA IEG GWGWAGVIWL+++V YFPLDL+KF  RY LS
Sbjct  773  LLGAFMIAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILS  832

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  LF+E  ++ +L+++
Sbjct  833  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEI  892

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  893  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  935



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFV+AQL+ATLIAVYA+WSFA IEG+GWGWA  +W+Y LV Y PLD++KF  RYALS
Sbjct  791  LLGAFVVAQLIATLIAVYANWSFAKIEGMGWGWALAVWIYTLVTYIPLDILKFTIRYALS  850

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            G+AW+ +L+ + AFT KKD+GKE+RE QWA AQRT+HGLQ P+ T LF E +N+ +L+++
Sbjct  851  GRAWNNLLDNKTAFTTKKDYGKEEREAQWAAAQRTMHGLQPPETTNLFPEKSNYRELSEI  910

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   180 bits (457),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 117/164 (71%), Positives = 140/164 (85%), Gaps = 2/164 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM AFVIAQL+ATLIAVYA+W FA I+GIGWGWAGVIWLY+++ Y PLD+IKF  RY LS
Sbjct  795  LMGAFVIAQLIATLIAVYANWGFARIQGIGWGWAGVIWLYSIIFYIPLDIIKFAIRYGLS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD--TKLFSEATNFNDLNQ  444
            GKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHGL  P+  + LF++   + +L++
Sbjct  855  GKAWTNLLENKTAFTNKKDYGKEEREAQWAHAQRTLHGLSAPEETSSLFNDKNTYRELSE  914

Query  443  laeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            +AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIET+QQ YTV
Sbjct  915  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  958



>gb|KGN65225.1| hypothetical protein Csa_1G267210 [Cucumis sativus]
Length=778

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF+ AQLVATLIAVY++W+FA I+GIGWGWAG IW++++V YFPLD++KF  RY LS
Sbjct  618  LVIAFIAAQLVATLIAVYSEWNFARIKGIGWGWAGAIWVFSIVTYFPLDVLKFAIRYGLS  677

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWD +LE + AFT KKD+GK +RE QWA AQRT+HGLQ P+T +F E +N+ DL+++A
Sbjct  678  GKAWDNMLENKTAFTTKKDYGKGEREAQWAIAQRTMHGLQPPET-IFHEKSNYEDLSEIA  736

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            E+AK+RAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  737  EQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  778



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   180 bits (457),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 115/163 (71%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+AT IAVYA+WSFA I+G+GWGWAGVIW+Y++V Y PLD++KF  RY LS
Sbjct  789  LLGAFMIAQLLATFIAVYANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFVIRYVLS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ PD T LF++  ++ +L+++
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEI  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T+QQ YTV
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>emb|CDP14278.1| unnamed protein product [Coffea canephora]
Length=1297

 Score =   181 bits (459),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 113/162 (70%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  797   LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
             L+ AF IAQLVATLIAVYA+WSFA I+GIGWGW GVIW++++V YFPLD++KF  RYALS
Sbjct  1136  LVTAFFIAQLVATLIAVYANWSFARIQGIGWGWGGVIWIFSIVTYFPLDILKFIIRYALS  1195

Query  617   GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
             GKAWD +++ + AFT KKD+G+E+RE QWA AQRTLHGLQ P++       ++ +L+++A
Sbjct  1196  GKAWDSMIQNKTAFTTKKDYGREEREAQWALAQRTLHGLQTPESAGLFNDKHYRELSEIA  1255

Query  437   eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
             E+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  1256  EQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  1297



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   180 bits (456),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 117/163 (72%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVATLIAVYA+W FA I+GIGWGWAGVIW+Y++V YFPLD++KF  RY LS
Sbjct  790  LVSAFMLAQLVATLIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHGLQ P+T  +F+E +++ +L+++
Sbjct  850  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEKSSYRELSEI  909

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+AT+IAVYADW FA ++GIGWGWAGVIWLY++V Y PLD++KF TRY LS
Sbjct  791  LVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMKFATRYILS  850

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHGLQ P+T  +F+E  ++ +L+++
Sbjct  851  GKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSYRELSEI  910

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =   180 bits (456),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 115/163 (71%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVATLIAVYADWSFA I+GIGWGWAGVIWLY++V + PLD  KF  RY LS
Sbjct  795  LVSAFMIAQLVATLIAVYADWSFAKIKGIGWGWAGVIWLYSIVFFVPLDWFKFTIRYILS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAWD ++E++IAFT KKD+G+E+RE QWA AQRTLHGLQ P+T+ LF E +++++L+++
Sbjct  855  GKAWDNLIERKIAFTSKKDYGREEREAQWATAQRTLHGLQPPETRTLFHEKSSYHELSEI  914

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+A+RRAE+ARLRE++TLKGHVESVVKLKG+DI+TIQQ+YTV
Sbjct  915  AEQARRRAEVARLREMNTLKGHVESVVKLKGIDIDTIQQSYTV  957



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   180 bits (456),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 118/163 (72%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF IAQLVAT IAVYA+W FA I+G+GWGWAGVIWLY+LV Y PLDL+KF  RY LS
Sbjct  789  LLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYVLS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ + LF+E  ++ +L+++
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEASNLFNEKNSYRELSEI  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   180 bits (456),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 115/163 (71%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+AT IAVYA+WSFA I+G+GWGWAGVIW+Y++V Y PLD++KF  RY LS
Sbjct  788  LLGAFMIAQLLATFIAVYANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFVIRYVLS  847

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ PD T LF++  ++ +L+++
Sbjct  848  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEI  907

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T+QQ YTV
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  950



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQL+AT+IAVYADW FA ++GIGWGWAGVIWLY++V Y PLD++KF TRY LS
Sbjct  791  LVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMKFATRYILS  850

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHGLQ P+T  +F+E  ++ +L+++
Sbjct  851  GKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSYRELSEI  910

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   180 bits (456),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 2/164 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L  AF+IAQLVATLIAVYA+W FA I+G GWGWAGV+WLYN+V Y PLD++KF  RY LS
Sbjct  790  LFTAFLIAQLVATLIAVYANWGFADIKGCGWGWAGVVWLYNIVFYVPLDILKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD--TKLFSEATNFNDLNQ  444
            GKAW  + E + AFT KKD+GKE+RE QWAHAQRTLHGLQ P+    LF+E  ++ +L++
Sbjct  850  GKAWLNLFESKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPEPSNHLFNEKNSYRELSE  909

Query  443  laeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            +AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  910  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>emb|CAD29579.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 143/165 (87%), Gaps = 3/165 (2%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVAT +AVYA+W FA I+GIGWGWAGV+WLY++V YFPLDL+KFF R+ LS
Sbjct  148  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFFIRFVLS  207

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK---LFSEATNFNDLN  447
            G+AWD +LE + AFT KKD+G+E+RE QWA AQRTLHGLQ P+     LF++ +++ +L+
Sbjct  208  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELS  267

Query  446  QlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            ++AE+AKRRAEIARLREL+TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  268  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFVIAQLVATLIAVYA+W FA I+GIGWGWA VIWLY++V +FPLDL KF  RY LS
Sbjct  792  LVTAFVIAQLVATLIAVYANWGFARIKGIGWGWAAVIWLYSIVFFFPLDLFKFSIRYILS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE++ AFT KKD+G+E+RE QWA AQRTLHGLQ P+ T LF+E  ++ +L+++
Sbjct  852  GKAWDNLLEKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNEKNSYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CAD62443.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVAT +AVYA+W FA I+GIGWGWAGV+WLY++V YFPLDLIKFF R+ LS
Sbjct  148  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLS  207

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD---TKLFSEATNFNDLN  447
            G+AWD +LE + AFT KKD+G+E+RE QWA AQRTLHGLQ P+   + LF +  ++ +L+
Sbjct  208  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELS  267

Query  446  QlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            ++AE+AKRRAEIARLREL+TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  268  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   179 bits (455),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 115/163 (71%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF+IAQLVATLIAVYA+W+FA ++G GWGWAGVIWLY+++ Y PLD++KF  RY LS
Sbjct  790  LVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYLPLDIMKFAIRYILS  849

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAW+ +L+ + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T LF+E  ++ +L+++
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEI  909

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   179 bits (455),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 117/163 (72%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVAT+IAVYA+W FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RYA S
Sbjct  793  LVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHS  852

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ + LF E +++ +L+++
Sbjct  853  GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEI  912

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   179 bits (455),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 113/163 (69%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF IAQL+ATLIAVYA+W FA ++GIGWGWAGVIWLY++V Y P+D++KF  RYAL+
Sbjct  787  LLVAFFIAQLIATLIAVYANWGFAKMKGIGWGWAGVIWLYSIVFYIPMDILKFIIRYALT  846

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAW+ + E R+AFT KKD+GK +RE QWA AQRTLHGL  P+T ++ +E  N+ +L++L
Sbjct  847  GKAWNTITENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSEL  906

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AK+RAE+ARLRELHTLKGHVESVVKLKGLDIET+QQ YTV
Sbjct  907  AEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  949



>gb|KHN22411.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=916

 Score =   179 bits (455),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 113/163 (69%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+VAF IAQL+ATLIAVYA+W FA ++GIGWGWAGVIWLY++V Y P+D++KF  RYAL+
Sbjct  754  LLVAFFIAQLIATLIAVYANWGFAKMKGIGWGWAGVIWLYSIVFYIPMDILKFIIRYALT  813

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAW+ + E R+AFT KKD+GK +RE QWA AQRTLHGL  P+T ++ +E  N+ +L++L
Sbjct  814  GKAWNTITENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSEL  873

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AK+RAE+ARLRELHTLKGHVESVVKLKGLDIET+QQ YTV
Sbjct  874  AEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  916



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   179 bits (455),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVAT +AVYA+W FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RY LS
Sbjct  789  LLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   179 bits (455),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVAT +AVYA+W FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RY LS
Sbjct  789  LLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   179 bits (455),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 115/163 (71%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+ATLIAVYA+WSFA I G GWGWAGVIW+Y++V YFPLDL+KF  RY LS
Sbjct  793  LLGAFLIAQLIATLIAVYANWSFARIHGCGWGWAGVIWIYSIVFYFPLDLMKFAIRYILS  852

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHGL+ P+ + +F++ +++ +L+++
Sbjct  853  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLEAPESSSIFNDKSSYRELSEI  912

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_011017965.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=949

 Score =   179 bits (455),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 111/162 (69%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AFV+AQL+AT+IAVYA+WSFA I+G+GWGWAG+IW+Y+++ Y PLD++KF  RYAL+
Sbjct  789  LVSAFVVAQLMATIIAVYANWSFARIQGVGWGWAGIIWIYSIITYIPLDILKFIIRYALT  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWD +L+ + AFT KKD+GK +RE QWA AQRTLHGLQ P+T +F++ T + +LN+LA
Sbjct  849  GKAWDNLLQNKTAFTNKKDYGKGEREAQWATAQRTLHGLQPPET-MFNDKTTYRELNELA  907

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            E+AK+RAE+ARLRELHTLKGHV+SVVK+KGLDIETIQQ YTV
Sbjct  908  EQAKKRAEVARLRELHTLKGHVDSVVKMKGLDIETIQQHYTV  949



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM AF+IAQL+AT+IAVYA+W FA I+GIGWGWAGVIWLY++V YFPLDL+KF  RY LS
Sbjct  793  LMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILS  852

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAW+ +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  +F+E +++ +L ++
Sbjct  853  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEI  912

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            LM AF+IAQL+AT+IAVYA+W FA I+GIGWGWAGVIWLY++V YFPLDL+KF  RY LS
Sbjct  793  LMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILS  852

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAW+ +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  +F+E +++ +L ++
Sbjct  853  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEI  912

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   179 bits (455),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVAT +AVYA+W FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RY LS
Sbjct  789  LLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF++AQLVATLIAVYADW FA I+G+GWGWAGVIWLY++V Y PLDLIKF  RY LS
Sbjct  501  LVSAFLVAQLVATLIAVYADWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLS  560

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T +F+E +++ +L+++
Sbjct  561  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETTSIFNERSSYRELSEI  620

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLREL+TLKGHVESVVKLKGLDI+ IQQ YTV
Sbjct  621  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  663



>ref|NP_001059093.1| Os07g0191200 [Oryza sativa Japonica Group]
 emb|CAD29295.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAC83861.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAF21007.1| Os07g0191200 [Oryza sativa Japonica Group]
Length=957

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYA+W FA+I+GIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVFAFFVAQLIATLIAVYANWGFASIKGIGWGWAGVIWLYNIVFYLPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            G+AWDLVLEQRIAFTRKKDFG ++ +L+WA AQRT+HGLQ   T  +F + T++NDLNQL
Sbjct  855  GRAWDLVLEQRIAFTRKKDFGTQENQLKWATAQRTIHGLQPAATAAVFRDMTSYNDLNQL  914

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AEEA+RRAEIARLREL TLKG +ESVVK KGLD+ETIQQ+YTV
Sbjct  915  AEEARRRAEIARLRELTTLKGRMESVVKQKGLDLETIQQSYTV  957



>gb|EEC81667.1| hypothetical protein OsI_25220 [Oryza sativa Indica Group]
 gb|EEE66722.1| hypothetical protein OsJ_23404 [Oryza sativa Japonica Group]
Length=951

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYA+W FA+I+GIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  789  LVFAFFVAQLIATLIAVYANWGFASIKGIGWGWAGVIWLYNIVFYLPLDIIKFLIRYALS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            G+AWDLVLEQRIAFTRKKDFG ++ +L+WA AQRT+HGLQ   T  +F + T++NDLNQL
Sbjct  849  GRAWDLVLEQRIAFTRKKDFGTQENQLKWATAQRTIHGLQPAATAAVFRDMTSYNDLNQL  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AEEA+RRAEIARLREL TLKG +ESVVK KGLD+ETIQQ+YTV
Sbjct  909  AEEARRRAEIARLRELTTLKGRMESVVKQKGLDLETIQQSYTV  951



>dbj|BAA06629.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=957

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF +AQL+ATLIAVYA+W FA+I+GIGWGWAGVIWLYN+V Y PLD+IKF  RYALS
Sbjct  795  LVFAFFVAQLIATLIAVYANWGFASIKGIGWGWAGVIWLYNIVFYLPLDIIKFLIRYALS  854

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            G+AWDLVLEQRIAFTRKKDFG ++ +L+WA AQRT+HGLQ   T  +F + T++NDLNQL
Sbjct  855  GRAWDLVLEQRIAFTRKKDFGTQENQLKWATAQRTIHGLQPAATAAVFRDMTSYNDLNQL  914

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AEEA+RRAEIARLREL TLKG +ESVVK KGLD+ETIQQ+YTV
Sbjct  915  AEEARRRAEIARLRELTTLKGRMESVVKQKGLDLETIQQSYTV  957



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   179 bits (454),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 112/163 (69%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L++AF+ AQLVAT+IAVYA W FA I+GIGWGWA  IW+Y+++ Y PLD++KF TRYALS
Sbjct  788  LVIAFIAAQLVATVIAVYASWGFARIQGIGWGWAAFIWVYSVITYIPLDILKFITRYALS  847

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAWD V++ + AFT KKD+GK +RE QWA AQRTLHGLQ PDT   F++ +++ +L+++
Sbjct  848  GKAWDNVIQNKTAFTSKKDYGKGEREAQWAMAQRTLHGLQSPDTSGFFNDKSSYKELSEI  907

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHV+SVVKLKGLDIETIQQ YTV
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVDSVVKLKGLDIETIQQHYTV  950



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   179 bits (453),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 116/163 (71%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQLVAT +AVYA+W FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RY LS
Sbjct  789  LLGAFMIAQLVATFLAVYANWEFARIKGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CDP14275.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF IAQLVATLIAVYA+WSFA I+GIGWGW GVIW++++V YFPLD++KF  RYALS
Sbjct  474  LVTAFFIAQLVATLIAVYANWSFARIQGIGWGWGGVIWIFSIVTYFPLDILKFIIRYALS  533

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQla  438
            GKAWD +++ + AFT KKD+G+E+RE QWA AQRTLHGLQ P++       ++ +L+++A
Sbjct  534  GKAWDSMIQNKTAFTTKKDYGREEREAQWALAQRTLHGLQTPESAGLFNDKHYRELSEIA  593

Query  437  eeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            E+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  594  EQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  635



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   179 bits (453),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 117/163 (72%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF IAQLVAT IAVYA+W FA I+G+GWGWAGVIWLY++V Y PLDL+KF  RY LS
Sbjct  789  LLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILS  848

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHGLQ P+T  LF++  ++ +L+++
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEI  908

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   179 bits (453),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 113/163 (69%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+ AQLVAT+IAVYA WSFA I+GIGWGWA  IW+Y+++ Y PLD++KF TRY LS
Sbjct  788  LVTAFIAAQLVATVIAVYASWSFARIQGIGWGWAAFIWVYSVITYIPLDILKFITRYVLS  847

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQl  441
            GKAWD +L+ + AFT KKD+G+ +RE QWA AQRTLHGLQ PDT  LF++  ++ +L+++
Sbjct  848  GKAWDNLLQNKTAFTSKKDYGRGEREAQWAMAQRTLHGLQSPDTSALFNDKNSYRELSEI  907

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   179 bits (453),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 118/163 (72%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  797  LMVAFVIAQLVATLIAVYADWSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALS  618
            L+ AF+IAQL+AT+IAVYA W FA I GIGWGWAGVIWLY++V Y PLD++KF  RYALS
Sbjct  792  LVGAFLIAQLIATIIAVYAHWGFARIHGIGWGWAGVIWLYSIVFYIPLDILKFIIRYALS  851

Query  617  GKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQl  441
            GKAWD VLE++ AFT KKD+GK +RE QWA AQRTLHGLQ  +T +LFS+  N+ +L+++
Sbjct  852  GKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQSAETAELFSDKNNYRELSEI  911

Query  440  aeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  312
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876