BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1801

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009758632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    297   6e-95   Nicotiana sylvestris
ref|XP_009758633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    296   6e-95   Nicotiana sylvestris
emb|CDP07525.1|  unnamed protein product                                294   1e-93   Coffea canephora [robusta coffee]
ref|XP_006341928.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    290   1e-92   Solanum tuberosum [potatoes]
ref|XP_004238250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      290   2e-92   Solanum lycopersicum
ref|XP_003631648.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      287   9e-91   Vitis vinifera
gb|EYU45144.1|  hypothetical protein MIMGU_mgv1a006001mg                286   1e-90   Erythranthe guttata [common monkey flower]
gb|KJB58293.1|  hypothetical protein B456_009G202900                    286   2e-90   Gossypium raimondii
gb|KJB58294.1|  hypothetical protein B456_009G202900                    286   2e-90   Gossypium raimondii
ref|XP_002282736.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    283   1e-89   Vitis vinifera
ref|XP_007017516.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    283   2e-89   
ref|XP_007017514.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    283   2e-89   
ref|XP_010664681.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    283   3e-89   Vitis vinifera
ref|XP_010263687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    282   5e-89   Nelumbo nucifera [Indian lotus]
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             282   5e-89   
ref|XP_009365605.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    281   2e-88   Pyrus x bretschneideri [bai li]
ref|XP_011024410.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    281   3e-88   Populus euphratica
ref|XP_010060941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    280   4e-88   Eucalyptus grandis [rose gum]
ref|XP_010060942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    280   4e-88   Eucalyptus grandis [rose gum]
ref|XP_008377425.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    280   5e-88   
gb|KHG04672.1|  hypothetical protein F383_30229                         279   5e-88   Gossypium arboreum [tree cotton]
ref|XP_006372047.1|  hypothetical protein POPTR_0018s08710g             275   1e-87   
ref|NP_001275210.1|  glucan endo-1,3-beta-D-glucosidase-like prec...    278   1e-87   Solanum tuberosum [potatoes]
ref|XP_004293211.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      279   2e-87   Fragaria vesca subsp. vesca
ref|XP_006372048.1|  hypothetical protein POPTR_0018s08710g             275   2e-87   
ref|XP_011083694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      277   3e-87   Sesamum indicum [beniseed]
ref|XP_002321276.2|  hypothetical protein POPTR_0014s18140g             269   4e-87   
emb|CDO97058.1|  unnamed protein product                                276   8e-87   Coffea canephora [robusta coffee]
ref|XP_010096392.1|  Glucan endo-1,3-beta-glucosidase 7                 276   1e-86   Morus notabilis
ref|XP_002510373.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    275   2e-86   Ricinus communis
ref|XP_006375631.1|  hypothetical protein POPTR_0014s18230g             274   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_002321274.1|  hypothetical protein POPTR_0014s18110g             272   3e-86   
ref|XP_004230886.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      275   4e-86   Solanum lycopersicum
ref|XP_008220789.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      275   4e-86   Prunus mume [ume]
ref|XP_009804917.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    273   6e-86   Nicotiana sylvestris
ref|XP_002321270.2|  hypothetical protein POPTR_0014s18290g             268   8e-86   
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    273   1e-85   Populus euphratica
ref|XP_007222662.1|  hypothetical protein PRUPE_ppa004976mg             273   2e-85   
ref|XP_009804916.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    273   3e-85   Nicotiana sylvestris
ref|XP_008377338.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    272   3e-85   Malus domestica [apple tree]
gb|KDO49089.1|  hypothetical protein CISIN_1g0122622mg                  265   4e-85   Citrus sinensis [apfelsine]
ref|XP_011088386.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    271   4e-85   Sesamum indicum [beniseed]
ref|XP_010254870.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      273   4e-85   Nelumbo nucifera [Indian lotus]
ref|XP_009605960.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    271   6e-85   Nicotiana tomentosiformis
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    271   8e-85   Populus euphratica
ref|XP_009364443.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    271   8e-85   Pyrus x bretschneideri [bai li]
ref|XP_011088385.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    272   9e-85   Sesamum indicum [beniseed]
gb|EYU37792.1|  hypothetical protein MIMGU_mgv1a006258mg                270   1e-84   Erythranthe guttata [common monkey flower]
ref|XP_009605959.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    270   2e-84   Nicotiana tomentosiformis
ref|XP_011012794.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      268   2e-84   Populus euphratica
ref|XP_012071831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    268   4e-84   Jatropha curcas
ref|XP_002306099.1|  hypothetical protein POPTR_0004s16120g             266   5e-84   
ref|XP_006375633.1|  hypothetical protein POPTR_0014s18250g             266   6e-84   
ref|XP_002313051.1|  glycosyl hydrolase family 17 family protein        266   8e-84   
ref|XP_012071830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    268   2e-83   Jatropha curcas
gb|KJB32497.1|  hypothetical protein B456_005G243100                    265   2e-83   Gossypium raimondii
ref|XP_006375627.1|  hypothetical protein POPTR_0014s18190g             264   2e-83   
ref|XP_002321266.1|  hypothetical protein POPTR_0014s18060g             264   2e-83   
ref|XP_007201010.1|  hypothetical protein PRUPE_ppa005375mg             267   3e-83   Prunus persica
ref|XP_006423252.1|  hypothetical protein CICLE_v10028372mg             264   4e-83   
ref|XP_007042210.1|  O-Glycosyl hydrolases family 17 protein isof...    266   7e-83   
ref|XP_010530842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      267   7e-83   Tarenaya hassleriana [spider flower]
ref|XP_010065396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    266   7e-83   Eucalyptus grandis [rose gum]
ref|XP_008236880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      266   9e-83   Prunus mume [ume]
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g             265   9e-83   Populus trichocarpa [western balsam poplar]
ref|XP_006375635.1|  hypothetical protein POPTR_0014s18270g             263   9e-83   
gb|KHG11479.1|  hypothetical protein F383_06303                         265   1e-82   Gossypium arboreum [tree cotton]
ref|XP_006379239.1|  hypothetical protein POPTR_0009s11830g             265   1e-82   Populus trichocarpa [western balsam poplar]
ref|XP_012069916.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      265   1e-82   Jatropha curcas
gb|KJB32496.1|  hypothetical protein B456_005G243100                    265   2e-82   Gossypium raimondii
ref|XP_002867117.1|  hypothetical protein ARALYDRAFT_491210             261   2e-82   
ref|XP_002509479.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    265   2e-82   Ricinus communis
ref|XP_002321268.2|  hypothetical protein POPTR_0014s18060g             264   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_007042209.1|  O-Glycosyl hydrolases family 17 protein isof...    266   3e-82   
gb|KJB32499.1|  hypothetical protein B456_005G243100                    265   3e-82   Gossypium raimondii
ref|XP_010447074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    265   3e-82   Camelina sativa [gold-of-pleasure]
gb|AFK46350.1|  unknown                                                 258   3e-82   Medicago truncatula
ref|XP_006423251.1|  hypothetical protein CICLE_v10028372mg             264   4e-82   Citrus clementina [clementine]
ref|XP_004507424.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    263   8e-82   Cicer arietinum [garbanzo]
ref|XP_004499144.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    264   9e-82   Cicer arietinum [garbanzo]
ref|XP_004499143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    265   1e-81   
ref|XP_008466580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      263   1e-81   Cucumis melo [Oriental melon]
gb|AIR93913.1|  glucanase                                               262   1e-81   Cicer arietinum [garbanzo]
ref|XP_007131842.1|  hypothetical protein PHAVU_011G045800g             262   2e-81   Phaseolus vulgaris [French bean]
ref|XP_006581121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    262   2e-81   
ref|XP_004147788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      263   2e-81   Cucumis sativus [cucumbers]
ref|XP_006581120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    262   2e-81   
ref|XP_004299094.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      263   3e-81   Fragaria vesca subsp. vesca
ref|XP_006412222.1|  hypothetical protein EUTSA_v10024968mg             262   5e-81   Eutrema salsugineum [saltwater cress]
ref|XP_006595937.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    259   8e-81   
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      260   8e-81   Pyrus x bretschneideri [bai li]
ref|XP_009374190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    260   9e-81   Pyrus x bretschneideri [bai li]
ref|XP_003544417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    261   1e-80   Glycine max [soybeans]
ref|XP_010444969.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    261   2e-80   
ref|XP_010432409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    261   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    259   3e-80   Malus domestica [apple tree]
ref|XP_007160761.1|  hypothetical protein PHAVU_001G014900g             257   9e-80   Phaseolus vulgaris [French bean]
ref|XP_007160762.1|  hypothetical protein PHAVU_001G014900g             258   1e-79   Phaseolus vulgaris [French bean]
gb|EPS70348.1|  hypothetical protein M569_04409                         257   1e-79   Genlisea aurea
ref|XP_010690895.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    258   2e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003606895.1|  Glucan endo-1,3-beta-glucosidase                   257   2e-79   Medicago truncatula
gb|KFK30062.1|  hypothetical protein AALP_AA7G211800                    257   4e-79   Arabis alpina [alpine rockcress]
ref|XP_010690894.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    258   4e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003522947.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    256   5e-79   Glycine max [soybeans]
gb|ACJ84511.1|  unknown                                                 254   5e-79   Medicago truncatula
ref|XP_003603912.1|  Glucan endo-1,3-beta-glucosidase                   255   1e-78   Medicago truncatula
ref|XP_003603913.1|  Glucan endo-1,3-beta-glucosidase                   255   1e-78   
ref|XP_009123249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      256   2e-78   Brassica rapa
ref|XP_010489192.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    252   3e-78   
ref|XP_004500813.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    253   4e-78   Cicer arietinum [garbanzo]
ref|XP_010107844.1|  Glucan endo-1,3-beta-glucosidase 7                 254   4e-78   
ref|XP_007136171.1|  hypothetical protein PHAVU_009G024000g             253   5e-78   Phaseolus vulgaris [French bean]
gb|AIR93908.1|  glucanase                                               253   5e-78   Cicer arietinum [garbanzo]
ref|XP_010489191.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    251   9e-78   
ref|XP_010467346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      253   2e-77   Camelina sativa [gold-of-pleasure]
gb|EPS59066.1|  hypothetical protein M569_15744                         251   2e-77   Genlisea aurea
emb|CDY26761.1|  BnaC09g08880D                                          252   5e-77   Brassica napus [oilseed rape]
emb|CAN61862.1|  hypothetical protein VITISV_043447                     250   2e-76   Vitis vinifera
ref|XP_010423738.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    251   2e-76   
gb|KEH40122.1|  glucan endo-1,3-beta-glucosidase-like protein           248   3e-76   Medicago truncatula
emb|CDY22386.1|  BnaA06g37080D                                          247   5e-76   Brassica napus [oilseed rape]
dbj|BAE99425.1|  beta-1,3-glucanase-like protein                        241   5e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101841.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      247   6e-76   Brassica rapa
ref|XP_002886212.1|  glycosyl hydrolase family 17 protein               247   1e-75   
gb|KJB34916.1|  hypothetical protein B456_006G090600                    247   1e-75   Gossypium raimondii
ref|XP_009138297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    249   1e-75   Brassica rapa
ref|XP_009138298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    248   1e-75   Brassica rapa
gb|KEH40124.1|  glucan endo-1,3-beta-glucosidase-like protein           248   1e-75   Medicago truncatula
gb|KEH40123.1|  glucan endo-1,3-beta-glucosidase-like protein           248   1e-75   Medicago truncatula
gb|KEH40125.1|  glucan endo-1,3-beta-glucosidase-like protein           247   2e-75   Medicago truncatula
ref|XP_006299612.1|  hypothetical protein CARUB_v10015799mg             248   2e-75   Capsella rubella
gb|AAD22313.1|  putative beta-1,3-glucanase                             246   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280516.1|  hypothetical protein CARUB_v10026453mg             245   3e-75   Capsella rubella
ref|XP_006409465.1|  hypothetical protein EUTSA_v10022641mg             248   4e-75   
ref|NP_179219.4|  O-glycosyl hydrolases family 17 protein               247   5e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148850.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    245   7e-75   Cucumis sativus [cucumbers]
emb|CDX71547.1|  BnaC04g17820D                                          244   7e-75   
ref|XP_008457927.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    244   1e-74   Cucumis melo [Oriental melon]
ref|XP_010481959.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   2e-74   Camelina sativa [gold-of-pleasure]
emb|CAA18827.1|  putative protein (fragment)                            240   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442129.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   2e-74   Camelina sativa [gold-of-pleasure]
sp|Q94G86.1|ALL9_OLEEU  RecName: Full=Glucan endo-1,3-beta-D-gluc...    244   2e-74   Olea europaea
ref|XP_010494214.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   3e-74   Camelina sativa [gold-of-pleasure]
emb|CAB80165.1|  putative protein (fragment)                            240   3e-74   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10628.1|  beta-1,3-glucanase-like protein                        242   5e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31822.1|  hypothetical protein AALP_AA6G162900                    242   6e-74   Arabis alpina [alpine rockcress]
ref|XP_002865493.1|  glycosyl hydrolase family 17 protein               242   7e-74   
ref|NP_199086.2|  glycosyl hydrolase family 17 protein                  241   9e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403361.1|  hypothetical protein EUTSA_v10003213mg             241   1e-73   Eutrema salsugineum [saltwater cress]
emb|CDY45313.1|  BnaA03g52860D                                          249   3e-73   Brassica napus [oilseed rape]
emb|CDX75437.1|  BnaA01g02650D                                          241   6e-73   
emb|CDX72483.1|  BnaC07g45050D                                          248   7e-73   
ref|XP_009112198.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      241   9e-73   Brassica rapa
ref|XP_010519110.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      240   9e-73   Tarenaya hassleriana [spider flower]
ref|NP_195174.6|  glucan endo-1,3-beta-glucosidase 7                    241   1e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69064.1|  BnaC01g03890D                                          240   2e-72   
ref|XP_006375634.1|  hypothetical protein POPTR_0014s18260g             231   1e-70   
ref|XP_006856026.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      234   1e-70   Amborella trichopoda
ref|XP_006434974.1|  hypothetical protein CICLE_v10003630mg             233   3e-70   
ref|XP_009406752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    233   6e-70   
gb|KDO84535.1|  hypothetical protein CISIN_1g040787mg                   231   2e-69   Citrus sinensis [apfelsine]
ref|XP_009407686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942826.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      227   5e-68   Elaeis guineensis
ref|XP_006375618.1|  hypothetical protein POPTR_0014s18040g             223   2e-67   
ref|XP_008783477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      224   8e-67   Phoenix dactylifera
ref|XP_008375942.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    224   2e-66   
gb|AFS50098.1|  glucan endo-1,3-beta-glucosidase                        222   5e-66   Elaeis guineensis
gb|AFK44108.1|  unknown                                                 212   2e-65   Medicago truncatula
ref|XP_009411141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    216   5e-64   
ref|XP_010939269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    214   7e-63   Elaeis guineensis
ref|XP_006651673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    210   1e-62   
gb|AAP44659.1|  putative beta 1,3-glucanase                             212   4e-62   Oryza sativa Japonica Group [Japonica rice]
gb|EAY91326.1|  hypothetical protein OsI_12942                          210   2e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_008681422.1|  PREDICTED: uncharacterized protein LOC100273...    209   6e-61   
ref|XP_008681421.1|  PREDICTED: uncharacterized protein LOC100273...    209   6e-61   
gb|KHN20071.1|  Glucan endo-1,3-beta-glucosidase 7                      201   4e-58   Glycine soja [wild soybean]
ref|XP_002466692.1|  hypothetical protein SORBIDRAFT_01g012380          201   6e-58   
ref|NP_001148381.1|  glucan endo-1,3-beta-glucosidase 7 precursor       200   2e-57   Zea mays [maize]
gb|ADE76367.1|  unknown                                                 198   7e-57   Picea sitchensis
ref|XP_004982217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    199   8e-57   
ref|XP_004982218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    198   1e-56   Setaria italica
ref|XP_009394306.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003561438.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    193   6e-55   Brachypodium distachyon [annual false brome]
gb|ABK24319.1|  unknown                                                 191   5e-54   Picea sitchensis
gb|ABK25242.1|  unknown                                                 188   6e-53   Picea sitchensis
gb|ABK24695.1|  unknown                                                 187   1e-52   Picea sitchensis
dbj|BAJ87172.1|  predicted protein                                      186   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95272.1|  predicted protein                                      184   6e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008785661.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   2e-51   
ref|XP_002466550.1|  hypothetical protein SORBIDRAFT_01g009770          183   2e-51   Sorghum bicolor [broomcorn]
ref|XP_010230690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      182   6e-51   Brachypodium distachyon [annual false brome]
ref|XP_009394779.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   7e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394780.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004986270.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   2e-50   
ref|XP_002456675.1|  hypothetical protein SORBIDRAFT_03g040630          177   2e-49   Sorghum bicolor [broomcorn]
emb|CDM85083.1|  unnamed protein product                                177   3e-49   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001149419.1|  glucan endo-1,3-beta-glucosidase 7 precursor       176   4e-49   
gb|ACF85574.1|  unknown                                                 176   7e-49   Zea mays [maize]
dbj|BAJ98053.1|  predicted protein                                      175   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146374.1|  putative O-glycosyl hydrolase family 17 prot...    174   3e-48   Zea mays [maize]
ref|XP_004970663.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   3e-48   Setaria italica
ref|XP_004970664.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   3e-48   
gb|KJB52394.1|  hypothetical protein B456_008G260000                    172   1e-47   Gossypium raimondii
gb|AAF31288.1|AC006424_17  CDS                                          173   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001044874.1|  Os01g0860800                                       172   1e-47   
gb|KHN33758.1|  Glucan endo-1,3-beta-glucosidase 7                      172   2e-47   Glycine soja [wild soybean]
ref|NP_174563.2|  glucan endo-1,3-beta-glucosidase 11                   172   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|EMS63842.1|  Glucan endo-1,3-beta-glucosidase 14                     174   2e-47   Triticum urartu
ref|XP_011470886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   2e-47   Fragaria vesca subsp. vesca
gb|KJB52393.1|  hypothetical protein B456_008G260000                    172   2e-47   Gossypium raimondii
ref|XP_004309523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   2e-47   Fragaria vesca subsp. vesca
ref|XP_006307574.1|  hypothetical protein CARUB_v10009196mg             172   2e-47   Capsella rubella
gb|EEC71847.1|  hypothetical protein OsI_04517                          172   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_011658156.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        173   3e-47   Cucumis sativus [cucumbers]
ref|XP_010478704.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010461089.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     172   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010499813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010906055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   4e-47   Elaeis guineensis
ref|XP_008457482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        174   5e-47   
gb|ERN16505.1|  hypothetical protein AMTR_s00031p00059420               170   6e-47   Amborella trichopoda
ref|XP_006855038.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     170   6e-47   
ref|XP_002893744.1|  glycosyl hydrolase family 17 protein               171   7e-47   Arabidopsis lyrata subsp. lyrata
gb|ABF94756.1|  Glucan endo-1,3-beta-glucosidase 7 precursor, put...    171   8e-47   Oryza sativa Japonica Group [Japonica rice]
gb|KEH42913.1|  glucan endo-1,3-beta-glucosidase                        170   1e-46   Medicago truncatula
ref|XP_011081364.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     170   1e-46   Sesamum indicum [beniseed]
gb|KJB39530.1|  hypothetical protein B456_007G018900                    170   2e-46   Gossypium raimondii
gb|KJB39529.1|  hypothetical protein B456_007G018900                    169   2e-46   Gossypium raimondii
ref|XP_007163933.1|  hypothetical protein PHAVU_L004500g                169   2e-46   Phaseolus vulgaris [French bean]
ref|XP_009114852.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     169   2e-46   Brassica rapa
ref|XP_012075958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-46   Jatropha curcas
ref|XP_011070401.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   3e-46   Sesamum indicum [beniseed]
gb|KHG16903.1|  hypothetical protein F383_04540                         169   3e-46   Gossypium arboreum [tree cotton]
gb|AFW67776.1|  putative O-glycosyl hydrolase family 17 protein         168   3e-46   
ref|XP_012075957.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   4e-46   Jatropha curcas
emb|CDX93815.1|  BnaA09g24150D                                          169   4e-46   
emb|CDY69080.1|  BnaCnng61800D                                          169   4e-46   Brassica napus [oilseed rape]
ref|XP_007039346.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 4      168   4e-46   
ref|XP_010267530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        169   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_007039348.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 6      168   4e-46   
ref|XP_008800671.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   4e-46   Phoenix dactylifera
gb|AFW67777.1|  putative O-glycosyl hydrolase family 17 protein         169   4e-46   
gb|ADW08741.1|  1,3-beta-D-glucanase GH17_33                            169   4e-46   Populus tremula x Populus tremuloides
ref|XP_007039344.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 2      169   5e-46   
ref|XP_006645060.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   5e-46   Oryza brachyantha
ref|NP_001147326.1|  LOC100280934 precursor                             169   5e-46   Zea mays [maize]
ref|XP_007039345.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 3      168   6e-46   
emb|CDP12246.1|  unnamed protein product                                169   6e-46   Coffea canephora [robusta coffee]
ref|XP_006415143.1|  hypothetical protein EUTSA_v10007671mg             169   6e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010662898.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        169   6e-46   Vitis vinifera
ref|XP_011038000.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   6e-46   Populus euphratica
ref|XP_011037999.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   6e-46   Populus euphratica
ref|XP_002300505.2|  hypothetical protein POPTR_0001s45320g             168   8e-46   Populus trichocarpa [western balsam poplar]
ref|XP_006589232.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   8e-46   Glycine max [soybeans]
ref|XP_007039343.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 1      168   8e-46   
ref|XP_006589233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   8e-46   Glycine max [soybeans]
ref|XP_003536170.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   8e-46   Glycine max [soybeans]
ref|NP_001150853.1|  glucan endo-1,3-beta-glucosidase 7 precursor       169   8e-46   Zea mays [maize]
ref|XP_004495513.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   1e-45   
ref|XP_010232596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   1e-45   
gb|KHN14763.1|  Glucan endo-1,3-beta-glucosidase 11                     168   1e-45   Glycine soja [wild soybean]
gb|AHC69782.1|  1,3-beta glucanase                                      167   1e-45   Quercus suber [cork oak]
gb|AIR93906.1|  glucanase                                               168   1e-45   Cicer arietinum [garbanzo]
ref|XP_003564669.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   1e-45   Brachypodium distachyon [annual false brome]
ref|XP_007016412.1|  O-Glycosyl hydrolases family 17 protein isof...    168   1e-45   
ref|XP_006837841.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     167   1e-45   
ref|XP_009347789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_007137073.1|  hypothetical protein PHAVU_009G097400g             167   1e-45   Phaseolus vulgaris [French bean]
ref|XP_002468213.1|  hypothetical protein SORBIDRAFT_01g041880          167   2e-45   Sorghum bicolor [broomcorn]
gb|KHF99783.1|  Glucan endo-1,3-beta-glucosidase                        169   2e-45   Gossypium arboreum [tree cotton]
gb|ERN00410.1|  hypothetical protein AMTR_s00100p00040750               167   2e-45   Amborella trichopoda
ref|XP_002275642.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     167   2e-45   Vitis vinifera
ref|XP_010676930.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     167   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002317055.2|  glycosyl hydrolase family 17 family protein        166   2e-45   
ref|XP_002532848.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    168   3e-45   Ricinus communis
gb|EEE59830.1|  hypothetical protein OsJ_12394                          167   4e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009347788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   4e-45   Pyrus x bretschneideri [bai li]
ref|XP_007016411.1|  O-Glycosyl hydrolases family 17 protein isof...    168   4e-45   
ref|NP_001050864.2|  Os03g0669300                                       160   5e-45   
ref|XP_009360206.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   5e-45   
ref|XP_010034118.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        167   5e-45   
ref|XP_012086629.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   5e-45   
ref|NP_001051111.1|  Os03g0722500                                       166   6e-45   
gb|EEC74801.1|  hypothetical protein OsI_10603                          166   6e-45   
ref|XP_008802734.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        166   6e-45   
gb|KFK45032.1|  hypothetical protein AALP_AA1G335200                    166   6e-45   
emb|CAN80621.1|  hypothetical protein VITISV_043431                     166   6e-45   
gb|AAN60993.1|  Putative glycosyl hydrolase                             166   7e-45   
ref|XP_009622831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     166   7e-45   
ref|XP_006649666.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   8e-45   
ref|XP_006439198.1|  hypothetical protein CICLE_v10020391mg             165   8e-45   
ref|XP_008245888.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   1e-44   
ref|XP_008392643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   1e-44   
ref|XP_007209175.1|  hypothetical protein PRUPE_ppa006239mg             165   1e-44   
gb|KHN16491.1|  Glucan endo-1,3-beta-glucosidase                        164   1e-44   
ref|XP_007209174.1|  hypothetical protein PRUPE_ppa006239mg             165   1e-44   
gb|ADW08745.1|  1,3-beta-D-glucanase GH17_65                            164   1e-44   
ref|XP_008392645.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   2e-44   
ref|XP_008392644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   2e-44   
gb|ERM95173.1|  hypothetical protein AMTR_s00009p00263650               165   2e-44   
gb|KHG22731.1|  Glucan endo-1,3-beta-glucosidase                        165   2e-44   
ref|XP_002518930.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    164   2e-44   
ref|XP_010264453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        165   2e-44   
ref|XP_010100224.1|  Glucan endo-1,3-beta-glucosidase 11                164   2e-44   
ref|XP_002298356.1|  glycosyl hydrolase family 17 family protein        165   2e-44   
ref|XP_006827757.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        165   2e-44   
gb|KJB83778.1|  hypothetical protein B456_013G263800                    166   2e-44   
ref|XP_009778930.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     164   2e-44   
ref|XP_002961999.1|  hypothetical protein SELMODRAFT_76182              162   3e-44   
ref|XP_008811870.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   3e-44   
gb|KJB37375.1|  hypothetical protein B456_006G202300                    166   3e-44   
ref|XP_011035318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    166   3e-44   
ref|XP_010421259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    164   3e-44   
ref|XP_004978982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   3e-44   
ref|XP_008352157.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    164   3e-44   
ref|XP_010421258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    164   4e-44   
ref|XP_002962313.1|  hypothetical protein SELMODRAFT_438073             165   4e-44   
ref|XP_009386567.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   4e-44   
ref|XP_008374135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   4e-44   
ref|XP_008357534.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   4e-44   
ref|XP_008357533.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   4e-44   
ref|XP_006287713.1|  hypothetical protein CARUB_v10000922mg             164   5e-44   
ref|XP_010252096.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     163   5e-44   
ref|XP_004505326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    165   5e-44   
ref|XP_004505325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    164   5e-44   
ref|XP_002283647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        164   6e-44   
ref|XP_010922329.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    164   6e-44   
ref|XP_008343598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    161   6e-44   
gb|KDO76771.1|  hypothetical protein CISIN_1g015263mg                   163   7e-44   
gb|KDO76773.1|  hypothetical protein CISIN_1g015263mg                   162   7e-44   
ref|NP_001119271.1|  O-Glycosyl hydrolases family 17 protein            164   7e-44   
ref|XP_008357531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   8e-44   
gb|ERN17158.1|  hypothetical protein AMTR_s00044p00136160               159   8e-44   
ref|XP_008357532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   8e-44   
emb|CDX87130.1|  BnaC09g04450D                                          164   8e-44   
ref|XP_002874188.1|  hydrolase, hydrolyzing O-glycosyl compounds        163   8e-44   
ref|NP_001031936.1|  O-Glycosyl hydrolases family 17 protein            163   9e-44   
ref|XP_011040600.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   9e-44   
ref|XP_010917973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   9e-44   
ref|XP_008233624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    164   9e-44   
gb|KJB24128.1|  hypothetical protein B456_004G128800                    162   1e-43   
ref|XP_004498531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    161   1e-43   
gb|KJB24129.1|  hypothetical protein B456_004G128800                    162   1e-43   
ref|XP_008437641.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        164   1e-43   
gb|KJB24130.1|  hypothetical protein B456_004G128800                    162   1e-43   
emb|CDP21469.1|  unnamed protein product                                163   1e-43   
ref|XP_009344064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   1e-43   
ref|XP_009344063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   1e-43   
dbj|BAJ99921.1|  predicted protein                                      162   1e-43   
gb|EYU40695.1|  hypothetical protein MIMGU_mgv1a004780mg                164   2e-43   
ref|XP_008810606.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        160   2e-43   
ref|XP_006846179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        163   2e-43   
ref|XP_010542063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     162   2e-43   
ref|XP_010940845.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   2e-43   
ref|XP_010940844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   2e-43   
ref|XP_006476269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   2e-43   
gb|EMT19236.1|  Glucan endo-1,3-beta-glucosidase 14                     160   2e-43   
ref|XP_011654593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   2e-43   
gb|KFK27709.1|  hypothetical protein AALP_AA8G419000                    162   3e-43   
ref|XP_008391122.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     161   3e-43   
ref|XP_010940843.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   3e-43   
pir||S31196  hypothetical protein - potato                              161   3e-43   
ref|XP_003575072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     160   3e-43   
gb|KCW85568.1|  hypothetical protein EUGRSUZ_B02365                     159   4e-43   
ref|XP_011015294.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    162   4e-43   
gb|AFU52665.1|  putative PD beta-1,3-glucanase 1                        161   4e-43   
ref|XP_010043554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    159   5e-43   
ref|XP_004978983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   5e-43   
ref|NP_001275601.1|  glucan endo-1,3-beta-glucosidase 11-like pre...    160   5e-43   
gb|ABR18393.1|  unknown                                                 160   5e-43   
ref|XP_002971087.1|  hypothetical protein SELMODRAFT_95153              158   5e-43   
ref|XP_010905996.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   6e-43   
ref|XP_002965231.1|  hypothetical protein SELMODRAFT_439107             162   6e-43   
ref|XP_002452203.1|  hypothetical protein SORBIDRAFT_04g021700          160   6e-43   
ref|XP_006473828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   6e-43   
ref|XP_010905995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   6e-43   
ref|XP_010937626.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    161   7e-43   
gb|EPS63364.1|  glycoside hydrolase                                     160   7e-43   
gb|EAY94033.1|  hypothetical protein OsI_15811                          159   7e-43   
ref|XP_004975562.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   7e-43   
ref|XP_010538537.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   7e-43   
ref|XP_010538536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   7e-43   
gb|ABR18134.1|  unknown                                                 160   7e-43   
gb|KHG03350.1|  hypothetical protein F383_28168                         159   8e-43   
emb|CDY19838.1|  BnaA09g04910D                                          161   8e-43   
ref|XP_009357726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        161   8e-43   
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    160   8e-43   
ref|XP_009111627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        161   9e-43   
ref|XP_008775290.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     160   1e-42   
ref|XP_011654675.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     159   1e-42   
gb|KDO85165.1|  hypothetical protein CISIN_1g011390mg                   160   1e-42   
ref|XP_010056028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   1e-42   
ref|XP_011654592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   1e-42   
ref|XP_010043553.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    159   1e-42   
ref|XP_007039107.1|  O-Glycosyl hydrolases family 17 protein            160   1e-42   
ref|XP_008437454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     159   1e-42   
dbj|BAJ91903.1|  predicted protein                                      159   1e-42   
gb|EEE58635.1|  hypothetical protein OsJ_10001                          159   1e-42   
dbj|BAK02637.1|  predicted protein                                      159   2e-42   
emb|CAH67163.1|  H0717B12.10                                            159   2e-42   
ref|NP_001052739.1|  Os04g0412300                                       159   2e-42   
ref|XP_006350517.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    159   2e-42   
emb|CAD40655.2|  OSJNBa0073L04.8                                        159   2e-42   
gb|EAZ30671.1|  hypothetical protein OsJ_14727                          159   2e-42   
gb|KCW72601.1|  hypothetical protein EUGRSUZ_E01067                     159   2e-42   
gb|KCW85570.1|  hypothetical protein EUGRSUZ_B02367                     160   2e-42   
gb|KCW72602.1|  hypothetical protein EUGRSUZ_E01067                     159   2e-42   
ref|XP_010493578.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        160   2e-42   
ref|XP_010519454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   2e-42   
ref|XP_010318035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        158   2e-42   
ref|XP_010106478.1|  Glucan endo-1,3-beta-glucosidase                   160   2e-42   
gb|KDO72847.1|  hypothetical protein CISIN_1g0375832mg                  159   2e-42   
ref|XP_010043555.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    160   2e-42   
ref|XP_009799239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    158   2e-42   
ref|XP_006488330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    160   2e-42   
ref|XP_006424832.1|  hypothetical protein CICLE_v10028241mg             160   2e-42   
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g             159   3e-42   
gb|EAY86149.1|  hypothetical protein OsI_07522                          158   3e-42   
ref|XP_004295910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    160   3e-42   
gb|EEC79302.1|  hypothetical protein OsI_20133                          158   3e-42   
ref|XP_009592800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   3e-42   
ref|XP_008342287.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    157   3e-42   
ref|XP_010519453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   3e-42   
ref|XP_006652263.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   3e-42   
ref|XP_004245446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   4e-42   
gb|EMT19757.1|  Glucan endo-1,3-beta-glucosidase 7                      159   4e-42   
gb|EPS68882.1|  hypothetical protein M569_05882                         157   4e-42   
emb|CDM83794.1|  unnamed protein product                                157   4e-42   
tpg|DAA37914.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    158   4e-42   
ref|XP_012084583.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     157   4e-42   
ref|XP_010244978.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     157   4e-42   
ref|XP_008804844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     157   4e-42   
ref|XP_006855690.2|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      159   4e-42   
tpg|DAA37913.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    158   5e-42   
ref|XP_002530863.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    159   5e-42   
ref|XP_009382024.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   5e-42   
gb|EYU35619.1|  hypothetical protein MIMGU_mgv1a006967mg                158   6e-42   
ref|NP_001131225.1|  uncharacterized protein LOC100192534 precursor     157   7e-42   
ref|XP_006360726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   7e-42   
ref|XP_010925705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   7e-42   
ref|XP_006486487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    158   7e-42   
ref|XP_006435532.1|  hypothetical protein CICLE_v10033472mg             158   7e-42   
gb|ACG28556.1|  glucan endo-1,3-beta-glucosidase 7 precursor            157   7e-42   
ref|XP_010925707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   7e-42   
ref|XP_010228925.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   7e-42   
ref|NP_001047027.1|  Os02g0532900                                       157   8e-42   
dbj|BAD54223.1|  putative beta-1,3-glucanase precursor                  157   8e-42   
emb|CDY04498.1|  BnaA07g13240D                                          157   8e-42   
ref|XP_008362701.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    158   9e-42   
ref|XP_004252615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   9e-42   
gb|ABR16583.1|  unknown                                                 157   9e-42   
ref|XP_003561857.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   1e-41   
gb|ACM45718.1|  endo-1,3-beta-glucanase                                 157   1e-41   
ref|XP_008382814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   1e-41   
ref|XP_006409773.1|  hypothetical protein EUTSA_v10016756mg             156   1e-41   
ref|XP_009357725.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    156   1e-41   
ref|XP_009385095.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   1e-41   
ref|XP_002278950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     156   1e-41   
ref|XP_006409774.1|  hypothetical protein EUTSA_v10016756mg             156   1e-41   
ref|XP_006394688.1|  hypothetical protein EUTSA_v10004182mg             157   1e-41   
gb|EMT29265.1|  Glucan endo-1,3-beta-glucosidase 14                     157   2e-41   
ref|XP_010909020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   2e-41   
ref|XP_006441150.1|  hypothetical protein CICLE_v10020075mg             157   2e-41   
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    157   2e-41   
ref|XP_010671896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        155   2e-41   
ref|XP_010109237.1|  Glucan endo-1,3-beta-glucosidase                   157   2e-41   
ref|XP_009357727.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    157   2e-41   
gb|EEC80746.1|  hypothetical protein OsI_23229                          156   3e-41   
gb|ACG35188.1|  glucan endo-1,3-beta-glucosidase GVI precursor          154   3e-41   
ref|XP_008654818.1|  PREDICTED: putative O-Glycosyl hydrolase sup...    154   3e-41   
ref|XP_011025078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    157   3e-41   
ref|XP_006647341.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   3e-41   
ref|XP_009772777.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   3e-41   
gb|EEE65821.1|  hypothetical protein OsJ_21560                          156   3e-41   
ref|NP_001057782.1|  Os06g0531000                                       156   3e-41   
gb|EEC83592.1|  hypothetical protein OsI_29271                          156   3e-41   
ref|NP_001049543.1|  Os03g0246100                                       156   3e-41   
ref|XP_002446413.1|  hypothetical protein SORBIDRAFT_06g015590          155   3e-41   
gb|KJB19861.1|  hypothetical protein B456_003G121900                    155   4e-41   
ref|XP_002462967.1|  hypothetical protein SORBIDRAFT_02g035480          157   4e-41   
emb|CDX76097.1|  BnaA04g03610D                                          156   4e-41   
ref|XP_010535497.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        154   5e-41   
gb|EMT06316.1|  Glucan endo-1,3-beta-glucosidase 14                     157   5e-41   
ref|XP_002526252.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    156   5e-41   
ref|XP_009586622.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    154   5e-41   
emb|CDY02936.1|  BnaC04g25500D                                          156   5e-41   
ref|XP_008382813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   5e-41   
dbj|BAB40807.1|  endo-1,3-beta-glucanase-like protein                   155   6e-41   
ref|XP_003588492.1|  Glucan endo-1,3-beta-glucosidase                   154   6e-41   
ref|XP_010553580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 10     155   6e-41   
ref|XP_008371690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    155   6e-41   
gb|EMT11727.1|  Glucan endo-1,3-beta-glucosidase 10                     156   6e-41   
ref|XP_002441180.1|  hypothetical protein SORBIDRAFT_09g021800          155   7e-41   
gb|EMT11580.1|  Glucan endo-1,3-beta-glucosidase                        156   8e-41   
ref|XP_006491986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    155   9e-41   
ref|XP_004964440.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   9e-41   
ref|XP_004952644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   9e-41   
emb|CDX83270.1|  BnaA03g22360D                                          154   9e-41   
ref|XP_010256938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    155   9e-41   
gb|EMS50259.1|  Glucan endo-1,3-beta-glucosidase 14                     155   9e-41   
gb|EPS61461.1|  hypothetical protein M569_13335                         153   1e-40   



>ref|XP_009758632.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Nicotiana sylvestris]
Length=462

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +++SFIG+NYGQ+A+NLPAPEATAKLLQSTSIEKVRLYG+DP +IKALANTG+GIMIGVA
Sbjct  23   ESESFIGINYGQIADNLPAPEATAKLLQSTSIEKVRLYGSDPVIIKALANTGVGIMIGVA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP MA+DP +AK W+ + VL FYPASKI+ INVGNE++ S D+NL+T LLPAMQNLQ
Sbjct  83   NGDIPPMASDPNFAKGWLSSKVLPFYPASKIIVINVGNEVMLSKDQNLMTNLLPAMQNLQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M++L  SEPPSSG FDP+ITD LK LL F  ATG+PF +NP
Sbjct  143  NALNDASIGGKIKVSTVHAMAVLKQSEPPSSGSFDPSITDLLKGLLEFNKATGSPFAVNP  202

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  203  YPYFAYQ  209



>ref|XP_009758633.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Nicotiana sylvestris]
Length=437

 Score =   296 bits (758),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +++SFIG+NYGQ+A+NLPAPEATAKLLQSTSIEKVRLYG+DP +IKALANTG+GIMIGVA
Sbjct  23   ESESFIGINYGQIADNLPAPEATAKLLQSTSIEKVRLYGSDPVIIKALANTGVGIMIGVA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP MA+DP +AK W+ + VL FYPASKI+ INVGNE++ S D+NL+T LLPAMQNLQ
Sbjct  83   NGDIPPMASDPNFAKGWLSSKVLPFYPASKIIVINVGNEVMLSKDQNLMTNLLPAMQNLQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M++L  SEPPSSG FDP+ITD LK LL F  ATG+PF +NP
Sbjct  143  NALNDASIGGKIKVSTVHAMAVLKQSEPPSSGSFDPSITDLLKGLLEFNKATGSPFAVNP  202

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  203  YPYFAYQ  209



>emb|CDP07525.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIG+NYGQVA+NLP+P+ATAK+LQSTSIEKVRLYGADPA+IKA ANTGIGIMIGV+N
Sbjct  24   SESFIGINYGQVADNLPSPDATAKMLQSTSIEKVRLYGADPAIIKAFANTGIGIMIGVSN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPAMA DP +AK+W+ +NV  FYPASKI+ IN+GNE+L SGDRNL+TQLLPAMQNLQN
Sbjct  84   GDIPAMATDPSFAKNWVNSNVSPFYPASKIVHINIGNEVLLSGDRNLMTQLLPAMQNLQN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALNSAS+ GKIKVSTVH M++L  S+PPSSG FDP+  D +K LL F +ATG+P +INPY
Sbjct  144  ALNSASLNGKIKVSTVHSMAVLRQSDPPSSGGFDPSFGDLMKGLLEFNNATGSPLVINPY  203

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  204  PFFAYQ  209



>ref|XP_006341928.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Solanum tuberosum]
Length=441

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYGQVA+NLPAPEATAKLLQSTSI+KVRLYG+DPA+IKALANTGIGIMIGVAN
Sbjct  25   SQSFIGINYGQVADNLPAPEATAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIMIGVAN  84

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP MA+DP +AK W+ +NVL FYPAS+I+ INVGNE++ S D+NL+T LLPAMQNLQ 
Sbjct  85   GDIPPMASDPNFAKGWLSSNVLPFYPASEIIVINVGNEVMSSNDQNLMTNLLPAMQNLQK  144

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN  S+GGKIKVSTVH M+++  S+PPSSG FDP I D LK LL F  ATG+PF INPY
Sbjct  145  ALNDVSIGGKIKVSTVHSMAVMKQSDPPSSGSFDPNIGDLLKGLLEFNKATGSPFAINPY  204

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  205  PFFAYQ  210



>ref|XP_004238250.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Solanum lycopersicum]
Length=471

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYGQVA+NLPAPEATAKLLQSTSI+KVRLYG+DPA+IKALANTGIGIMIGVAN
Sbjct  55   SQSFIGINYGQVADNLPAPEATAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIMIGVAN  114

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPAMA+DP +AK W+ +NVL FYPAS+I+ INVGNE++ S D+NL+T LLPAMQNL+ 
Sbjct  115  GDIPAMASDPNFAKGWLSSNVLPFYPASEIIVINVGNEVMSSNDQNLMTNLLPAMQNLRK  174

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN  S+GGKIKVSTVH M+++  S+PPSSG FDP I D LK LL F  ATG+PF INPY
Sbjct  175  ALNDVSIGGKIKVSTVHSMAVMKQSDPPSSGSFDPNIGDLLKGLLEFNKATGSPFAINPY  234

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  235  PFFAYQ  240



>ref|XP_003631648.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Vitis vinifera]
 emb|CBI32582.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   287 bits (734),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIG+NYGQVANNLP PEATAKLL+STSIEKVRLYGADP +IKALANTGIGI+IG A
Sbjct  54   DSQSFIGINYGQVANNLPPPEATAKLLKSTSIEKVRLYGADPGIIKALANTGIGIVIGAA  113

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP +A  W+ +NV+A+YPASKI+ I VGNE++ S D+NL++QLLPAMQN+Q
Sbjct  114  NGDIPALASDPNFAAQWVNSNVIAYYPASKIILITVGNEVMSSTDQNLMSQLLPAMQNVQ  173

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GGKIKVSTVH M++L  S+PPSSG F+PA +D+++ LL F   TG+PF INP
Sbjct  174  NALNAASLGGKIKVSTVHSMAVLTQSDPPSSGAFNPATSDTMRGLLEFQRNTGSPFAINP  233

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  234  YPFFAYQ  240



>gb|EYU45144.1| hypothetical protein MIMGU_mgv1a006001mg [Erythranthe guttata]
Length=461

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP PEATAKLLQST+IEKVRLYG+DPA+IKA ANTGIGI IGV+N
Sbjct  22   SQSFIGVNYGQVADNLPPPEATAKLLQSTAIEKVRLYGSDPAVIKAFANTGIGIAIGVSN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             DIPAMAADP +AK+WIGANV  F+PASKI+ INVGNE++   DRNL+ QLLPAMQNLQN
Sbjct  82   SDIPAMAADPNFAKNWIGANVAPFHPASKIILINVGNEVMSYNDRNLMAQLLPAMQNLQN  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+SA +GGKIKVSTVH M++L  S+PPSSG FDP+I D LK LL F  ATG+PF INPY
Sbjct  142  ALDSADLGGKIKVSTVHSMAVLRQSDPPSSGSFDPSIGDLLKGLLGFNKATGSPFAINPY  201

Query  653  PFFAFQ  670
            P+FA++
Sbjct  202  PYFAYR  207



>gb|KJB58293.1| hypothetical protein B456_009G202900 [Gossypium raimondii]
Length=472

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP+P ATAKLLQSTSI+KVRLYG+D AMIKALANTGIGI+IG AN
Sbjct  24   SQSFIGVNYGQVADNLPSPAATAKLLQSTSIQKVRLYGSDAAMIKALANTGIGIVIGTAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +AK+W+  NV+A+YPASKI+ INVGNE++ SGD NLI+QLLPAMQN++N
Sbjct  84   GDIPALASDPNFAKNWVDTNVVAYYPASKIILINVGNEVIMSGDNNLISQLLPAMQNVKN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++AS+G K+KVSTVH M++L  SEPPSSG FDPA  D LK +L+F +ATG+PF INPY
Sbjct  144  ALDAASLGDKVKVSTVHSMTLLKQSEPPSSGSFDPAYGDMLKGVLAFNNATGSPFAINPY  203

Query  653  PFFAFQ  670
            PFFA++
Sbjct  204  PFFAYR  209



>gb|KJB58294.1| hypothetical protein B456_009G202900 [Gossypium raimondii]
Length=491

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP+P ATAKLLQSTSI+KVRLYG+D AMIKALANTGIGI+IG AN
Sbjct  24   SQSFIGVNYGQVADNLPSPAATAKLLQSTSIQKVRLYGSDAAMIKALANTGIGIVIGTAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +AK+W+  NV+A+YPASKI+ INVGNE++ SGD NLI+QLLPAMQN++N
Sbjct  84   GDIPALASDPNFAKNWVDTNVVAYYPASKIILINVGNEVIMSGDNNLISQLLPAMQNVKN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++AS+G K+KVSTVH M++L  SEPPSSG FDPA  D LK +L+F +ATG+PF INPY
Sbjct  144  ALDAASLGDKVKVSTVHSMTLLKQSEPPSSGSFDPAYGDMLKGVLAFNNATGSPFAINPY  203

Query  653  PFFAFQ  670
            PFFA++
Sbjct  204  PFFAYR  209



>ref|XP_002282736.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Vitis 
vinifera]
 emb|CBI19687.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIG+NYGQVA+NLP P ATAKLLQSTSIEKVRLYGADPA+IKALANTGIGI+IG AN
Sbjct  24   SESFIGINYGQVADNLPPPSATAKLLQSTSIEKVRLYGADPAIIKALANTGIGIVIGTAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+PA+A+DP +A++WI +NVL +YP+SKI+ I VGNE++ SGD+NL+TQLLPAMQNLQN
Sbjct  84   GDVPALASDPNFARNWINSNVLPYYPSSKIILITVGNEVMTSGDQNLMTQLLPAMQNLQN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN AS+GG IKVSTVH M++L  SEPPSSG FDP+  D +K LL F  ATG+PF INPY
Sbjct  144  ALNGASLGGMIKVSTVHSMAVLKQSEPPSSGSFDPSFGDLMKGLLGFNKATGSPFAINPY  203

Query  653  PFFAFQ  670
            P+FA++
Sbjct  204  PYFAYR  209



>ref|XP_007017516.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 3 
[Theobroma cacao]
 gb|EOY14741.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 3 
[Theobroma cacao]
Length=465

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP+P ATAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG AN
Sbjct  24   SQSFIGVNYGQVADNLPSPAATAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +AK+W+ AN++A+YP+SKI+ INVGNE++ SGD NLI+QLLPAMQN++N
Sbjct  84   GDIPALASDPNFAKTWVNANIVAYYPSSKIILINVGNEVIMSGDNNLISQLLPAMQNVKN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++AS+G K+KVSTVH M++L  SEPPSSG FDP+  D LK LL+F +A G+PF INPY
Sbjct  144  ALDAASLGDKVKVSTVHSMALLKQSEPPSSGCFDPSFGDVLKGLLAFNNANGSPFAINPY  203

Query  653  PFFAFQ  670
            P+FA++
Sbjct  204  PYFAYR  209



>ref|XP_007017514.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 1 
[Theobroma cacao]
 gb|EOY14739.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 1 
[Theobroma cacao]
Length=464

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP+P ATAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG AN
Sbjct  24   SQSFIGVNYGQVADNLPSPAATAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +AK+W+ AN++A+YP+SKI+ INVGNE++ SGD NLI+QLLPAMQN++N
Sbjct  84   GDIPALASDPNFAKTWVNANIVAYYPSSKIILINVGNEVIMSGDNNLISQLLPAMQNVKN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++AS+G K+KVSTVH M++L  SEPPSSG FDP+  D LK LL+F +A G+PF INPY
Sbjct  144  ALDAASLGDKVKVSTVHSMALLKQSEPPSSGCFDPSFGDVLKGLLAFNNANGSPFAINPY  203

Query  653  PFFAFQ  670
            P+FA++
Sbjct  204  PYFAYR  209



>ref|XP_010664681.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Vitis 
vinifera]
Length=500

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIG+NYGQVA+NLP P ATAKLLQSTSIEKVRLYGADPA+IKALANTGIGI+IG AN
Sbjct  24   SESFIGINYGQVADNLPPPSATAKLLQSTSIEKVRLYGADPAIIKALANTGIGIVIGTAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+PA+A+DP +A++WI +NVL +YP+SKI+ I VGNE++ SGD+NL+TQLLPAMQNLQN
Sbjct  84   GDVPALASDPNFARNWINSNVLPYYPSSKIILITVGNEVMTSGDQNLMTQLLPAMQNLQN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN AS+GG IKVSTVH M++L  SEPPSSG FDP+  D +K LL F  ATG+PF INPY
Sbjct  144  ALNGASLGGMIKVSTVHSMAVLKQSEPPSSGSFDPSFGDLMKGLLGFNKATGSPFAINPY  203

Query  653  PFFAFQ  670
            P+FA++
Sbjct  204  PYFAYR  209



>ref|XP_010263687.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Nelumbo nucifera]
Length=465

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P ATAKLLQSTSI KVRLYGADPA+IKALANTGIGI IG A
Sbjct  24   NSQSFIGVNYGQVADNLPPPAATAKLLQSTSIGKVRLYGADPAIIKALANTGIGIAIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AK WIG+NVL +YPAS I+ INVGNE++ SGD+NLI++LLPAMQN+Q
Sbjct  84   NGDIPPLASDPNFAKQWIGSNVLPYYPASNIIVINVGNEVMTSGDQNLISKLLPAMQNMQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL +A++GGK+KVSTVH M++L  SEPPSSG F P   D+LK +L F+  TG+PF INP
Sbjct  144  NALEAATLGGKVKVSTVHSMAVLRQSEPPSSGMFHPQYVDTLKAMLGFLKDTGSPFTINP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_006386924.1| hypothetical protein POPTR_0002s26290g [Populus trichocarpa]
 gb|ERP64721.1| hypothetical protein POPTR_0002s26290g [Populus trichocarpa]
Length=463

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P ATAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG A
Sbjct  24   NSQSFIGVNYGQVADNLPPPSATAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP +AK+WI  NVL FYPASKI+ INVGNE++ SGD+NL+ +LLPAMQN+Q
Sbjct  84   NGDIPALASDPSFAKNWINTNVLPFYPASKIILINVGNEVMTSGDQNLMNKLLPAMQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN  S+GG+IKVSTVH M +L  SEPPSSG FDP+  D +K LL F +AT +PF INP
Sbjct  144  NALNDVSLGGEIKVSTVHSMGVLKQSEPPSSGSFDPSYEDLMKGLLGFNNATASPFAINP  203

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  204  YPYFAYR  210



>ref|XP_009365605.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Pyrus x bretschneideri]
Length=483

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            + QSFIGVNYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANTG+GI+IG A
Sbjct  20   NCQSFIGVNYGQVADNLPPPSSTAKLLQSTSIQKVRLYGSDPAIIKALANTGVGIVIGAA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSW+GANV  FYPAS I+ I VGNE+L SG++ LI+QL+PA+QN+Q
Sbjct  80   NGDIPGLASDPSFAKSWVGANVSPFYPASNIILITVGNEVLTSGEQGLISQLVPAIQNVQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALNSAS+GGKIKVSTVH M++L  SEPPSSG FDP   D +K LL F +ATG+PF INP
Sbjct  140  NALNSASLGGKIKVSTVHSMAVLKQSEPPSSGSFDPGFGDVMKGLLGFNNATGSPFAINP  199

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  200  YPYFAYR  206



>ref|XP_011024410.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Populus euphratica]
Length=510

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P ATAKLLQSTSI+K RLYG+DPA+IKALANTGIGI+IG A
Sbjct  71   NSQSFIGVNYGQVADNLPPPSATAKLLQSTSIQKFRLYGSDPAIIKALANTGIGIVIGTA  130

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP +AK+WI  NVL FYPASKI+ INVGNE++ SGD+NL+ +LLPAMQ +Q
Sbjct  131  NGDIPALASDPSFAKNWISTNVLPFYPASKIILINVGNEVMTSGDQNLMNKLLPAMQKVQ  190

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN  S+GG+IKVSTVH M +L  SEPPSSGRFDP+  D +K LL F +AT +PF INP
Sbjct  191  NALNDVSLGGEIKVSTVHSMGVLKQSEPPSSGRFDPSYEDLMKGLLGFNNATASPFAINP  250

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  251  YPYFAYR  257



>ref|XP_010060941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW67839.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=480

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P ATAKLLQSTSIEKVRLYG DPA+I ALANTGIGI+IG A
Sbjct  23   NSQSFIGVNYGQVADNLPQPSATAKLLQSTSIEKVRLYGTDPAIIGALANTGIGIVIGAA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A DP +AK+W+ ANV+ FYP+SKI+ I VGNE++ SGD NL+TQLLPAMQN+Q
Sbjct  83   NGDIPALANDPNFAKNWVNANVVPFYPSSKIILITVGNEVMTSGDHNLMTQLLPAMQNMQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+ S+GGKIKVS+VH M++L SSEPPSSG FDP  +D +K +L F +ATG+PF INP
Sbjct  143  NALNAVSLGGKIKVSSVHSMAVLKSSEPPSSGSFDP--SDEMKGILGFNNATGSPFAINP  200

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  201  YPYFAYR  207



>ref|XP_010060942.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 isoform X2 [Eucalyptus 
grandis]
 gb|KCW67837.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=474

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P ATAKLLQSTSIEKVRLYG DPA+I ALANTGIGI+IG A
Sbjct  23   NSQSFIGVNYGQVADNLPQPSATAKLLQSTSIEKVRLYGTDPAIIGALANTGIGIVIGAA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A DP +AK+W+ ANV+ FYP+SKI+ I VGNE++ SGD NL+TQLLPAMQN+Q
Sbjct  83   NGDIPALANDPNFAKNWVNANVVPFYPSSKIILITVGNEVMTSGDHNLMTQLLPAMQNMQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+ S+GGKIKVS+VH M++L SSEPPSSG FDP  +D +K +L F +ATG+PF INP
Sbjct  143  NALNAVSLGGKIKVSSVHSMAVLKSSEPPSSGSFDP--SDEMKGILGFNNATGSPFAINP  200

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  201  YPYFAYR  207



>ref|XP_008377425.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Malus domestica]
Length=474

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            + QSFIGVNYGQVA+NLP P +TA LLQSTSI+KVRLYG+DPA+IKALANTG+GI+IG A
Sbjct  20   NCQSFIGVNYGQVADNLPPPSSTAXLLQSTSIQKVRLYGSDPAIIKALANTGVGIVIGAA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSW+GANV  FYPAS I+ I VGNE+L SGD+ LI+QL+PA+QN+Q
Sbjct  80   NGDIPGLASDPSFAKSWVGANVSPFYPASNIILITVGNEVLTSGDQGLISQLVPAIQNVQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALNSAS+GGKIKVSTVH M++L  SEPPSSG FDP   D +K LL F +ATG+PF INP
Sbjct  140  NALNSASLGGKIKVSTVHSMAVLKQSEPPSSGSFDPGFGDVMKGLLGFNNATGSPFSINP  199

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  200  YPYFAYR  206



>gb|KHG04672.1| hypothetical protein F383_30229 [Gossypium arboreum]
Length=472

 Score =   279 bits (714),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q+FIGVNYGQ A+NLP+P ATAKLLQ+TSI+KVRLYG+D AMIKALANTGIGI+IG AN
Sbjct  24   SQTFIGVNYGQHADNLPSPAATAKLLQATSIQKVRLYGSDAAMIKALANTGIGIVIGTAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +AK+W+  NV+A+YPASKI+ INVGNE++ SGD NLI+QLLPAMQN++N
Sbjct  84   GDIPALASDPNFAKNWVDTNVVAYYPASKIILINVGNEVIMSGDNNLISQLLPAMQNVKN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++AS+G K+KVSTVH M++L  SEPPSSG FDPA  D LK +L+F +AT +PF INPY
Sbjct  144  ALDAASLGAKVKVSTVHSMTLLKQSEPPSSGSFDPAYGDMLKGVLAFNNATASPFAINPY  203

Query  653  PFFAFQ  670
            PFFA++
Sbjct  204  PFFAYR  209



>ref|XP_006372047.1| hypothetical protein POPTR_0018s08710g [Populus trichocarpa]
 gb|ERP49844.1| hypothetical protein POPTR_0018s08710g [Populus trichocarpa]
Length=363

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIG+NYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG A
Sbjct  23   NSQSFIGINYGQVADNLPPPSSTAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSWI  NVL FYPAS I+ I VGNE++ S D+NL+ +LLPAMQN+Q
Sbjct  83   NGDIPGLASDPNFAKSWINTNVLPFYPASNIILITVGNEVMTSNDQNLMNKLLPAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF INP
Sbjct  143  NALNDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINP  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>ref|NP_001275210.1| glucan endo-1,3-beta-D-glucosidase-like precursor [Solanum tuberosum]
 gb|AFU52647.1| beta-1,3-glucanase 12 [Solanum tuberosum]
Length=470

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+Q+FIGVNYGQVA+NLP P  T KL+QSTSI+KVRLYGADPA+IKALANTGIGI+IG +
Sbjct  24   DSQAFIGVNYGQVADNLPPPAETVKLIQSTSIQKVRLYGADPAIIKALANTGIGIVIGAS  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+AADP +A  W+  N+LA+YPASKI+ +NVGNE++ SGD+NLI QLLPAMQN+Q
Sbjct  84   NGDIPALAADPNFAGQWVNNNILAYYPASKIIVVNVGNEVVTSGDQNLIPQLLPAMQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GG+IKVSTVH MS+L  S+PPSSG F P   DSLK LL F    G+P +INP
Sbjct  144  NALNAASLGGRIKVSTVHAMSILSQSDPPSSGLFSPVFGDSLKALLQFHKENGSPLMINP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_004293211.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            + QSFIGVNYGQVA+NLP P +TAKLLQST+I+KVRLYG+DPA+IKALANTGIGI+IG A
Sbjct  21   NCQSFIGVNYGQVADNLPPPSSTAKLLQSTTIQKVRLYGSDPAIIKALANTGIGIVIGAA  80

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+PA+A+DP YA +W+  NV+ FYPAS I+ I VGNE+L SGD  L+TQL+PAMQN+Q
Sbjct  81   NGDVPALASDPNYAINWVSTNVVPFYPASNIILITVGNEVLTSGDHGLLTQLVPAMQNVQ  140

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALNS S+GGKIKVSTVH MS+L  SEPPSSG FDP   D +K LL F  ATG+PF INP
Sbjct  141  NALNSVSLGGKIKVSTVHAMSVLKQSEPPSSGSFDPGFGDVMKALLGFCSATGSPFAINP  200

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  201  YPYFAYR  207



>ref|XP_006372048.1| hypothetical protein POPTR_0018s08710g [Populus trichocarpa]
 gb|ERP49845.1| hypothetical protein POPTR_0018s08710g [Populus trichocarpa]
Length=375

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIG+NYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG A
Sbjct  23   NSQSFIGINYGQVADNLPPPSSTAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSWI  NVL FYPAS I+ I VGNE++ S D+NL+ +LLPAMQN+Q
Sbjct  83   NGDIPGLASDPNFAKSWINTNVLPFYPASNIILITVGNEVMTSNDQNLMNKLLPAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF INP
Sbjct  143  NALNDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINP  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>ref|XP_011083694.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Sesamum indicum]
Length=462

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P  T KLLQST+IEKVRLYG+DP +IKA ANTGIGIMIG +N
Sbjct  24   SQSFIGVNYGQVADNLPPPAETVKLLQSTAIEKVRLYGSDPGIIKAFANTGIGIMIGASN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP MA+DP +AK+WI A V+ FYPAS I+ INVGNE++   DRNL+TQLLPAMQNLQN
Sbjct  84   GDIPGMASDPNFAKNWINAYVVPFYPASNIILINVGNEVMSYNDRNLMTQLLPAMQNLQN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+SA +GGKIKVSTVH M++L  S+PPSSG FDP+I D LK LL F +ATG+PF INPY
Sbjct  144  ALDSADLGGKIKVSTVHSMAVLRQSDPPSSGSFDPSIGDLLKGLLEFNNATGSPFAINPY  203

Query  653  PFFAFQ  670
            P+FA++
Sbjct  204  PYFAYR  209



>ref|XP_002321276.2| hypothetical protein POPTR_0014s18140g, partial [Populus trichocarpa]
 gb|EEE99591.2| hypothetical protein POPTR_0014s18140g, partial [Populus trichocarpa]
Length=235

 Score =   269 bits (688),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYGQVA+NLP P +TAKLLQSTSI+KV+LYG+DPA+IKALANTGIGI+IG AN
Sbjct  1    SQSFIGINYGQVADNLPPPPSTAKLLQSTSIQKVQLYGSDPAIIKALANTGIGIVIGTAN  60

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP +A+DP +AKSWI  NVL FYP S I+ I VGNE++ S D+NL+ +LLPAMQN+QN
Sbjct  61   GDIPGLASDPNFAKSWINTNVLPFYPDSNIILITVGNEVMTSNDQNLVNKLLPAMQNVQN  120

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN AS+GGKIKV TVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF+INPY
Sbjct  121  ALNDASLGGKIKVCTVHPMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFVINPY  180

Query  653  PFFAFQ  670
            P+FA++
Sbjct  181  PYFAYR  186



>emb|CDO97058.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   276 bits (705),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIGVNYGQVA+NLP P ATAKLLQSTSIEKVRLYGADPA+I+ALA+TGIGI+IG AN
Sbjct  31   SESFIGVNYGQVADNLPPPAATAKLLQSTSIEKVRLYGADPAIIRALADTGIGIVIGAAN  90

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +A  W+  NVL +YPASKI+ I VGNE++ S D+NLI+QLLPAMQN+QN
Sbjct  91   GDIPALASDPNFAGQWVATNVLPYYPASKILVITVGNEVMTSTDQNLISQLLPAMQNVQN  150

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN+AS+GGKIKVSTVH M++L  S+PPSSG F+P    ++K LL F  A G+PF+INPY
Sbjct  151  ALNAASLGGKIKVSTVHSMAVLTQSDPPSSGTFNPGFGGTMKALLQFHQANGSPFMINPY  210

Query  653  PFFAFQ  670
            P+FA+Q
Sbjct  211  PYFAYQ  216



>ref|XP_010096392.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
 gb|EXB63955.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
Length=467

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P ATAKLLQSTSIEKVRLYGADPA+IKALANTGIGI+IG A
Sbjct  24   NSQSFIGVNYGQVADNLPPPSATAKLLQSTSIEKVRLYGADPAIIKALANTGIGIVIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP +AK+W+ ANV+ FYPASKI+ I VGNE++ SGD+ LI Q+LPA+QN+Q
Sbjct  84   NGDIPALASDPNFAKNWVNANVVPFYPASKIILITVGNEVMTSGDQGLINQMLPAIQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALNSAS+GGKIKVSTVH M++L  SEPPS+G F P     L+ +L+F +AT +PF INP
Sbjct  144  NALNSASLGGKIKVSTVHSMAVLRQSEPPSAGSFHPDFVPVLRGMLAFNNATDSPFAINP  203

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  204  YPYFAYR  210



>ref|XP_002510373.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF52560.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=461

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +++SFIGVNYGQVA+NLP P ATAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI IG +
Sbjct  24   NSESFIGVNYGQVADNLPPPSATAKLLQSTSIQKVRLYGSDPAIIKALANTGIGITIGAS  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            +GDIP++A+DP +AK+W+  NV+ FYPASKI+ I +GNE++ SGD+NL++ LLPAMQN+Q
Sbjct  84   SGDIPSLASDPNFAKNWVDTNVVPFYPASKIILITIGNEVMSSGDQNLMSNLLPAMQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GG+IKVSTVH M++L  SEPPS+G FDP+  D +K LL+F +ATG+PF INP
Sbjct  144  NALNAASLGGEIKVSTVHSMAVLKQSEPPSTGSFDPSFGDLMKGLLAFNNATGSPFAINP  203

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  204  YPYFAYR  210



>ref|XP_006375631.1| hypothetical protein POPTR_0014s18230g [Populus trichocarpa]
 gb|ERP53428.1| hypothetical protein POPTR_0014s18230g [Populus trichocarpa]
Length=432

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIG+NYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG A
Sbjct  23   NSQSFIGINYGQVADNLPPPPSTAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSWI  NVL FYPAS I+ I VGNE++ S D+NL+ +LLPAMQN+Q
Sbjct  83   NGDIPGLASDPNFAKSWINTNVLPFYPASNIILITVGNEVMTSNDQNLVNRLLPAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF INP
Sbjct  143  NALNDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINP  202

Query  650  YPFFAFQ  670
            YP++A++
Sbjct  203  YPYYAYR  209



>ref|XP_002321274.1| hypothetical protein POPTR_0014s18110g [Populus trichocarpa]
 gb|EEE99589.1| hypothetical protein POPTR_0014s18110g [Populus trichocarpa]
Length=374

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIG+NYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI++G A
Sbjct  23   NSQSFIGINYGQVADNLPPPPSTAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVVGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +A+SWI  NVL FYPAS I+ I VGNE++ S D+NL+ +LLPAMQN+Q
Sbjct  83   NGDIPGLASDPNFAESWINTNVLPFYPASNIILITVGNEVMTSNDQNLVNKLLPAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF INP
Sbjct  143  NALNDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINP  202

Query  650  YPFFAFQ  670
            YP++A++
Sbjct  203  YPYYAYR  209



>ref|XP_004230886.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Solanum lycopersicum]
Length=473

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+Q+FIGVNYGQVA+NLP P  T KL+QSTSI+KVRLYGADPA+IKALANTGIGI+IG +
Sbjct  24   DSQAFIGVNYGQVADNLPPPAETVKLIQSTSIQKVRLYGADPAIIKALANTGIGIVIGAS  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+AADP +A  W+  N+LA+YPASKI+ +NVGNE++ SGD+NLI +LLPAMQN+Q
Sbjct  84   NGDIPALAADPNFAGQWVHNNILAYYPASKIIVVNVGNEVVTSGDQNLIPKLLPAMQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GG+IKVSTVH MS+L  S+PPSSG F P   D+LK LL F    G+P +INP
Sbjct  144  NALNAASLGGRIKVSTVHAMSILSQSDPPSSGLFSPVFGDTLKALLQFHKDNGSPLMINP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_008220789.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Prunus mume]
Length=480

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
             QSFIGVNYGQVA+NLP P ATAKLLQSTSI+KVRLYG+DPA+IKALANTG+GI+IG AN
Sbjct  21   CQSFIGVNYGQVADNLPPPSATAKLLQSTSIQKVRLYGSDPAIIKALANTGVGIVIGAAN  80

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP +A+D  +AKSWI ANV  FYPAS I+ I VGNE+L SGD+ LI+QL+PA+QN+QN
Sbjct  81   GDIPGLASDQNFAKSWIDANVAPFYPASNIILITVGNEVLTSGDQGLISQLVPAIQNVQN  140

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+SAS+GGKIKVSTVH M++L  SEPPSSG FDP   D +K LL+F  ATG+PF INPY
Sbjct  141  ALDSASLGGKIKVSTVHSMAVLKQSEPPSSGSFDPGFGDVMKWLLAFNSATGSPFAINPY  200

Query  653  PFFAFQ  670
            P+FA++
Sbjct  201  PYFAYR  206



>ref|XP_009804917.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Nicotiana 
sylvestris]
Length=451

 Score =   273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++Q+FIGVNYGQ+A+NLP    T KL+QST IEKVRLYGADPA+IKALANTGIGI+IG A
Sbjct  24   ESQAFIGVNYGQLADNLPPVTETVKLIQSTRIEKVRLYGADPAIIKALANTGIGIVIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP YA  W+ +NVLA+YPASKI+ + VGNE++ SGD+NLI QLLPAMQN+Q
Sbjct  84   NGDIPALASDPNYAGQWVNSNVLAYYPASKIIVVTVGNEVVTSGDQNLIPQLLPAMQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GGKIKVSTVH MS+L  S+PPSSG F P   D+LK LL F    G+P +INP
Sbjct  144  NALNAASLGGKIKVSTVHAMSILSQSDPPSSGLFSPVFGDTLKALLQFHKENGSPLMINP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_002321270.2| hypothetical protein POPTR_0014s18290g, partial [Populus trichocarpa]
 gb|EEE99585.2| hypothetical protein POPTR_0014s18290g, partial [Populus trichocarpa]
Length=285

 Score =   268 bits (684),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q+FIG+NYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG AN
Sbjct  1    SQAFIGINYGQVADNLPPPSSTAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTAN  60

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP +A+DP +AKSWI  NVL FYPAS I+ I VGNE++ S D+NL+ +LLPAMQN+QN
Sbjct  61   GDIPGLASDPNFAKSWINTNVLPFYPASNIILITVGNEVMTSNDQNLMNKLLPAMQNVQN  120

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
             LN  S+GGKIKVST+H M +L  SEPPSSG FDP+  D +K LL F  A G+PF INPY
Sbjct  121  TLNDESLGGKIKVSTIHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINPY  180

Query  653  PFFAFQ  670
            P++A++
Sbjct  181  PYYAYR  186



>ref|XP_011037536.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
 ref|XP_011037537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
Length=456

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIGVNYGQVA+NLP P ATAKLLQST+++KVRLYGADPAMI+ALANTGIGI+IG AN
Sbjct  20   SESFIGVNYGQVADNLPPPSATAKLLQSTAVQKVRLYGADPAMIRALANTGIGIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            G+IPA+A+DP +A  WI +NVLA+YPASKI+ I VGNE+L S D+NLI+QLLPAMQN+Q 
Sbjct  80   GEIPALASDPNFATQWINSNVLAYYPASKIILITVGNEVLLSNDQNLISQLLPAMQNMQR  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+SAS+GGK+KVSTVH M++L  S+PPSSG F+PA  D+++ LL F    G+P  +NPY
Sbjct  140  ALSSASLGGKVKVSTVHSMAILSRSDPPSSGLFNPAYQDTMRRLLQFQKDNGSPLAVNPY  199

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  200  PFFAYQ  205



>ref|XP_007222662.1| hypothetical protein PRUPE_ppa004976mg [Prunus persica]
 gb|EMJ23861.1| hypothetical protein PRUPE_ppa004976mg [Prunus persica]
Length=483

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
             QSFIGVNYGQVA+NLP P ATAKLLQSTSI+KVRLYG+DPA+IKA+ANTGIGI+IG AN
Sbjct  21   CQSFIGVNYGQVADNLPPPSATAKLLQSTSIQKVRLYGSDPAIIKAIANTGIGIVIGAAN  80

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP +A+D  +AKSW+ ANV  FYPAS I+ I VGNE+L SGD+ LI+QL+PA+QN+QN
Sbjct  81   GDIPGLASDQNFAKSWVDANVAPFYPASNIILITVGNEVLTSGDQGLISQLVPAIQNVQN  140

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+S+S+GGKIKVSTVH M++L  SEPPSSG FDP   D +K LL+F  ATG+PF INPY
Sbjct  141  ALDSSSLGGKIKVSTVHSMAVLKQSEPPSSGSFDPGFGDVMKWLLAFNSATGSPFAINPY  200

Query  653  PFFAFQ  670
            P+FA++
Sbjct  201  PYFAYR  206



>ref|XP_009804916.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Nicotiana 
sylvestris]
Length=480

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++Q+FIGVNYGQ+A+NLP    T KL+QST IEKVRLYGADPA+IKALANTGIGI+IG A
Sbjct  24   ESQAFIGVNYGQLADNLPPVTETVKLIQSTRIEKVRLYGADPAIIKALANTGIGIVIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP YA  W+ +NVLA+YPASKI+ + VGNE++ SGD+NLI QLLPAMQN+Q
Sbjct  84   NGDIPALASDPNYAGQWVNSNVLAYYPASKIIVVTVGNEVVTSGDQNLIPQLLPAMQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GGKIKVSTVH MS+L  S+PPSSG F P   D+LK LL F    G+P +INP
Sbjct  144  NALNAASLGGKIKVSTVHAMSILSQSDPPSSGLFSPVFGDTLKALLQFHKENGSPLMINP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_008377338.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Malus domestica]
Length=473

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            + QSFIGVNYGQVA+NLP P +T KLLQSTSI+KVRLYG+DPA+IKALANTG+GI+IG +
Sbjct  20   NCQSFIGVNYGQVADNLPPPSSTTKLLQSTSIQKVRLYGSDPAIIKALANTGLGIVIGAS  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSW+GANV  FYPAS I+ I VGNE+L  GD+ LI+QL+PA++N+Q
Sbjct  80   NGDIPGLASDPSFAKSWVGANVSPFYPASNIILITVGNEVLTYGDQGLISQLVPAIKNVQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +AL S S+GGKIKVSTVH M+ML  SEPPSS RFDP   D +K+LL F +ATG+PF INP
Sbjct  140  DALTSLSLGGKIKVSTVHSMAMLKHSEPPSSARFDPGFGDVIKELLGFNNATGSPFAINP  199

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  200  YPYFAYR  206



>gb|KDO49089.1| hypothetical protein CISIN_1g0122622mg, partial [Citrus sinensis]
Length=245

 Score =   265 bits (676),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P ATAKLLQSTSI+K+RLYGADPA+IKALANTG+GI+IG ++
Sbjct  27   SQSFIGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASS  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP  A  WI +NVL FYPASKI+ I VGNE++ S D+NLI+QLLPAM N+QN
Sbjct  87   GDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMANMQN  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN+AS+GGKIKVSTVH MS+L  S+PPSSG F     D+++ +L F+   G+PF INPY
Sbjct  147  ALNAASLGGKIKVSTVHAMSVLAQSDPPSSGSF--IRQDTMRGILQFLKDHGSPFTINPY  204

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  205  PFFAYQ  210



>ref|XP_011088386.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Sesamum 
indicum]
Length=457

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP PEATAKLL+STSIEKVRLYGADPA+IKALANTGIGI+IG A
Sbjct  31   NSQSFIGVNYGQVADNLPPPEATAKLLKSTSIEKVRLYGADPAIIKALANTGIGIVIGAA  90

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP +A +WI +NVL +YPASKI+ + VGNE++ S D+NL++QLLPAMQN+Q
Sbjct  91   NGDIPALASDPNFAGNWINSNVLPYYPASKIIVVTVGNEVVTSPDQNLVSQLLPAMQNVQ  150

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GGKIKVSTVH M++L  S+PPSSG F     D++K LL F  A G+P +INP
Sbjct  151  NALNAASLGGKIKVSTVHSMAVLSQSDPPSSGAF--GYGDTMKALLQFHSANGSPLMINP  208

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  209  YPFFAYQ  215



>ref|XP_010254870.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Nelumbo nucifera]
Length=512

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P AT  LLQSTSI KVRL+GADPA+IKALANT IGI+I  A
Sbjct  75   NSQSFIGVNYGQVADNLPPPAATVNLLQSTSIGKVRLFGADPAIIKALANTAIGIVIAAA  134

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AK WI +NVL +YPASKI+ INVGNE++ SGD+NLI+ LLPAMQN+Q
Sbjct  135  NGDIPPLASDPNFAKQWINSNVLPYYPASKIIVINVGNEVMTSGDQNLISNLLPAMQNVQ  194

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GGKIKVSTVH M++L  S+PPSSG F P + ++LK +L F+  TG+PF INP
Sbjct  195  NALNAASLGGKIKVSTVHSMAVLAQSDPPSSGMFHPELFETLKAMLGFLQDTGSPFTINP  254

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  255  YPFFAYQ  261



>ref|XP_009605960.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Nicotiana 
tomentosiformis]
Length=451

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++Q+FIGVNYGQ+A+NLP    T KL+QST IEKVRLYGADPA+IKALANTGIGI+IG A
Sbjct  24   ESQAFIGVNYGQLADNLPPVTETVKLIQSTRIEKVRLYGADPAIIKALANTGIGIVIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP +A  W+ +NVLA+YPASKI+ + VGNE++ SGD+NLI QLLPAMQN+Q
Sbjct  84   NGDIPALASDPNFAGQWVNSNVLAYYPASKIIVVTVGNEVVTSGDQNLIPQLLPAMQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GG+IKVSTVH MS+L  S+PPSSG F P   D+LK LL F    G+P +INP
Sbjct  144  NALNAASLGGRIKVSTVHAMSILSQSDPPSSGLFSPVFGDTLKALLQFHKENGSPLMINP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_011048644.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
Length=456

 Score =   271 bits (692),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P ATAKLLQST+++KVRLYGADPA+IKALA+TGIGI+IG AN
Sbjct  20   SQSFIGVNYGQVADNLPPPSATAKLLQSTAVQKVRLYGADPAIIKALADTGIGIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +A  W+ +NVLA+YP+SKI+ I VGNE+L S D+NLI+QLLPAMQN++ 
Sbjct  80   GDIPALASDPNFATQWVNSNVLAYYPSSKIILITVGNEVLLSNDQNLISQLLPAMQNMEK  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+SAS+GGK+KVSTVH M++L  S+PPSSG F PA  D++K LL F    G+P  +NPY
Sbjct  140  ALSSASLGGKVKVSTVHSMAILSQSDPPSSGLFSPAYQDTMKGLLQFQKDNGSPIAVNPY  199

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  200  PFFAYQ  205



>ref|XP_009364443.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Pyrus x bretschneideri]
Length=470

 Score =   271 bits (693),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            + QSFIGVNYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANTG+GI+IG +
Sbjct  20   NCQSFIGVNYGQVADNLPPPSSTAKLLQSTSIQKVRLYGSDPAIIKALANTGLGIVIGAS  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSW+GANV  FYPAS I+ I VGNE+L  GD+ LI+QL+PA++N+Q
Sbjct  80   NGDIPGLASDPSFAKSWVGANVSPFYPASNIILITVGNEVLTYGDQGLISQLVPAIKNVQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +ALNS S+GG+IKVSTVH M++L  SEPPSS RFDP   D +K LL F +ATG+PF INP
Sbjct  140  DALNSLSLGGQIKVSTVHSMAVLKHSEPPSSARFDPGFGDVMKALLGFNNATGSPFAINP  199

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  200  YPYFAYR  206



>ref|XP_011088385.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Sesamum 
indicum]
Length=506

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP PEATAKLL+STSIEKVRLYGADPA+IKALANTGIGI+IG A
Sbjct  31   NSQSFIGVNYGQVADNLPPPEATAKLLKSTSIEKVRLYGADPAIIKALANTGIGIVIGAA  90

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP +A +WI +NVL +YPASKI+ + VGNE++ S D+NL++QLLPAMQN+Q
Sbjct  91   NGDIPALASDPNFAGNWINSNVLPYYPASKIIVVTVGNEVVTSPDQNLVSQLLPAMQNVQ  150

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GGKIKVSTVH M++L  S+PPSSG F     D++K LL F  A G+P +INP
Sbjct  151  NALNAASLGGKIKVSTVHSMAVLSQSDPPSSGAF--GYGDTMKALLQFHSANGSPLMINP  208

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  209  YPFFAYQ  215



>gb|EYU37792.1| hypothetical protein MIMGU_mgv1a006258mg [Erythranthe guttata]
Length=450

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP  EATAKLLQSTSIEKVRLYGADP +IKALANTGIGI+IG A
Sbjct  29   NSQSFIGVNYGQVADNLPPAEATAKLLQSTSIEKVRLYGADPVIIKALANTGIGIVIGAA  88

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP +A +W+ +NVLA+YPASKI+ ++VGNE++ S D+NL++QLLPAMQN+Q
Sbjct  89   NGDIPALASDPNFAGNWVYSNVLAYYPASKIIVVSVGNEVVTSPDQNLVSQLLPAMQNVQ  148

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GGK+KVSTVH M++L  S+PPSSG F     D++K LL F  + G+PF+INP
Sbjct  149  NALNAASLGGKVKVSTVHSMAVLSQSDPPSSGAF--GYGDTMKGLLQFHSSNGSPFMINP  206

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  207  YPFFAYQ  213



>ref|XP_009605959.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Nicotiana 
tomentosiformis]
Length=480

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++Q+FIGVNYGQ+A+NLP    T KL+QST IEKVRLYGADPA+IKALANTGIGI+IG A
Sbjct  24   ESQAFIGVNYGQLADNLPPVTETVKLIQSTRIEKVRLYGADPAIIKALANTGIGIVIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP +A  W+ +NVLA+YPASKI+ + VGNE++ SGD+NLI QLLPAMQN+Q
Sbjct  84   NGDIPALASDPNFAGQWVNSNVLAYYPASKIIVVTVGNEVVTSGDQNLIPQLLPAMQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GG+IKVSTVH MS+L  S+PPSSG F P   D+LK LL F    G+P +INP
Sbjct  144  NALNAASLGGRIKVSTVHAMSILSQSDPPSSGLFSPVFGDTLKALLQFHKENGSPLMINP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_011012794.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Populus euphratica]
Length=417

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIG+NYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG A
Sbjct  23   NSQSFIGINYGQVADNLPPPPSTAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSWI  +VL FYP S I+ I VGNE++ S D+NL+ +LLPA+QN+Q
Sbjct  83   NGDIPGLASDPNFAKSWINTHVLPFYPDSNIILITVGNEVMTSNDQNLMNKLLPALQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF INP
Sbjct  143  NALNDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNRANGSPFAINP  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>ref|XP_012071831.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Jatropha 
curcas]
 gb|KDP38495.1| hypothetical protein JCGZ_04420 [Jatropha curcas]
Length=437

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P ATAKLL+ST+I+KVRLYG+DPA+IKALANTGIGI IG +N
Sbjct  23   SQSFIGVNYGQVADNLPPPSATAKLLESTAIQKVRLYGSDPAIIKALANTGIGITIGASN  82

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A+DP +A +W+  NV+ FYPASKI+ I VGNE++ S D+NL+T+LLPAMQN+QN
Sbjct  83   GDIPSLASDPNFATNWVNTNVVPFYPASKIILITVGNEVMSSNDQNLMTKLLPAMQNVQN  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++ S+GGKIKVSTVH M++L  SEPPS G FDP+  D +K LL+F +AT +PF INPY
Sbjct  143  ALDAESLGGKIKVSTVHSMAVLKQSEPPSIGSFDPSYGDLMKGLLAFTNATNSPFAINPY  202

Query  653  PFFAFQ  670
            P+FA++
Sbjct  203  PYFAYR  208



>ref|XP_002306099.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
 gb|EEE86610.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
Length=373

 Score =   266 bits (680),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIGVNYGQVA+NLP+P ATAKLLQST+++KVRLYGADPA+I+ALANTGI I+IG AN
Sbjct  20   SESFIGVNYGQVADNLPSPSATAKLLQSTAVQKVRLYGADPAIIRALANTGIEIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            G+IPA+A+DP  A  WI +NVL +YPASKI+ I VGNE+L S D+NLI+QLLPAMQN+Q 
Sbjct  80   GEIPALASDPNSATQWINSNVLPYYPASKIILITVGNEVLLSNDQNLISQLLPAMQNMQK  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+SAS+GGK+KVSTVH M++L  S+PPSSG F+PA  D+++ LL F    G+P  +NPY
Sbjct  140  ALSSASLGGKVKVSTVHSMAILSRSDPPSSGLFNPAYQDTMRRLLQFQKDNGSPLAVNPY  199

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  200  PFFAYQ  205



>ref|XP_006375633.1| hypothetical protein POPTR_0014s18250g [Populus trichocarpa]
 gb|ERP53430.1| hypothetical protein POPTR_0014s18250g [Populus trichocarpa]
Length=378

 Score =   266 bits (680),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIG+NYGQVA+NLP P +TAKLLQSTSI+KVRL G+DPA+IKALANTGIGI+IG A
Sbjct  23   NSQSFIGINYGQVADNLPPPPSTAKLLQSTSIQKVRLNGSDPAIIKALANTGIGIVIGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSWI  NVL FYPAS I+ I VG E++ S D+NL+ +LLPAMQN+Q
Sbjct  83   NGDIPGLASDPNFAKSWINTNVLPFYPASNIILITVGIEVMTSNDQNLMNKLLPAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF INP
Sbjct  143  NALNDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINP  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>ref|XP_002313051.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE87006.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=372

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYGQVA+NLP P ATAKLLQST ++KVRLYGADPA+IKALA+TGIGI+IG AN
Sbjct  20   SQSFIGINYGQVADNLPPPSATAKLLQSTGVQKVRLYGADPAIIKALADTGIGIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +A  W+ +NVLA YP+SKI+ I VGNE+L S D+NLI+QLLPAMQN+Q 
Sbjct  80   GDIPALASDPNFATQWVNSNVLA-YPSSKIILITVGNEVLLSNDQNLISQLLPAMQNMQK  138

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+SAS+GGK+KVSTVH M++L  S+PPSSG F PA  D++K LL F    G+P  +NPY
Sbjct  139  ALSSASLGGKVKVSTVHSMAILSQSDPPSSGLFSPAYQDTMKGLLQFQKDNGSPIAVNPY  198

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  199  PFFAYQ  204



>ref|XP_012071830.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Jatropha 
curcas]
 gb|KDP38494.1| hypothetical protein JCGZ_04419 [Jatropha curcas]
Length=461

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P ATAKLLQST+I+KVRLYG+DPA+IKALAN GIGI IG +
Sbjct  23   NSQSFIGVNYGQVADNLPPPSATAKLLQSTAIQKVRLYGSDPAIIKALANAGIGITIGAS  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++A+DP +AK+W+  NV+ FYPAS I+ I VGNE++ SGD+NL+T+LL AMQN+Q
Sbjct  83   NGDIPSLASDPNFAKNWVNTNVVPFYPASTIILITVGNEVMSSGDQNLMTKLLQAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL++AS+GGKIKVSTVH M++L  SEPPS G FDP+  D +K LL+F +AT +PF INP
Sbjct  143  NALDAASLGGKIKVSTVHSMAVLKQSEPPSIGSFDPSYGDLMKGLLAFNNATNSPFAINP  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>gb|KJB32497.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=362

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P ATAKLL+STSIEKVRLYGADPA+IKALANT IGI+IG AN
Sbjct  20   AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A+DP  A  WI +NVL FYPASKI+ I VGNE+L + D NLI QLLPAMQN+QN
Sbjct  80   GDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQN  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+N AS+GGKIKVSTVH M++L  S+PPSSG F P+   +LK LL F    G+PF INPY
Sbjct  140  AINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFHKDNGSPFAINPY  199

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  200  PFFAYQ  205



>ref|XP_006375627.1| hypothetical protein POPTR_0014s18190g [Populus trichocarpa]
 gb|ERP53424.1| hypothetical protein POPTR_0014s18190g [Populus trichocarpa]
Length=372

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFI +NYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANT IGI+IG A
Sbjct  23   NSQSFISINYGQVADNLPPPPSTAKLLQSTSIQKVRLYGSDPAIIKALANTRIGIVIGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSWI  NVL FYPAS I+ I VGNE++ S D+NL+ +LLPAMQN+Q
Sbjct  83   NGDIPGLASDPNFAKSWINTNVLPFYPASNIILITVGNEVMTSNDQNLMNKLLPAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL+ AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF IN 
Sbjct  143  NALDDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINT  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>ref|XP_002321266.1| hypothetical protein POPTR_0014s18060g [Populus trichocarpa]
 gb|EEE99581.1| hypothetical protein POPTR_0014s18060g [Populus trichocarpa]
Length=374

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSF+G+NYGQVA+NLP P + AKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG A
Sbjct  23   NSQSFLGINYGQVADNLPPPSSNAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+D  + KSWI  NVL FYPAS I+ I VGNE++ S D+NL+ +LLPAMQN+Q
Sbjct  83   NGDIPGLASDSNFTKSWINKNVLPFYPASNIILITVGNEVMTSNDQNLMNKLLPAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF IN 
Sbjct  143  NALNDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINT  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>ref|XP_007201010.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
 gb|EMJ02209.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
Length=464

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P ATAKLLQSTSI++VRLYGADPA+IKALA TGI I IG +N
Sbjct  23   SQSFIGVNYGQVADNLPPPAATAKLLQSTSIKRVRLYGADPAIIKALAGTGIAIAIGASN  82

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP  A  W+ +NVLAFYPAS I  INVGNE+L+S D+ LI+QLLPAM+N+Q+
Sbjct  83   GDIPALASDPNAAAQWVNSNVLAFYPASNIDLINVGNEVLFSNDQGLISQLLPAMRNVQS  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++AS+GGK++VSTVH M++L  S+PPSSGRF P   D LK LL+F    G+PF +NPY
Sbjct  143  ALSAASLGGKVRVSTVHAMTLLAQSDPPSSGRFKPGFQDVLKGLLAFQRDNGSPFAVNPY  202

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  203  PFFAYQ  208



>ref|XP_006423252.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
 gb|ESR36492.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
Length=379

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P ATAKLLQSTSI+K+RLYGADPA+IKALANTG+GI+IG ++
Sbjct  27   SQSFIGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASS  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP  A  WI +NVL FYPASKI+ I VGNE++ S D+NLI+QLLPAM N+QN
Sbjct  87   GDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMANMQN  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN+AS+GGKIKVSTVH MS+L  S+PPSSG F     D+++ +L F+   G+PF INPY
Sbjct  147  ALNAASLGGKIKVSTVHAMSVLAQSDPPSSGSF--IRQDTMRGILQFLKDHGSPFTINPY  204

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  205  PFFAYQ  210



>ref|XP_007042210.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX98041.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=459

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQVA+NLP P ATAKLLQSTSIEKVRLYGADPA+IKALANTGIGI+IG  NGD+P
Sbjct  24   IGVNYGQVADNLPPPSATAKLLQSTSIEKVRLYGADPAIIKALANTGIGIVIGATNGDVP  83

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            A+A+DP  A  W+ +NVL FYPASKI+ I VGNE+L + D NLI QLLPAMQN+QNALN+
Sbjct  84   ALASDPNSAAQWVNSNVLPFYPASKIILITVGNEVLMTNDPNLINQLLPAMQNVQNALNA  143

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            AS+GGK+KVSTVH M++L  S+PPSSG F P+   +LK LL F    G+PF INPYPFFA
Sbjct  144  ASLGGKVKVSTVHSMAVLSQSDPPSSGLFSPSYQPALKGLLQFQKENGSPFAINPYPFFA  203

Query  665  FQ  670
            +Q
Sbjct  204  YQ  205



>ref|XP_010530842.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Tarenaya hassleriana]
Length=499

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P  TAKLLQSTSI+KVRLYGADPA+IKALA TGIGI+IG  N
Sbjct  19   SQSFIGVNYGQVADNLPPPSETAKLLQSTSIQKVRLYGADPAVIKALAGTGIGIVIGAGN  78

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A DP  A  WI +NVL FYP+SKI+ I VGNE+L S D+NLI+QLLPAMQNLQ 
Sbjct  79   GDIPSLAGDPNAATQWINSNVLPFYPSSKIILITVGNEVLMSNDQNLISQLLPAMQNLQK  138

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+  AS+GGKIKVSTVH M++L SSEPPS+G F      SLK +L F+  TG+PF INPY
Sbjct  139  AIEGASLGGKIKVSTVHSMTVLGSSEPPSAGSFAAGYQSSLKGILQFLSQTGSPFTINPY  198

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  199  PFFAYQ  204



>ref|XP_010065396.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Eucalyptus 
grandis]
 gb|KCW62850.1| hypothetical protein EUGRSUZ_G00445 [Eucalyptus grandis]
Length=470

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSF+GVNYGQVA+NLP PE+TAKLLQST+I KVRLYGADPA+IKALANTGIGI+IG AN
Sbjct  29   SQSFVGVNYGQVADNLPPPESTAKLLQSTTIGKVRLYGADPAIIKALANTGIGIVIGAAN  88

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++AADP  A  W+GAN+L FYPASKI  + VGNE+  S D NL++QLLPAMQN+Q 
Sbjct  89   GDIPSLAADPNAAGQWVGANILPFYPASKITLVTVGNEVFMSNDENLMSQLLPAMQNMQR  148

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+ +A +GGK+KVS+VH MS+L  S+PPSSGRF P+    ++D+L F    G+P  INPY
Sbjct  149  AITAAGLGGKVKVSSVHAMSLLSQSDPPSSGRFHPSFEARMRDVLQFQRENGSPLPINPY  208

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  209  PFFAYQ  214



>ref|XP_008236880.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Prunus mume]
Length=463

 Score =   266 bits (679),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P ATAKLLQST+I++VRLYGADPA+IKALA TGI I IG +N
Sbjct  23   SQSFIGVNYGQVADNLPPPAATAKLLQSTAIKRVRLYGADPAIIKALAGTGIAIAIGASN  82

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP  A  W+ +NVLAFYP S I  INVGNE+L+S D+ LI+QLLPAM+N+Q+
Sbjct  83   GDIPALASDPNAAAQWVNSNVLAFYPTSNIDLINVGNEVLFSNDQGLISQLLPAMRNVQS  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++AS+GGK++VSTVH M++L  S+PPSSGRF+P + D LK LL+F    G+PF +NPY
Sbjct  143  ALSAASLGGKVRVSTVHAMTLLAQSDPPSSGRFNPGLQDVLKGLLAFQRDNGSPFAVNPY  202

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  203  PFFAYQ  208



>ref|XP_006384505.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
 gb|ABK95331.1| unknown [Populus trichocarpa]
 gb|ERP62302.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
Length=456

 Score =   265 bits (678),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIGVNYGQVA+NLP+P ATAKLLQST+++KVRLYGADPA+I+ALANTGI I+IG AN
Sbjct  20   SESFIGVNYGQVADNLPSPSATAKLLQSTAVQKVRLYGADPAIIRALANTGIEIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            G+IPA+A+DP  A  WI +NVL +YPASKI+ I VGNE+L S D+NLI+QLLPAMQN+Q 
Sbjct  80   GEIPALASDPNSATQWINSNVLPYYPASKIILITVGNEVLLSNDQNLISQLLPAMQNMQK  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+SAS+GGK+KVSTVH M++L  S+PPSSG F+PA  D+++ LL F    G+P  +NPY
Sbjct  140  ALSSASLGGKVKVSTVHSMAILSRSDPPSSGLFNPAYQDTMRRLLQFQKDNGSPLAVNPY  199

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  200  PFFAYQ  205



>ref|XP_006375635.1| hypothetical protein POPTR_0014s18270g [Populus trichocarpa]
 gb|ERP53432.1| hypothetical protein POPTR_0014s18270g [Populus trichocarpa]
Length=375

 Score =   263 bits (672),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIG+NYGQVA+NLP P +TAKLLQSTSI+KVRL G+D A+IKALA TGIGI+IG A
Sbjct  23   NSQSFIGINYGQVADNLPPPSSTAKLLQSTSIQKVRLNGSDTAIIKALAKTGIGIVIGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+DP +AKSWI  NVL FYPAS I+ I VGN ++ S D+NL+ +LLPAMQN+Q
Sbjct  83   NGDIPGLASDPNFAKSWINTNVLPFYPASNIILITVGNGVMTSNDQNLMNRLLPAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF INP
Sbjct  143  NALNDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKALLEFSRANGSPFAINP  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>gb|KHG11479.1| hypothetical protein F383_06303 [Gossypium arboreum]
Length=456

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P ATAKLL+STSIEKVRLYGADPA+IKALANT IGI+IG AN
Sbjct  20   AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A+DP  A  WI +NVL FYPASKI+ I VGNE+L + D NLI QLLPAMQN+QN
Sbjct  80   GDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQN  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+N AS+GGKIKVSTVH M++L  S+PPSSG F P+   +LK LL F    G+PF INPY
Sbjct  140  AINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPY  199

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  200  PFFAYQ  205



>ref|XP_006379239.1| hypothetical protein POPTR_0009s11830g [Populus trichocarpa]
 gb|ABK95837.1| unknown [Populus trichocarpa]
 gb|ERP57036.1| hypothetical protein POPTR_0009s11830g [Populus trichocarpa]
Length=452

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYGQVA+NLP P ATAKLLQST ++KVRLYGADPA+IKALA+TGIGI+IG AN
Sbjct  20   SQSFIGINYGQVADNLPPPSATAKLLQSTGVQKVRLYGADPAIIKALADTGIGIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +A  W+ +NVLA YP+SKI+ I VGNE+L S D+NLI+QLLPAMQN+Q 
Sbjct  80   GDIPALASDPNFATQWVNSNVLA-YPSSKIILITVGNEVLLSNDQNLISQLLPAMQNMQK  138

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL+SAS+GGK+KVSTVH M++L  S+PPSSG F PA  D++K LL F    G+P  +NPY
Sbjct  139  ALSSASLGGKVKVSTVHSMAILSQSDPPSSGLFSPAYQDTMKGLLQFQKDNGSPIAVNPY  198

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  199  PFFAYQ  204



>ref|XP_012069916.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Jatropha curcas]
 gb|KDP46246.1| hypothetical protein JCGZ_10086 [Jatropha curcas]
Length=459

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIG+NYG +A+NLP P ATAKLLQSTSI+KVRLYGADPA +KALANTGIGI+IG AN
Sbjct  23   SESFIGINYGLLADNLPPPTATAKLLQSTSIQKVRLYGADPAFLKALANTGIGIVIGAAN  82

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP  A  W+ ANVL +YPAS I+ I +GNE+L SGD+NLI+QLLPAMQN+ N
Sbjct  83   GDIPALASDPNSATQWVNANVLPYYPASNIILITIGNEVLLSGDQNLISQLLPAMQNMHN  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALNS S+GGKIKVSTVH M+ L  S+PPSSG F+P+  D++K LL F    G+P  INPY
Sbjct  143  ALNSISLGGKIKVSTVHSMASLSQSDPPSSGMFNPSYQDTMKGLLQFQRDNGSPLAINPY  202

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  203  PFFAYQ  208



>gb|KJB32496.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=456

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P ATAKLL+STSIEKVRLYGADPA+IKALANT IGI+IG AN
Sbjct  20   AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A+DP  A  WI +NVL FYPASKI+ I VGNE+L + D NLI QLLPAMQN+QN
Sbjct  80   GDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQN  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+N AS+GGKIKVSTVH M++L  S+PPSSG F P+   +LK LL F    G+PF INPY
Sbjct  140  AINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFHKDNGSPFAINPY  199

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  200  PFFAYQ  205



>ref|XP_002867117.1| hypothetical protein ARALYDRAFT_491210 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43376.1| hypothetical protein ARALYDRAFT_491210 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P  TAKLLQSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  22   AEPFIGVNYGQVADNLPPPSETAKLLQSTSIQKVRLYGADPAIIKALAGTGVGIVIGAAN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P+ A+DP  A  WI +NVL FYPASKI+ I VGNEIL S D NL+ QLLPAMQN+Q 
Sbjct  82   GDVPSFASDPNAATQWINSNVLPFYPASKIILITVGNEILMSNDPNLVNQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH M++L SS+PPS+G F P     LK +L F+  TG+PF INPY
Sbjct  142  ALEAVSLGGKIKVSTVHSMTVLGSSDPPSTGSFAPGYQTGLKGILQFLSDTGSPFAINPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>ref|XP_002509479.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF50866.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=460

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYG VA+NLP P A+AKLLQST+I+KVRLYGADPA++KALANTGIG++IG AN
Sbjct  24   SQSFIGINYGLVADNLPPPTASAKLLQSTAIQKVRLYGADPAVLKALANTGIGVVIGAAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP  A  WI ANVL +YPA+ I+ I VGNE++ SGD+NLI+QLLPAMQN+ N
Sbjct  84   GDIPALASDPNSATQWINANVLPYYPATNIILITVGNEVVLSGDQNLISQLLPAMQNIAN  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN+AS+GGKIKVSTVH M++L  S+PPSSG F+P+  D++K LL F    G+P  INPY
Sbjct  144  ALNAASLGGKIKVSTVHSMAVLSQSDPPSSGLFNPSYQDTMKGLLQFQRDNGSPLTINPY  203

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  204  PFFAYQ  209



>ref|XP_002321268.2| hypothetical protein POPTR_0014s18060g [Populus trichocarpa]
 gb|EEE99583.2| hypothetical protein POPTR_0014s18060g [Populus trichocarpa]
Length=454

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSF+G+NYGQVA+NLP P + AKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG A
Sbjct  23   NSQSFLGINYGQVADNLPPPSSNAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A+D  + KSWI  NVL FYPAS I+ I VGNE++ S D+NL+ +LLPAMQN+Q
Sbjct  83   NGDIPGLASDSNFTKSWINKNVLPFYPASNIILITVGNEVMTSNDQNLMNKLLPAMQNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN AS+GGKIKVSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF IN 
Sbjct  143  NALNDASLGGKIKVSTVHSMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINT  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>ref|XP_007042209.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX98040.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=511

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQVA+NLP P ATAKLLQSTSIEKVRLYGADPA+IKALANTGIGI+IG  NGD+P
Sbjct  24   IGVNYGQVADNLPPPSATAKLLQSTSIEKVRLYGADPAIIKALANTGIGIVIGATNGDVP  83

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            A+A+DP  A  W+ +NVL FYPASKI+ I VGNE+L + D NLI QLLPAMQN+QNALN+
Sbjct  84   ALASDPNSAAQWVNSNVLPFYPASKIILITVGNEVLMTNDPNLINQLLPAMQNVQNALNA  143

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            AS+GGK+KVSTVH M++L  S+PPSSG F P+   +LK LL F    G+PF INPYPFFA
Sbjct  144  ASLGGKVKVSTVHSMAVLSQSDPPSSGLFSPSYQPALKGLLQFQKENGSPFAINPYPFFA  203

Query  665  FQ  670
            +Q
Sbjct  204  YQ  205



>gb|KJB32499.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=484

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P ATAKLL+STSIEKVRLYGADPA+IKALANT IGI+IG AN
Sbjct  20   AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A+DP  A  WI +NVL FYPASKI+ I VGNE+L + D NLI QLLPAMQN+QN
Sbjct  80   GDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQN  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+N AS+GGKIKVSTVH M++L  S+PPSSG F P+   +LK LL F    G+PF INPY
Sbjct  140  AINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFHKDNGSPFAINPY  199

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  200  PFFAYQ  205



>ref|XP_010447074.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=507

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+SFIGVNYGQVA+NLP P  TAKLLQSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  24   AESFIGVNYGQVADNLPPPSETAKLLQSTSIQKVRLYGADPAIIKALAGTGVGIVIGAAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++A+DP  A  WI +NVL FYPASKI+ I VGNE+L S D NL+ QLLPAMQNLQ 
Sbjct  84   GDVPSLASDPNVAGQWINSNVLPFYPASKIILITVGNEVLLSNDPNLVNQLLPAMQNLQK  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH M++L SS+PPS+G F P     LK +L F+  TG+PF INPY
Sbjct  144  ALEAVSLGGKIKVSTVHAMTVLGSSDPPSAGSFAPGYQTGLKGILQFLSDTGSPFAINPY  203

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  204  PFFAYQ  209



>gb|AFK46350.1| unknown [Medicago truncatula]
Length=263

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIGVNYGQVA+NLP P ATA LL+STSI K+RLY ADP++IK+L+N+GIGI IG A
Sbjct  24   DSQSFIGVNYGQVADNLPPPSATANLLKSTSIGKLRLYNADPSIIKSLSNSGIGITIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A++P  A  W+ +NVL +YP+S I  I VGNE++ SGD  LI+ LLPA+QN+Q
Sbjct  84   NGDIPILASNPNSATQWVNSNVLPYYPSSNITLITVGNEVMTSGDNALISNLLPAIQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALNSAS+GGKIKVSTVH M++L  S+PPSSG FDP + D++K +L F+    APF INP
Sbjct  144  NALNSASLGGKIKVSTVHSMAVLTQSDPPSSGSFDPNLKDTMKQMLEFLKDNKAPFTINP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_006423251.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
 ref|XP_006487152.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Citrus sinensis]
 gb|ESR36491.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
Length=467

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P ATAKLLQSTSI+K+RLYGADPA+IKALANTG+GI+IG ++
Sbjct  27   SQSFIGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASS  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP  A  WI +NVL FYPASKI+ I VGNE++ S D+NLI+QLLPAM N+QN
Sbjct  87   GDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMANMQN  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN+AS+GGKIKVSTVH MS+L  S+PPSSG F     D+++ +L F+   G+PF INPY
Sbjct  147  ALNAASLGGKIKVSTVHAMSVLAQSDPPSSGSF--IRQDTMRGILQFLKDHGSPFTINPY  204

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  205  PFFAYQ  210



>ref|XP_004507424.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cicer arietinum]
Length=458

 Score =   263 bits (672),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIGVNYGQVA+NLP+P+ATA LL+ST+I KVRLYGADPA+IKALAN+GIGI+IG A
Sbjct  24   DSQSFIGVNYGQVADNLPSPDATAGLLKSTTIGKVRLYGADPAIIKALANSGIGIVIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++A++P  A  W+ +NVL +YPAS I  I VGNE++ SGD  LI+QLLPA+QN+Q
Sbjct  84   NGDIPSLASNPNSATQWVNSNVLPYYPASNITLITVGNEVMTSGDNGLISQLLPAIQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALNS S+GG IKVSTVH M++L  S+PPSSG FDPA+ D+LK LL F     +PF INP
Sbjct  144  NALNSVSLGG-IKVSTVHSMAVLTQSDPPSSGSFDPALQDTLKQLLEFQKDNKSPFTINP  202

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  203  YPFFAYQ  209



>ref|XP_004499144.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Cicer arietinum]
Length=485

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +++ F+GVNYGQVA+NLP P ATAKLLQSTSIEKVRLYG DPA+IKALANTGIGI+IG A
Sbjct  25   NSEPFLGVNYGQVADNLPPPSATAKLLQSTSIEKVRLYGTDPAIIKALANTGIGIVIGAA  84

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++A+DP +AK+WI +NV+ +YPAS I+ I VGNE++ S D NL+ Q+LPA+QN+Q
Sbjct  85   NGDIPSLASDPNFAKTWINSNVIPYYPASNIILITVGNEVITSNDTNLVNQMLPAIQNVQ  144

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL+S S+ GKIKVSTVH M++L  SEPPS+GRF P  +  L+ LLSF   TG+PF INP
Sbjct  145  NALDSVSLSGKIKVSTVHSMAVLKDSEPPSAGRFHPEYSVVLQSLLSFNKDTGSPFAINP  204

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  205  YPYFAYK  211



>ref|XP_004499143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Cicer arietinum]
Length=520

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +++ F+GVNYGQVA+NLP P ATAKLLQSTSIEKVRLYG DPA+IKALANTGIGI+IG A
Sbjct  25   NSEPFLGVNYGQVADNLPPPSATAKLLQSTSIEKVRLYGTDPAIIKALANTGIGIVIGAA  84

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++A+DP +AK+WI +NV+ +YPAS I+ I VGNE++ S D NL+ Q+LPA+QN+Q
Sbjct  85   NGDIPSLASDPNFAKTWINSNVIPYYPASNIILITVGNEVITSNDTNLVNQMLPAIQNVQ  144

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL+S S+ GKIKVSTVH M++L  SEPPS+GRF P  +  L+ LLSF   TG+PF INP
Sbjct  145  NALDSVSLSGKIKVSTVHSMAVLKDSEPPSAGRFHPEYSVVLQSLLSFNKDTGSPFAINP  204

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  205  YPYFAYK  211



>ref|XP_008466580.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Cucumis melo]
Length=478

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYGQVA+NLP P ATAKLLQSTSIEKVRLYGADPA+IKALANTGIGI+IG AN
Sbjct  25   SQSFIGINYGQVADNLPPPSATAKLLQSTSIEKVRLYGADPAIIKALANTGIGIVIGAAN  84

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+AADP +AK+W+ ANV  F+PASKI+ I VGNE++ S   NL+ QL+PA+QN+QN
Sbjct  85   GDIPALAADPNFAKNWVNANVAPFHPASKIILITVGNEVITSNQENLMNQLVPAIQNIQN  144

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALNS S+ G IKVSTVH M++L  SEPPSSG F P     LK+LL F +ATG+PF INPY
Sbjct  145  ALNSMSL-GDIKVSTVHSMAVLRQSEPPSSGMFHPNYMTVLKELLEFNNATGSPFTINPY  203

Query  653  PFFAFQ  670
            P+FA++
Sbjct  204  PYFAYR  209



>gb|AIR93913.1| glucanase [Cicer arietinum]
Length=460

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIGVNYGQVA+NLP+P+ATA LL+ST+I KVRLYGADPA+IKALAN+GIGI+IG A
Sbjct  24   DSQSFIGVNYGQVADNLPSPDATAGLLKSTTIGKVRLYGADPAIIKALANSGIGIVIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++A++P  A  W+ +NVL +YPAS I  I VGNE++ SGD  LI+QLLPA+QN+Q
Sbjct  84   NGDIPSLASNPNSATQWVNSNVLPYYPASNITLITVGNEVMTSGDNGLISQLLPAIQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALNS S+GG IKVSTVH M++L  S+PPSSG FDPA+ D+LK LL F     +PF INP
Sbjct  144  NALNSVSLGG-IKVSTVHSMAVLTQSDPPSSGSFDPALQDTLKQLLEFQKDNKSPFTINP  202

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  203  YPFFAYQ  209



>ref|XP_007131842.1| hypothetical protein PHAVU_011G045800g [Phaseolus vulgaris]
 gb|ESW03836.1| hypothetical protein PHAVU_011G045800g [Phaseolus vulgaris]
Length=459

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q FIGVNYGQVA++LPAPE +A+LL+ST++ KVRLYGADPA+IKALAN+GIGI+IGVAN
Sbjct  22   SQPFIGVNYGQVADDLPAPEVSAELLKSTTVGKVRLYGADPAIIKALANSGIGIVIGVAN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A+DP  A  W+ ANVL  YP S I  I VGNEI+ SGD  L +QLLPAMQN+QN
Sbjct  82   GDIPSLASDPDSATQWVNANVLPHYPESNITLIAVGNEIIKSGDDGLASQLLPAMQNVQN  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALNSAS+GGKIKVSTVH M++L  SEPPS+G FDPA+ D L+ L++F+    +PF INPY
Sbjct  142  ALNSASLGGKIKVSTVHSMAVLTQSEPPSAGSFDPALMDILQPLVAFLKNNESPFAINPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>ref|XP_006581121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Glycine max]
Length=459

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLPAPE TA LL+ST+I KVRLYGADPA+IKALAN+GIGI+IG A
Sbjct  26   ESQSFIGVNYGQVADNLPAPEDTANLLKSTTIGKVRLYGADPAIIKALANSGIGIVIGAA  85

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++AADP  A  W+ ANVL +YPAS I  I VGNEIL   D+ L++QL+PAM+N+Q
Sbjct  86   NGDIPSLAADPNAATQWVNANVLPYYPASNITLITVGNEILTLADQGLLSQLVPAMRNVQ  145

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL +AS+GGKI+VSTVH M++L  S+PPSSG F+PA+ D+LK LL+ +    +PF INP
Sbjct  146  NALGAASLGGKIRVSTVHSMAVLTQSDPPSSGLFNPALQDTLKQLLALLKDNKSPFTINP  205

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  206  YPFFAYQ  212



>ref|XP_004147788.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Cucumis sativus]
 gb|KGN59949.1| hypothetical protein Csa_3G855430 [Cucumis sativus]
Length=478

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYGQVA+NLP P ATAKLLQSTSIEKVRLYGADPA+IKALANTGIGI+IG AN
Sbjct  25   SQSFIGINYGQVADNLPPPSATAKLLQSTSIEKVRLYGADPAIIKALANTGIGIVIGAAN  84

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+AADP +AK+W+ ANV  F+PASKI+ I VGNE++ S   NL+ QL+PA+QN+QN
Sbjct  85   GDIPALAADPNFAKNWVNANVAPFHPASKIILITVGNEVITSNQDNLMNQLVPAIQNIQN  144

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALNS S+ G IKVSTVH M++L  SEPPSSG F P     LK+LL F +ATG+PF INPY
Sbjct  145  ALNSMSL-GDIKVSTVHSMAVLRQSEPPSSGMFHPNYMTVLKELLEFNNATGSPFTINPY  203

Query  653  PFFAFQ  670
            P+FA++
Sbjct  204  PYFAYR  209



>ref|XP_006581120.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Glycine max]
Length=480

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLPAPE TA LL+ST+I KVRLYGADPA+IKALAN+GIGI+IG A
Sbjct  47   ESQSFIGVNYGQVADNLPAPEDTANLLKSTTIGKVRLYGADPAIIKALANSGIGIVIGAA  106

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++AADP  A  W+ ANVL +YPAS I  I VGNEIL   D+ L++QL+PAM+N+Q
Sbjct  107  NGDIPSLAADPNAATQWVNANVLPYYPASNITLITVGNEILTLADQGLLSQLVPAMRNVQ  166

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL +AS+GGKI+VSTVH M++L  S+PPSSG F+PA+ D+LK LL+ +    +PF INP
Sbjct  167  NALGAASLGGKIRVSTVHSMAVLTQSDPPSSGLFNPALQDTLKQLLALLKDNKSPFTINP  226

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  227  YPFFAYQ  233



>ref|XP_004299094.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P +TAKLLQSTSI +VRLYG+DP +IKALANTGIGI+IG+A
Sbjct  21   ESQSFIGVNYGQVADNLPPPSSTAKLLQSTSIMQVRLYGSDPDVIKALANTGIGIVIGIA  80

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++AADP  A  WI ++V+ FYP+SKI  INVGNE+L S D+ LI+QLLPAM+N+Q
Sbjct  81   NGDIPSLAADPNAAAQWINSHVVPFYPSSKITLINVGNEVLLSNDQGLISQLLPAMRNVQ  140

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +AL++AS+GGK++VSTVH M++L  S+PPSSGRF+P + D LK LL+F     +PF +NP
Sbjct  141  SALSAASLGGKVRVSTVHAMTVLSQSDPPSSGRFNPGMLDVLKGLLAFQRDNASPFAVNP  200

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  201  YPFFAYQ  207



>ref|XP_006412222.1| hypothetical protein EUTSA_v10024968mg [Eutrema salsugineum]
 gb|ESQ53675.1| hypothetical protein EUTSA_v10024968mg [Eutrema salsugineum]
Length=504

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVANNLP P  TAKLLQSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  22   AEPFIGVNYGQVANNLPPPSETAKLLQSTSIQKVRLYGADPAIIKALAGTGVGIVIGAAN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++AADP  A  WI +NVL FYPASKI+ I VGNE+L S D NL+ QLLPAMQN+Q 
Sbjct  82   GDVPSLAADPNAATQWINSNVLPFYPASKIILITVGNEVLMSNDPNLVNQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH M++L +SEPPSSG F       LK +L F+  TG+PF INPY
Sbjct  142  ALETVSLGGKIKVSTVHAMTVLGNSEPPSSGSFASVYQTGLKGILQFLSDTGSPFAINPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>ref|XP_006595937.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Glycine max]
Length=431

 Score =   259 bits (663),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 157/187 (84%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIGVNYGQVA+NLP P ATAKLLQST+I KVRLYG DPA+IKALANTGIGI+IG AN
Sbjct  28   SESFIGVNYGQVADNLPPPSATAKLLQSTAIGKVRLYGTDPAIIKALANTGIGIVIGAAN  87

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP +A+DP +AK+W+  NV+ +YPAS I+ I VGNE++ S D+NL+ Q+LPA+QN+Q 
Sbjct  88   GDIPGLASDPNFAKTWVNTNVVPYYPASNIILITVGNEVITSNDQNLVNQMLPAIQNVQG  147

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL++AS+ GGKIKVSTVH MS+L  SEPPS+GRF P     L+ LLSF +ATG+PF INP
Sbjct  148  ALDAASLGGGKIKVSTVHAMSVLRDSEPPSAGRFHPEYDTVLQGLLSFNNATGSPFTINP  207

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  208  YPYFAYR  214



>ref|XP_009374179.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Pyrus x bretschneideri]
Length=459

 Score =   260 bits (665),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIGVNYGQVA+NLP P  TAKLLQST+I++VRLYGADPA+IKALA +GI I IG A
Sbjct  24   DSQSFIGVNYGQVADNLPPPSDTAKLLQSTAIKRVRLYGADPAIIKALAGSGIAIAIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+PA+A+DP  A  W+ +NVL FYPASKI  INVGNE+L S D+ LI+QLLPAM+N+Q
Sbjct  84   NGDLPALASDPNAAAQWVNSNVLPFYPASKIDLINVGNEVLLSNDQGLISQLLPAMRNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +AL++AS+GGK++VSTVH M++L  S+PPSSG F+P   D LK LL+F    G+PF +NP
Sbjct  144  SALSAASLGGKVRVSTVHSMAVLAQSDPPSSGLFNPGFQDVLKGLLAFQRDNGSPFAVNP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_009374190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=459

 Score =   260 bits (665),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIGVNYGQVA+NLP P  TAKLLQST+I+++RL+G+DPA+IKALA +GI I IG A
Sbjct  24   DSQSFIGVNYGQVADNLPPPSDTAKLLQSTAIKRIRLFGSDPAIIKALAGSGIAIAIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+PA+A+DP  A  W+ +NVL FYPASKI  INVGNE+L S D+ LI+QLLPAM+N+Q
Sbjct  84   NGDLPALASDPNAAAQWVNSNVLPFYPASKIDLINVGNEVLLSNDQGLISQLLPAMRNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +AL++AS+GGK++VSTVH M++L  S+PPSSGRF+P   D LK LL+F    G+PF +NP
Sbjct  144  SALSAASLGGKVRVSTVHSMAVLSQSDPPSSGRFNPGFQDVLKGLLAFQRDNGSPFAVNP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_003544417.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Glycine max]
Length=484

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 157/187 (84%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIGVNYGQVA+NLP P ATAKLLQST+I KVRLYG DPA+IKALANTGIGI+IG AN
Sbjct  28   SESFIGVNYGQVADNLPPPSATAKLLQSTAIGKVRLYGTDPAIIKALANTGIGIVIGAAN  87

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP +A+DP +AK+W+  NV+ +YPAS I+ I VGNE++ S D+NL+ Q+LPA+QN+Q 
Sbjct  88   GDIPGLASDPNFAKTWVNTNVVPYYPASNIILITVGNEVITSNDQNLVNQMLPAIQNVQG  147

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL++AS+ GGKIKVSTVH MS+L  SEPPS+GRF P     L+ LLSF +ATG+PF INP
Sbjct  148  ALDAASLGGGKIKVSTVHAMSVLRDSEPPSAGRFHPEYDTVLQGLLSFNNATGSPFTINP  207

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  208  YPYFAYR  214



>ref|XP_010444969.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
7-like [Camelina sativa]
Length=507

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+SFIGVNYGQVA+NLP P  TAKLL STSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  23   AESFIGVNYGQVADNLPPPSETAKLLXSTSIQKVRLYGADPAIIKALAGTGVGIVIGAAN  82

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++A+DP  A  WI +NVL FYPASKI+ I VGNE+L S D NL+ QLLPAMQNLQ 
Sbjct  83   GDVPSLASDPNAAGQWINSNVLPFYPASKIILITVGNEVLLSNDPNLVNQLLPAMQNLQK  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH M++L +S+PPS+G F P     LK +L F+  TG+PF INPY
Sbjct  143  ALEAVSLGGKIKVSTVHAMTVLGNSDPPSAGSFAPGYQTGLKGILQFLSDTGSPFAINPY  202

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  203  PFFAYQ  208



>ref|XP_010432409.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=507

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+SFIGVNYGQVA+NLP P  TAKLLQSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  24   AESFIGVNYGQVADNLPPPSETAKLLQSTSIQKVRLYGADPAIIKALAGTGVGIVIGAAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++A+DP  A  WI +NVL FYPASKI+ I VGNE+L S D NL+ QLLPAMQNLQ 
Sbjct  84   GDVPSLASDPNAAAQWINSNVLPFYPASKIILITVGNEVLMSNDPNLVNQLLPAMQNLQK  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH M++L +S+PPS+G F       LK +L F+  TG+PF INPY
Sbjct  144  ALEAVSLGGKIKVSTVHAMTVLGNSDPPSAGSFAAGYQTGLKGILQFLSDTGSPFAINPY  203

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  204  PFFAYQ  209



>ref|XP_008377317.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=459

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIGVNYGQVA+NLP P  TAKLLQST+I++VRLYGADPA+IKALA +GI I IG +
Sbjct  24   DSQSFIGVNYGQVADNLPPPSETAKLLQSTAIKRVRLYGADPAIIKALAGSGIAIAIGAS  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP  A  W+ +NVL FYPASKI  INVGNE+L S D+ LI+QLLPAM+N+ 
Sbjct  84   NGDIPALASDPNAAAQWVNSNVLPFYPASKIDLINVGNEVLLSNDQGLISQLLPAMRNVL  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +AL++AS+GGK++VSTVH M++L  S+PPSSG+F+P   D LK LL+F    G+PF +NP
Sbjct  144  SALSAASLGGKVRVSTVHSMAVLAQSDPPSSGQFNPGFQDVLKGLLAFQRDNGSPFAVNP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>ref|XP_007160761.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
 gb|ESW32755.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
Length=425

 Score =   257 bits (656),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIGVNYGQVA+NLP P ATAKLLQST+I KVRLYG DPA+I+ALANTGIGI+IG AN
Sbjct  23   SESFIGVNYGQVADNLPPPAATAKLLQSTAIGKVRLYGTDPAIIQALANTGIGIVIGAAN  82

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP +A+DP +AK+W+  NV+ +YPAS I+ + VGNE++ S D  L+ Q+LPA+QN+Q 
Sbjct  83   GDIPGLASDPNFAKTWVNTNVVPYYPASNIILVTVGNEVITSNDTGLVNQMLPAIQNVQG  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +AS+GGK+KVSTVH M++L  SEPPS+GRF P     L+ LLSF +ATG+PF INPY
Sbjct  143  ALEAASLGGKVKVSTVHSMAVLRDSEPPSAGRFHPEYNTVLQGLLSFNNATGSPFTINPY  202

Query  653  PFFAFQ  670
            P+FA++
Sbjct  203  PYFAYR  208



>ref|XP_007160762.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
 gb|ESW32756.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
Length=473

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++SFIGVNYGQVA+NLP P ATAKLLQST+I KVRLYG DPA+I+ALANTGIGI+IG AN
Sbjct  23   SESFIGVNYGQVADNLPPPAATAKLLQSTAIGKVRLYGTDPAIIQALANTGIGIVIGAAN  82

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP +A+DP +AK+W+  NV+ +YPAS I+ + VGNE++ S D  L+ Q+LPA+QN+Q 
Sbjct  83   GDIPGLASDPNFAKTWVNTNVVPYYPASNIILVTVGNEVITSNDTGLVNQMLPAIQNVQG  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +AS+GGK+KVSTVH M++L  SEPPS+GRF P     L+ LLSF +ATG+PF INPY
Sbjct  143  ALEAASLGGKVKVSTVHSMAVLRDSEPPSAGRFHPEYNTVLQGLLSFNNATGSPFTINPY  202

Query  653  PFFAFQ  670
            P+FA++
Sbjct  203  PYFAYR  208



>gb|EPS70348.1| hypothetical protein M569_04409 [Genlisea aurea]
Length=448

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 158/186 (85%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P ATA  L+STSI+KVRLYGADPA+IKALANTGIGI+IG AN
Sbjct  35   SQSFIGVNYGQVADNLPPPAATANFLKSTSIQKVRLYGADPAIIKALANTGIGIVIGAAN  94

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++AADP +A +W+ +NV+ +YPAS+I+ ++VGNE++ S D NL++QL+PAM N+QN
Sbjct  95   GDIPSLAADPNFAGNWVYSNVIVYYPASQIIAVSVGNEVVTSPDPNLVSQLVPAMLNIQN  154

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN+AS+GGK+KVSTVH M++L  S+PPSSG F     D++K +L F  A G+PF+INPY
Sbjct  155  ALNAASLGGKVKVSTVHSMAVLSQSDPPSSGAF--GYPDTMKAILQFFSANGSPFMINPY  212

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  213  PFFAYQ  218



>ref|XP_010690895.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=495

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSF+G+NYG+VA+NLP PE TAKLL+ST   KVRLYGADPA+IKALANTGIGI+IG AN
Sbjct  29   SQSFLGINYGEVADNLPPPETTAKLLKSTPFSKVRLYGADPAIIKALANTGIGIVIGAAN  88

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +A  WI +NVLAF P SKI+ I VGNE++ SGD+NLI+QL+PAMQN+Q+
Sbjct  89   GDIPALASDPSHATQWINSNVLAF-PDSKIILITVGNEVISSGDQNLISQLVPAMQNIQD  147

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN+A +GGKI+VSTVH M+++  S+PPSSG F+  + D +K LL F    G+PF INPY
Sbjct  148  ALNAAKLGGKIQVSTVHSMAVMGQSDPPSSGAFNSELVDFMKKLLEFQKENGSPFTINPY  207

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  208  PFFAYQ  213



>ref|XP_003606895.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES89092.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=464

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIGVNYGQVA+NLP P ATA LL+STSI K+RLY ADP++IK+L+N+GIGI IG A
Sbjct  24   DSQSFIGVNYGQVADNLPPPSATANLLKSTSIGKLRLYNADPSIIKSLSNSGIGITIGAA  83

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A++P  A  W+ +NVL +YP+S I  I VGNE++ SGD  LI+ LLPA+QN+Q
Sbjct  84   NGDIPILASNPNSATQWVNSNVLPYYPSSNITLITVGNEVMTSGDNALISNLLPAIQNVQ  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALNSAS+GGKIKVSTVH M++L  S+PPSSG FDP + D++K +L F+    APF INP
Sbjct  144  NALNSASLGGKIKVSTVHSMAVLTQSDPPSSGSFDPNLKDTMKQMLEFLKDNKAPFTINP  203

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  204  YPFFAYQ  210



>gb|KFK30062.1| hypothetical protein AALP_AA7G211800 [Arabis alpina]
Length=503

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+SFIGVNYGQVA+NLP P  TAKLLQSTSI+KVRLYGADPA+IKALA T IGI+IG AN
Sbjct  23   AESFIGVNYGQVADNLPPPSETAKLLQSTSIQKVRLYGADPAIIKALAGTNIGIVIGAAN  82

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++A+DP  A  WI +NVL FYPASKI+ INVGNE+  S D NL+ QLLPAMQN+Q 
Sbjct  83   GDLPSLASDPNAATQWINSNVLPFYPASKIILINVGNEVSMSTDPNLVNQLLPAMQNVQK  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH MS+L +S+PPSSG F       LK +L F+  TG+PF+INPY
Sbjct  143  ALEAVSLGGKIKVSTVHAMSVLGNSDPPSSGSFAAGYQAGLKGILQFLSDTGSPFVINPY  202

Query  653  PFFAFQ  670
            PFFA++
Sbjct  203  PFFAYR  208



>ref|XP_010690894.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSF+G+NYG+VA+NLP PE TAKLL+ST   KVRLYGADPA+IKALANTGIGI+IG AN
Sbjct  29   SQSFLGINYGEVADNLPPPETTAKLLKSTPFSKVRLYGADPAIIKALANTGIGIVIGAAN  88

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+A+DP +A  WI +NVLAF P SKI+ I VGNE++ SGD+NLI+QL+PAMQN+Q+
Sbjct  89   GDIPALASDPSHATQWINSNVLAF-PDSKIILITVGNEVISSGDQNLISQLVPAMQNIQD  147

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN+A +GGKI+VSTVH M+++  S+PPSSG F+  + D +K LL F    G+PF INPY
Sbjct  148  ALNAAKLGGKIQVSTVHSMAVMGQSDPPSSGAFNSELVDFMKKLLEFQKENGSPFTINPY  207

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  208  PFFAYQ  213



>ref|XP_003522947.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Glycine max]
Length=459

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLPAPE TA LL+ST+I KVRLYGADPA+IKALAN+GIGI+IG +
Sbjct  25   ESQSFIGVNYGQVADNLPAPEDTASLLKSTTIGKVRLYGADPAIIKALANSGIGIVIGAS  84

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDI ++A DP  A  W+ ANVL +YPAS I  I VGNEIL   D+ L +QL+PAM+N+Q
Sbjct  85   NGDIASLAGDPNAATQWVNANVLPYYPASNITLITVGNEILTLADQGLKSQLVPAMRNVQ  144

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL +AS+GGKIKVSTVH M++L  S+PPSSG F+PA+ D+LK LL+ +    +PF INP
Sbjct  145  NALGAASLGGKIKVSTVHSMAVLTQSDPPSSGLFNPALQDTLKQLLALLKDNKSPFTINP  204

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  205  YPFFAYQ  211



>gb|ACJ84511.1| unknown [Medicago truncatula]
Length=407

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSF+GVNYGQ A+NLP PEATAKLLQST+I KVR+YGADPA+IK+LAN+GIGI+IG A
Sbjct  23   DSQSFVGVNYGQTADNLPPPEATAKLLQSTTIGKVRIYGADPAIIKSLANSGIGIVIGAA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            N D+P++A+DP  A  WI  NVL +YPAS I  I VGNE+L SGD  L++QL+PA++N+Q
Sbjct  83   NNDVPSLASDPNAATQWINTNVLPYYPASNITLITVGNEVLNSGDEGLVSQLMPAIRNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL+S  +GGK+KV+TVH M++L  S+PPSSG F+PA+ ++L  LL+F+    +PF +NP
Sbjct  143  TALSSVKLGGKVKVTTVHSMAVLAQSDPPSSGSFNPALRNTLNQLLAFLKDNKSPFTVNP  202

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  203  YPFFAYQ  209



>ref|XP_003603912.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES74163.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=459

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSF+GVNYGQ A+NLP PEATAKLLQST+I KVR+YGADPA+IK+LAN+GIGI+IG A
Sbjct  23   DSQSFVGVNYGQTADNLPPPEATAKLLQSTTIGKVRIYGADPAIIKSLANSGIGIVIGAA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            N DIP++A+DP  A  WI  NVL +YPAS I  I VGNE+L SGD  L++QL+PA++N+Q
Sbjct  83   NNDIPSLASDPNAATQWINTNVLPYYPASNITLITVGNEVLNSGDEGLVSQLMPAIRNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL+S  +GGK+KV+TVH M++L  S+PPSSG F+PA+ ++L  LL+F+    +PF +NP
Sbjct  143  TALSSVKLGGKVKVTTVHSMAVLAQSDPPSSGSFNPALRNTLNQLLAFLKDNKSPFTVNP  202

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  203  YPFFAYQ  209



>ref|XP_003603913.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=477

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSF+GVNYGQ A+NLP PEATAKLLQST+I KVR+YGADPA+IK+LAN+GIGI+IG A
Sbjct  41   DSQSFVGVNYGQTADNLPPPEATAKLLQSTTIGKVRIYGADPAIIKSLANSGIGIVIGAA  100

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            N DIP++A+DP  A  WI  NVL +YPAS I  I VGNE+L SGD  L++QL+PA++N+Q
Sbjct  101  NNDIPSLASDPNAATQWINTNVLPYYPASNITLITVGNEVLNSGDEGLVSQLMPAIRNVQ  160

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL+S  +GGK+KV+TVH M++L  S+PPSSG F+PA+ ++L  LL+F+    +PF +NP
Sbjct  161  TALSSVKLGGKVKVTTVHSMAVLAQSDPPSSGSFNPALRNTLNQLLAFLKDNKSPFTVNP  220

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  221  YPFFAYQ  227



>ref|XP_009123249.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brassica rapa]
 emb|CDY37244.1| BnaA09g08650D [Brassica napus]
Length=512

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            DA+SFIGVNYG +A+NLP+P   AKLLQSTSI+KVRLYGADP +IK+LA TG+GI+IGVA
Sbjct  21   DAESFIGVNYGLLADNLPSPSDAAKLLQSTSIQKVRLYGADPTIIKSLAGTGVGIVIGVA  80

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WIG NVL FYPAS I+ INVGNEIL S D NL++QLLPAMQN+Q
Sbjct  81   NGDLPSLASDLNVASQWIGTNVLPFYPASDIILINVGNEILLSNDLNLVSQLLPAMQNVQ  140

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+GGKIKVSTVH M++L  S+PPS+G F P     LK +L F+  TG+PF+INP
Sbjct  141  KALEAVSLGGKIKVSTVHAMTVLGQSDPPSAGSFAPGYQAGLKGILQFLSETGSPFVINP  200

Query  650  YPFFAF  667
            YPFFA+
Sbjct  201  YPFFAY  206



>ref|XP_010489192.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Camelina sativa]
Length=393

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +AQSFIGVNYG +A+NLPAP  TAKLLQSTSI+KVRLY ADP++IK+LA TGIGI+IGVA
Sbjct  20   NAQSFIGVNYGLLADNLPAPSETAKLLQSTSIQKVRLYNADPSIIKSLAGTGIGIVIGVA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WI +NVL FYPAS I+ INVGNE+L S D NL+ QLLPAMQN+Q
Sbjct  80   NGDLPSIASDLNVASQWISSNVLPFYPASNIILINVGNELLLSNDLNLVNQLLPAMQNIQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+GGKIKVSTVH M++L +SEPPS+G F  +    LK +L F+  TG+PF INP
Sbjct  140  KALEAVSLGGKIKVSTVHAMTVLGNSEPPSAGSFALSYQAGLKVILQFLSDTGSPFAINP  199

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  200  YPFFAYQ  206



>ref|XP_004500813.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cicer arietinum]
Length=440

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSF+GVNYGQ+A+NLP P+AT KLLQST+I KVR+YGADP  +KA AN+G+GI+IG A
Sbjct  20   ESQSFVGVNYGQIADNLPPPDATVKLLQSTTIGKVRIYGADPTTLKAFANSGMGIVIGAA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++A+DP  A  WI +NVL +YPAS I  I VGNE+L SGD+ L++QL+PA++N+Q
Sbjct  80   NGDIPSLASDPNAATQWINSNVLPYYPASNITLITVGNEVLTSGDQGLVSQLVPAIRNVQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +AL+SAS+GG++KVSTVH M++L+ S+PPSSG F+PA+  ++  LL+F+    +PF+INP
Sbjct  140  SALSSASLGGRVKVSTVHSMAVLIQSDPPSSGSFNPALQQTMNQLLAFLRDNKSPFMINP  199

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  200  YPYFAYQ  206



>ref|XP_010107844.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
 gb|EXC17244.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
Length=479

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSF+GVNYGQVA+ LP+P ATA LL+STSI+KVRLYGADPA+I ALANTGIGI+IG +
Sbjct  27   DSQSFVGVNYGQVADTLPSPAATANLLRSTSIKKVRLYGADPAIITALANTGIGIVIGAS  86

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A+DP  A  W+ +NV+ FYP+S I  + +GNE+L  GD  L +QLLPAM+N+Q
Sbjct  87   NGDIPALASDPNAATQWVKSNVVPFYPSSDITLVTLGNEVLTVGDGALASQLLPAMRNVQ  146

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL +A +GGK++VSTVH MS+L  S+PPSSGRF P + D+L+ +L+F+   G+PF INP
Sbjct  147  NALATAGLGGKVRVSTVHVMSVLGQSDPPSSGRFRPELEDTLRGVLAFLRDNGSPFAINP  206

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  207  YPFFAYQ  213



>ref|XP_007136171.1| hypothetical protein PHAVU_009G024000g [Phaseolus vulgaris]
 gb|ESW08165.1| hypothetical protein PHAVU_009G024000g [Phaseolus vulgaris]
Length=457

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 156/187 (83%), Gaps = 2/187 (1%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P++TA LL+STSI KVRLYGADPA+IKALAN+GIGI+IG A
Sbjct  22   NSQSFIGVNYGQVADNLPPPDSTAGLLKSTSIGKVRLYGADPAIIKALANSGIGIVIGAA  81

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++A+DP  A  W+ ANVL +YPAS I  I VGNEIL   D++L++QL+PAM+NLQ
Sbjct  82   NGDIPSLASDPNAATQWVNANVLPYYPASNITLITVGNEILTLADQSLVSQLVPAMRNLQ  141

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+ASV  KIKVSTVH M++L  S+PPSSG F+PA+ ++LK LL+ +    +PF INP
Sbjct  142  NALNAASV--KIKVSTVHSMAVLTQSDPPSSGLFNPALQNTLKQLLAVLKDNKSPFTINP  199

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  200  YPFFAYQ  206



>gb|AIR93908.1| glucanase [Cicer arietinum]
Length=454

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSF+GVNYGQ+A+NLP P+AT KLLQST+I KVR+YGADP  +KA AN+G+GI+IG A
Sbjct  20   ESQSFVGVNYGQIADNLPPPDATVKLLQSTTIGKVRIYGADPTTLKAFANSGMGIVIGAA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP++A+DP  A  WI +NVL +YPAS I  I VGNE+L SGD+ L++QL+PA++N+Q
Sbjct  80   NGDIPSLASDPNAATQWINSNVLPYYPASNITLITVGNEVLTSGDQGLVSQLVPAIRNVQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +AL+SAS+GG++KVSTVH M++L+ S+PPSSG F+PA+  ++  LL+F+    +PF+INP
Sbjct  140  SALSSASLGGRVKVSTVHSMAVLIQSDPPSSGSFNPALQQTMNQLLAFLRDNKSPFMINP  199

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  200  YPYFAYQ  206



>ref|XP_010489191.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Camelina sativa]
Length=424

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +AQSFIGVNYG +A+NLPAP  TAKLLQSTSI+KVRLY ADP++IK+LA TGIGI+IGVA
Sbjct  20   NAQSFIGVNYGLLADNLPAPSETAKLLQSTSIQKVRLYNADPSIIKSLAGTGIGIVIGVA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WI +NVL FYPAS I+ INVGNE+L S D NL+ QLLPAMQN+Q
Sbjct  80   NGDLPSIASDLNVASQWISSNVLPFYPASNIILINVGNELLLSNDLNLVNQLLPAMQNIQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+GGKIKVSTVH M++L +SEPPS+G F  +    LK +L F+  TG+PF INP
Sbjct  140  KALEAVSLGGKIKVSTVHAMTVLGNSEPPSAGSFALSYQAGLKVILQFLSDTGSPFAINP  199

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  200  YPFFAYQ  206



>ref|XP_010467346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Camelina sativa]
Length=503

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +AQSFIGVNYG +A+NLP+P  TAKLLQSTSI+KVRLY ADP++IK+LA TGIGI+IGVA
Sbjct  20   NAQSFIGVNYGLLADNLPSPSETAKLLQSTSIQKVRLYNADPSIIKSLAGTGIGIVIGVA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WI +NVL FYPAS I+ INVGNE+L S D NL+ QLLPAMQN+Q
Sbjct  80   NGDLPSVASDLNVASQWISSNVLPFYPASNIILINVGNELLLSNDLNLVNQLLPAMQNIQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            N+L + S+GGKIKVSTVH M++L +SEPPS+G F  +    LK +L F+  TG+PF INP
Sbjct  140  NSLEAVSLGGKIKVSTVHAMTVLGNSEPPSAGSFALSYQAGLKGILQFLSDTGSPFAINP  199

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  200  YPFFAYQ  206



>gb|EPS59066.1| hypothetical protein M569_15744, partial [Genlisea aurea]
Length=440

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 156/186 (84%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYG+VA+NLP P +TA LL+STS+ KVRLYGADPA+IKALANTGIGI+IG AN
Sbjct  16   SQSFIGVNYGEVADNLPPPASTANLLKSTSVGKVRLYGADPAIIKALANTGIGIVIGAAN  75

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++AADP +A +W+  NV+A+YP S+I  +++GNE++ S D NL +QL+PAMQN+QN
Sbjct  76   GDIPSLAADPNFAGNWVYTNVMAYYPTSQITVVSIGNEVVTSPDPNLASQLVPAMQNVQN  135

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++AS+GGK+KVSTVH M++L  S+PPSSG F     D+++ LL F  A G+PF+INPY
Sbjct  136  ALDAASLGGKVKVSTVHSMAVLSQSDPPSSGTF--GYGDTMRALLQFHKANGSPFMINPY  193

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  194  PFFAYQ  199



>emb|CDY26761.1| BnaC09g08880D [Brassica napus]
Length=512

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            DA SFIGVNYG +A+NLP+P   AKL+QS+SI+KVRLYGADP +IK+LA TG+GI+IGVA
Sbjct  21   DADSFIGVNYGLLADNLPSPSDAAKLIQSSSIQKVRLYGADPTIIKSLAGTGVGIVIGVA  80

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WIG NVL FYPAS I+ INVGNEIL S D NL++QLLPAMQN+Q
Sbjct  81   NGDLPSLASDLNVASQWIGTNVLPFYPASDIILINVGNEILLSNDLNLVSQLLPAMQNVQ  140

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+GGKIKVSTVH M++L  S+PPS+G F P     LK +L F+  TG+PF+INP
Sbjct  141  KALEAVSLGGKIKVSTVHAMTVLGQSDPPSAGSFAPGYQAGLKGILQFLSETGSPFVINP  200

Query  650  YPFFAF  667
            YPFFA+
Sbjct  201  YPFFAY  206



>emb|CAN61862.1| hypothetical protein VITISV_043447 [Vitis vinifera]
Length=479

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  170  EATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIPAMAADPGYAKSWIGA  349
            +ATAKLL+STSIEKVRLYGADP +IKALANTGIGI+IG ANGDIPA+A+DP +A  W+ +
Sbjct  63   KATAKLLKSTSIEKVRLYGADPGIIKALANTGIGIVIGAANGDIPALASDPNFAAQWVNS  122

Query  350  NVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNSASVGGKIKVSTVHGM  529
            NV+A+YPASKI+ I VGNE++ S D+NL++QLLPAMQN+QNALN+AS+GGKIKVSTVH M
Sbjct  123  NVIAYYPASKIILITVGNEVMSSTDQNLMSQLLPAMQNVQNALNAASLGGKIKVSTVHSM  182

Query  530  SMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFAFQ  670
            ++L  S+PPSSG F+PA +D+++ LL F   TG+PF INPYPFFA+Q
Sbjct  183  AVLTQSDPPSSGAFNPATSDTMRGLLEFQRNTGSPFAINPYPFFAYQ  229



>ref|XP_010423738.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=523

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +AQSFIGVNYG +A+NLP P  TAKLLQSTSI+KVRLY ADP++IK+LA TGIGI+IGVA
Sbjct  20   NAQSFIGVNYGLLADNLPPPSETAKLLQSTSIQKVRLYNADPSIIKSLAGTGIGIVIGVA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WI +NVL FYPAS I+ INVGNE+L S D NL+ QLLPAMQN+Q
Sbjct  80   NGDLPSVASDLNVASQWISSNVLPFYPASNIILINVGNELLLSNDLNLVNQLLPAMQNIQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+GGKIKVSTVH M++L +SEPPS+G F  +    LK +L F+  TG+PF INP
Sbjct  140  KALEAVSLGGKIKVSTVHAMTVLGNSEPPSAGSFALSYQAGLKGILQFLSDTGSPFAINP  199

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  200  YPFFAYQ  206



>gb|KEH40122.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=417

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +2

Query  122  FIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDI  301
            F+GVNYGQVA+NLP   ATAKLLQ+T+ EKVRLYG DPA+IK+LANTGIGI+IG ANGDI
Sbjct  23   FLGVNYGQVADNLPPASATAKLLQTTAFEKVRLYGTDPAIIKSLANTGIGIVIGAANGDI  82

Query  302  PAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALN  481
            P++A+DP +AK+WI  NVL +YPAS I+ I VGNE++ S D NLI  +LPA+QN+Q AL+
Sbjct  83   PSLASDPSFAKTWISTNVLPYYPASNIILITVGNEVITSNDTNLINGMLPAIQNIQKALD  142

Query  482  SASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFF  661
             AS+GGKI+VSTVH MS+L +SEPPS+G F    +  L+ LLSF   TG+PF INPYP+F
Sbjct  143  EASLGGKIRVSTVHTMSVLKNSEPPSAGSFHDEYSTVLQGLLSFNKDTGSPFAINPYPYF  202

Query  662  AFQ  670
            A++
Sbjct  203  AYK  205



>emb|CDY22386.1| BnaA06g37080D [Brassica napus]
Length=432

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q FIGVNYGQ A+NLP P ATAKLLQSTSI+KVRLYG+DPA+IKALANTGI I+IG   
Sbjct  24   SQPFIGVNYGQTADNLPPPSATAKLLQSTSIQKVRLYGSDPAIIKALANTGIEIVIGT--  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DP +A+SW+  NV+ +YPASKI  I+VGNE    GDRN + QLLPAM+N+Q+
Sbjct  82   GDVPGLASDPSFARSWVETNVVPYYPASKITLIDVGNEATTFGDRNFMLQLLPAMKNVQS  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +AS+GGKIKVSTVH MS+L  S+PPS+G F     D LK LL F   TG+PF +NPY
Sbjct  142  ALEAASLGGKIKVSTVHTMSILSQSDPPSAGVFAADHADILKGLLEFNRETGSPFAVNPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>dbj|BAE99425.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=253

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q F+GVNYG  A+NLP P A+AKLLQST+ +KVRLYG+DPA+IKALANTGI I+IG +N
Sbjct  22   SQPFLGVNYGLTADNLPPPSASAKLLQSTTFQKVRLYGSDPAVIKALANTGIEIVIGASN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DP +A+SW+  NV+ +YPASKI+ I VGNEI   GD +L++QLLPAM+N+Q 
Sbjct  82   GDVPGLASDPSFARSWVETNVVPYYPASKIVLIAVGNEITSFGDNSLMSQLLPAMKNVQT  141

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL +AS+ GGKIKVSTVH MS+L  S+PPS+  F P   D LK LL F   TG+PF +NP
Sbjct  142  ALEAASLGGGKIKVSTVHIMSVLAGSDPPSTAVFKPEHADILKGLLEFNSETGSPFAVNP  201

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  202  YPFFAYQ  208



>ref|XP_009101841.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brassica rapa]
Length=432

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q FIGVNYGQ A+NLP P ATAKLLQSTSI+KVRLYG+DPA+IKALANTGI I+IG   
Sbjct  24   SQPFIGVNYGQTADNLPPPSATAKLLQSTSIQKVRLYGSDPAIIKALANTGIEIVIGT--  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DP +A+SW+  NV+ +YPASKI  I+VGNE    GDRN + QLLPAM+N+Q+
Sbjct  82   GDVPGLASDPSFARSWVETNVVPYYPASKITLIDVGNEATTFGDRNFMLQLLPAMKNVQS  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +AS+GGKIKVSTVH MS+L  S+PPS+G F     D LK LL F   TG+PF +NPY
Sbjct  142  ALEAASLGGKIKVSTVHTMSILSQSDPPSAGVFAADHADILKGLLEFNRETGSPFAVNPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>ref|XP_002886212.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62471.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +AQSFIGVNYG +A+NLP P  TAKLLQSTSIEKVRLY ADP++IK+LA T IGI+IGVA
Sbjct  20   NAQSFIGVNYGLLADNLPPPSETAKLLQSTSIEKVRLYNADPSIIKSLAGTDIGIVIGVA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WI +NVL FYPAS I+ INVGNE+L S D NL+ QLLPAMQN+Q
Sbjct  80   NGDLPSIASDFNVASQWINSNVLPFYPASNIILINVGNEVLLSNDLNLVNQLLPAMQNVQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+G KIKVSTVH M++L +SEPPS+G F P+    LK +L F+  T +PF INP
Sbjct  140  KALEAVSLGRKIKVSTVHAMTVLGNSEPPSAGSFAPSYQAGLKGILQFLSDTESPFAINP  199

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  200  YPFFAYQ  206



>gb|KJB34916.1| hypothetical protein B456_006G090600 [Gossypium raimondii]
Length=448

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQ A+NLP P AT +LL+STSIEKVRLYGADP +IKALANT IGI+IG AN
Sbjct  20   AEPFIGVNYGQEADNLPPPLATVELLKSTSIEKVRLYGADPVIIKALANTEIGIVIGAAN  79

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP +A+DP  A  W+ +NVL FYP SKI+ + VGNE+L + D NLI QLLPAMQN+QN
Sbjct  80   GDIPCLASDPNSAVQWVNSNVLPFYPDSKIILVTVGNEVLTTNDPNLIDQLLPAMQNMQN  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+  A +GGKIKVSTVH M++L  S+PPSSG F P+   +L+ LL F    G+PF +NPY
Sbjct  140  AITGALLGGKIKVSTVHSMAVLGQSDPPSSGCFSPSYEPALRGLLRFHSDNGSPFAVNPY  199

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  200  PFFAYQ  205



>ref|XP_009138297.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Brassica rapa]
Length=528

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P  TAKL+QSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  22   AEPFIGVNYGQVADNLPPPSETAKLIQSTSIQKVRLYGADPAIIKALAGTGVGIVIGTAN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++AADP  A  WI +NVL FYPASKI+ I VGNE+L S D NL++QLLPAMQN+Q 
Sbjct  82   GDLPSLAADPNAASQWISSNVLPFYPASKIILITVGNEVLLSKDPNLVSQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH MS+L SSEPPSSG F       LKD+L F+  TG+PF INPY
Sbjct  142  ALEAVSLGGKIKVSTVHAMSVLGSSEPPSSGSFASGYQAGLKDILQFLSDTGSPFAINPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>ref|XP_009138298.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Brassica rapa]
 ref|XP_009138299.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X3 
[Brassica rapa]
Length=505

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P  TAKL+QSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  22   AEPFIGVNYGQVADNLPPPSETAKLIQSTSIQKVRLYGADPAIIKALAGTGVGIVIGTAN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++AADP  A  WI +NVL FYPASKI+ I VGNE+L S D NL++QLLPAMQN+Q 
Sbjct  82   GDLPSLAADPNAASQWISSNVLPFYPASKIILITVGNEVLLSKDPNLVSQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH MS+L SSEPPSSG F       LKD+L F+  TG+PF INPY
Sbjct  142  ALEAVSLGGKIKVSTVHAMSVLGSSEPPSSGSFASGYQAGLKDILQFLSDTGSPFAINPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>gb|KEH40124.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=486

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +2

Query  122  FIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDI  301
            F+GVNYGQVA+NLP   ATAKLLQ+T+ EKVRLYG DPA+IK+LANTGIGI+IG ANGDI
Sbjct  23   FLGVNYGQVADNLPPASATAKLLQTTAFEKVRLYGTDPAIIKSLANTGIGIVIGAANGDI  82

Query  302  PAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALN  481
            P++A+DP +AK+WI  NVL +YPAS I+ I VGNE++ S D NLI  +LPA+QN+Q AL+
Sbjct  83   PSLASDPSFAKTWISTNVLPYYPASNIILITVGNEVITSNDTNLINGMLPAIQNIQKALD  142

Query  482  SASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFF  661
             AS+GGKI+VSTVH MS+L +SEPPS+G F    +  L+ LLSF   TG+PF INPYP+F
Sbjct  143  EASLGGKIRVSTVHTMSVLKNSEPPSAGSFHDEYSTVLQGLLSFNKDTGSPFAINPYPYF  202

Query  662  AFQ  670
            A++
Sbjct  203  AYK  205



>gb|KEH40123.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=479

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +2

Query  122  FIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDI  301
            F+GVNYGQVA+NLP   ATAKLLQ+T+ EKVRLYG DPA+IK+LANTGIGI+IG ANGDI
Sbjct  23   FLGVNYGQVADNLPPASATAKLLQTTAFEKVRLYGTDPAIIKSLANTGIGIVIGAANGDI  82

Query  302  PAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALN  481
            P++A+DP +AK+WI  NVL +YPAS I+ I VGNE++ S D NLI  +LPA+QN+Q AL+
Sbjct  83   PSLASDPSFAKTWISTNVLPYYPASNIILITVGNEVITSNDTNLINGMLPAIQNIQKALD  142

Query  482  SASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFF  661
             AS+GGKI+VSTVH MS+L +SEPPS+G F    +  L+ LLSF   TG+PF INPYP+F
Sbjct  143  EASLGGKIRVSTVHTMSVLKNSEPPSAGSFHDEYSTVLQGLLSFNKDTGSPFAINPYPYF  202

Query  662  AFQ  670
            A++
Sbjct  203  AYK  205



>gb|KEH40125.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=481

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +2

Query  122  FIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDI  301
            F+GVNYGQVA+NLP   ATAKLLQ+T+ EKVRLYG DPA+IK+LANTGIGI+IG ANGDI
Sbjct  23   FLGVNYGQVADNLPPASATAKLLQTTAFEKVRLYGTDPAIIKSLANTGIGIVIGAANGDI  82

Query  302  PAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALN  481
            P++A+DP +AK+WI  NVL +YPAS I+ I VGNE++ S D NLI  +LPA+QN+Q AL+
Sbjct  83   PSLASDPSFAKTWISTNVLPYYPASNIILITVGNEVITSNDTNLINGMLPAIQNIQKALD  142

Query  482  SASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFF  661
             AS+GGKI+VSTVH MS+L +SEPPS+G F    +  L+ LLSF   TG+PF INPYP+F
Sbjct  143  EASLGGKIRVSTVHTMSVLKNSEPPSAGSFHDEYSTVLQGLLSFNKDTGSPFAINPYPYF  202

Query  662  AFQ  670
            A++
Sbjct  203  AYK  205



>ref|XP_006299612.1| hypothetical protein CARUB_v10015799mg [Capsella rubella]
 gb|EOA32510.1| hypothetical protein CARUB_v10015799mg [Capsella rubella]
Length=499

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +AQSFIGVNYG +A+NLP P  TAKLLQSTSI+KVRLY ADP++IK+LA TGIGI+IGVA
Sbjct  16   NAQSFIGVNYGLLADNLPPPSETAKLLQSTSIQKVRLYNADPSIIKSLAGTGIGIVIGVA  75

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A++   A  WI  NVL FYPAS I+ INVGNE+L S D NL+ QLLPAMQN+Q
Sbjct  76   NGDLPSIASNLNVASQWININVLPFYPASNIILINVGNEVLLSNDLNLVNQLLPAMQNIQ  135

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+GGKIKVSTVH M++L +SEPPS+G F  +    LK +L F+  TG+PF INP
Sbjct  136  KALEAVSLGGKIKVSTVHAMTVLGNSEPPSAGSFALSYQAGLKGILQFLSDTGSPFAINP  195

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  196  YPFFAYQ  202



>gb|AAD22313.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=456

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +AQSFIGVNYG +++NLP P  TAKLLQSTSI+KVRLY AD ++I +L  TGIGI+IGVA
Sbjct  20   NAQSFIGVNYGLLSDNLPPPSQTAKLLQSTSIQKVRLYNADSSIITSLVGTGIGIVIGVA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WI +NVL FYPAS I+ INVGNE+L S D NL+ QLLPAMQN+Q
Sbjct  80   NGDLPSIASDLNIASQWINSNVLPFYPASNIILINVGNEVLLSNDLNLVNQLLPAMQNVQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+GGKIKVSTVH M++L +SEPPS+G F P+    LK +L F+  TG+PF INP
Sbjct  140  KALEAVSLGGKIKVSTVHAMTVLGNSEPPSAGSFAPSYQAGLKGILQFLSDTGSPFAINP  199

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  200  YPFFAYQ  206



>ref|XP_006280516.1| hypothetical protein CARUB_v10026453mg [Capsella rubella]
 gb|EOA13414.1| hypothetical protein CARUB_v10026453mg [Capsella rubella]
Length=429

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q F+GVNYG  A+NLP P A+AKLLQST+ +KVRLYGADPA+IKALANTGI I+IG +N
Sbjct  22   SQPFLGVNYGLTADNLPPPSASAKLLQSTTFQKVRLYGADPAVIKALANTGIEIVIGASN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DPG+A++W+  NVL +YPASKI+ I VGNE+   GD  L++QLLPAM+N+Q+
Sbjct  82   GDVPGLASDPGFARTWVETNVLPYYPASKIVLIAVGNEVTTYGDDTLMSQLLPAMKNVQS  141

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL +AS+ GGKIKVSTVH MS+L  S+PPS+  F P   D LK LL F   TG+PF +NP
Sbjct  142  ALEAASLGGGKIKVSTVHVMSVLAGSDPPSTAVFKPEHADILKGLLEFNSETGSPFAVNP  201

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  202  YPFFAYQ  208



>ref|XP_006409465.1| hypothetical protein EUTSA_v10022641mg [Eutrema salsugineum]
 gb|ESQ50918.1| hypothetical protein EUTSA_v10022641mg [Eutrema salsugineum]
Length=526

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +AQS+IGVNYG +A+NLP P  TAKLLQSTSI+KVRLYGADP +IK+LA TG+ I+IGVA
Sbjct  36   NAQSYIGVNYGLLADNLPPPSDTAKLLQSTSIQKVRLYGADPTIIKSLAGTGVEIVIGVA  95

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WI  NVL FYPASKI+ INVGNEIL S D NL+ QLLPAMQN+ 
Sbjct  96   NGDLPSLASDVNVASQWIDVNVLPFYPASKIILINVGNEILLSNDLNLVNQLLPAMQNVH  155

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+GGKIKVSTVH M++L  SEPPS+G F P+    LK +L F+  TG+ F+INP
Sbjct  156  KALEAVSLGGKIKVSTVHAMTVLGQSEPPSAGLFAPSYQAGLKGILQFLSDTGSSFVINP  215

Query  650  YPFFAF  667
            YPFFA+
Sbjct  216  YPFFAY  221



>ref|NP_179219.4| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEC06477.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=503

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +AQSFIGVNYG +++NLP P  TAKLLQSTSI+KVRLY AD ++I +L  TGIGI+IGVA
Sbjct  20   NAQSFIGVNYGLLSDNLPPPSQTAKLLQSTSIQKVRLYNADSSIITSLVGTGIGIVIGVA  79

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++A+D   A  WI +NVL FYPAS I+ INVGNE+L S D NL+ QLLPAMQN+Q
Sbjct  80   NGDLPSIASDLNIASQWINSNVLPFYPASNIILINVGNEVLLSNDLNLVNQLLPAMQNVQ  139

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL + S+GGKIKVSTVH M++L +SEPPS+G F P+    LK +L F+  TG+PF INP
Sbjct  140  KALEAVSLGGKIKVSTVHAMTVLGNSEPPSAGSFAPSYQAGLKGILQFLSDTGSPFAINP  199

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  200  YPFFAYQ  206



>ref|XP_004148850.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cucumis sativus]
 gb|KGN61789.1| hypothetical protein Csa_2G246520 [Cucumis sativus]
Length=464

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIGVNYGQ+++NLP P ATA LL+STSI K+RLY ADP +IK+LAN+G+GI+IG+A
Sbjct  26   DSQSFIGVNYGQLSDNLPPPSATANLLRSTSISKIRLYNADPLIIKSLANSGLGIVIGIA  85

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A++P  A  WI  N+  +YPAS I+ I VGNE++ S D+NLI+QL+PAM+N+Q
Sbjct  86   NGDIPALASNPNSAAQWINTNLNPYYPASNILLITVGNEVMSSMDQNLISQLVPAMRNVQ  145

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NA+N+A++GGK+KVSTVH M++L  S+PPSSGR +P    ++K+++ F+    +PF INP
Sbjct  146  NAVNAANLGGKVKVSTVHSMAVLSQSDPPSSGRINPMFEGTMKEVVEFLKENESPFAINP  205

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  206  YPFFAYQ  212



>emb|CDX71547.1| BnaC04g17820D [Brassica napus]
Length=436

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q FIGVNYGQ A+NLP P ATAKLL+ST+I+KVRLYG+DPA+IKALANTGI I+IG   
Sbjct  24   SQPFIGVNYGQTADNLPPPSATAKLLRSTTIQKVRLYGSDPAIIKALANTGIEIVIGT--  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DP +A+SW+  NV+ +YPASKI  I+VGNE    GDRN + QLLPAM+N+Q+
Sbjct  82   GDVPGLASDPSFARSWVETNVVPYYPASKITLIDVGNEATTFGDRNFMLQLLPAMKNVQS  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +AS+GGKIKVSTVH MS+L  S+PPS+G F     D LK LL F   TG+PF +NPY
Sbjct  142  ALEAASLGGKIKVSTVHTMSILSQSDPPSAGVFAADHADILKGLLEFNRETGSPFAVNPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>ref|XP_008457927.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cucumis melo]
Length=464

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSFIGVNYGQ+++NLP P +TA LL+STSI K+RLY ADP +IK+LAN+G+GI+IG+A
Sbjct  26   DSQSFIGVNYGQLSDNLPPPSSTANLLRSTSISKIRLYNADPLIIKSLANSGLGIVIGIA  85

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIPA+A++P  A  WI  N+  +YPAS I+ I VGNE++ S D+NLI+QL+PAM+N+Q
Sbjct  86   NGDIPALASNPNSAAQWINTNLNPYYPASNILLITVGNEVMSSMDQNLISQLVPAMRNVQ  145

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NA+N+AS+GGK+KVSTVH M++L  S+PPSSGR +P    ++K ++ F+    +PF INP
Sbjct  146  NAVNAASLGGKVKVSTVHSMAVLSQSDPPSSGRINPMFETTMKAVVEFLKENESPFAINP  205

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  206  YPFFAYQ  212



>ref|XP_010481959.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=435

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q F+GVNYG  A+NLP P A+AKLLQST+ +KVRLYG+DPA+IKALANTGI I+IG +N
Sbjct  22   SQPFLGVNYGLTADNLPPPSASAKLLQSTTFQKVRLYGSDPAVIKALANTGIEIVIGASN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DPG+A++W+  NV+ +YPASKI+ I VGNE+   GD  L++QLLPAM+N+Q+
Sbjct  82   GDVPGLASDPGFARTWVETNVIPYYPASKIVLIAVGNEVTTFGDNTLMSQLLPAMKNVQS  141

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL +AS+ GGKIKVSTVH MS+L  S+PPS+  F P   D LK LL F   TG+PF +NP
Sbjct  142  ALEAASLGGGKIKVSTVHVMSVLAGSDPPSTAVFKPEHADILKGLLEFNSETGSPFAVNP  201

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  202  YPFFAYQ  208



>emb|CAA18827.1| putative protein (fragment) [Arabidopsis thaliana]
Length=335

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P  T KLLQSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  1    AEPFIGVNYGQVADNLPPPSETVKLLQSTSIQKVRLYGADPAIIKALAGTGVGIVIGAAN  60

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++A+DP  A  WI +NVL FYPASKIM I VGNEIL S D NL+ QLLPAMQN+Q 
Sbjct  61   GDVPSLASDPNAATQWINSNVLPFYPASKIMLITVGNEILMSNDPNLVNQLLPAMQNVQK  120

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTV+ M++L SS+PPSSG F       LK +L F+  TG+PF INPY
Sbjct  121  ALEAVSLGGKIKVSTVNSMTVLGSSDPPSSGSFAAGYQTGLKGILQFLSDTGSPFAINPY  180

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  181  PFFAYQ  186



>ref|XP_010442129.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=435

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q F+GVNYG  A+NLP P A+AKLLQST+ +KVRLYG+DPA+IKALANTGI I+IG +N
Sbjct  22   SQPFLGVNYGLTADNLPPPSASAKLLQSTTFQKVRLYGSDPAVIKALANTGIEIVIGASN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DPG+A++W+  NV+ +YPASKI+ I VGNE+   GD  L++QLLPAM+N+Q+
Sbjct  82   GDVPGLASDPGFARTWVETNVIPYYPASKIVLIAVGNEVTTFGDNTLMSQLLPAMKNVQS  141

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL +AS+ GGKIKVSTVH MS+L  S+PPS+  F P   D LK LL F   TG+PF +NP
Sbjct  142  ALEAASLGGGKIKVSTVHVMSVLAGSDPPSTAVFKPEHADILKGLLEFNSETGSPFAVNP  201

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  202  YPFFAYQ  208



>sp|Q94G86.1|ALL9_OLEEU RecName: Full=Glucan endo-1,3-beta-D-glucosidase; AltName: Full=Major 
pollen allergen Ole e 9; AltName: Allergen=Ole e 9; 
Flags: Precursor [Olea europaea]
 gb|AAK58515.1|AF249675_1 beta-1,3-glucanase-like protein [Olea europaea]
Length=460

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSF+GVNYGQ+++NLP+ +AT  LL+ST+I+KVRL+GA+PA+IKA ANTG+ I+IG  
Sbjct  25   NSQSFLGVNYGQLSDNLPSLQATVNLLKSTTIQKVRLFGAEPAVIKAFANTGVEIVIGFD  84

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGDIP +A++P  A  ++ +NV++FYPAS I+ I VGNE+L SGD+ LI+QLLPAMQN+Q
Sbjct  85   NGDIPTLASNPNVASQFVKSNVMSFYPASNIIAITVGNEVLTSGDQKLISQLLPAMQNVQ  144

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NALN+AS+GGK+KVSTVH M++L  S PPSSG F+P + D++K LL F  A  APF+I+P
Sbjct  145  NALNAASLGGKVKVSTVHAMAVLSQSYPPSSGVFNPGLGDTMKALLQFQSANDAPFMISP  204

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  205  YPYFAYK  211



>ref|XP_010494214.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=435

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q F+GVNYG  A+NLP P A+AKLLQST+ +KVRLYG+DPA+IKALANTGI I+IG +N
Sbjct  22   SQPFLGVNYGLTADNLPPPSASAKLLQSTTFQKVRLYGSDPAVIKALANTGIEIVIGASN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DPG+A++W+  NV+ +YPASKI+ I VGNE+   GD  L++QLLPAM+N+Q 
Sbjct  82   GDVPGLASDPGFARTWVETNVIPYYPASKIVLIAVGNEVTTFGDNTLMSQLLPAMKNVQG  141

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL +AS+ GGKIKVSTVH MS+L  S+PPS+  F P   D LK LL F   TG+PF +NP
Sbjct  142  ALEAASLGGGKIKVSTVHVMSVLAGSDPPSTAVFKPEHADILKGLLEFNSETGSPFAVNP  201

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  202  YPFFAYQ  208



>emb|CAB80165.1| putative protein (fragment) [Arabidopsis thaliana]
Length=356

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P  T KLLQSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  22   AEPFIGVNYGQVADNLPPPSETVKLLQSTSIQKVRLYGADPAIIKALAGTGVGIVIGAAN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++A+DP  A  WI +NVL FYPASKIM I VGNEIL S D NL+ QLLPAMQN+Q 
Sbjct  82   GDVPSLASDPNAATQWINSNVLPFYPASKIMLITVGNEILMSNDPNLVNQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTV+ M++L SS+PPSSG F       LK +L F+  TG+PF INPY
Sbjct  142  ALEAVSLGGKIKVSTVNSMTVLGSSDPPSSGSFAAGYQTGLKGILQFLSDTGSPFAINPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>dbj|BAB10628.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=431

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q F+GVNYG  A+NLP P A+AKLLQST+ +KVRLYG+DPA+IKALANTGI I+IG +N
Sbjct  22   SQPFLGVNYGLTADNLPPPSASAKLLQSTTFQKVRLYGSDPAVIKALANTGIEIVIGASN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DP +A+SW+  NV+ +YPASKI+ I VGNEI   GD +L++QLLPAM+N+Q 
Sbjct  82   GDVPGLASDPSFARSWVETNVVPYYPASKIVLIAVGNEITSFGDNSLMSQLLPAMKNVQT  141

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL +AS+ GGKIKVSTVH MS+L  S+PPS+  F P   D LK LL F   TG+PF +NP
Sbjct  142  ALEAASLGGGKIKVSTVHIMSVLAGSDPPSTAVFKPEHADILKGLLEFNSETGSPFAVNP  201

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  202  YPFFAYQ  208



>gb|KFK31822.1| hypothetical protein AALP_AA6G162900 [Arabis alpina]
Length=435

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q FIGVNYG VA+NLP P A+AKLL ST+I+KVRLYG+DPA+IKALANTGI I+IG +N
Sbjct  24   SQPFIGVNYGLVADNLPPPAASAKLLLSTTIQKVRLYGSDPAVIKALANTGIEIVIGASN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DP  A++W+  NV+ +YPASKI+ I VGNE+  S D NL++QL+PAM+N+Q 
Sbjct  84   GDVPGLASDPNIARAWVNTNVVPYYPASKIILIAVGNELTTSTDPNLMSQLVPAMRNVQT  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +AS+GGKIKV+TVH MS+L  S+PPS+G F+P   D LK +L F   TG+PF INPY
Sbjct  144  ALEAASLGGKIKVTTVHVMSVLGRSDPPSAGAFNPDHADILKGVLEFNSETGSPFAINPY  203

Query  653  PFFAFQ  670
            PFFA++
Sbjct  204  PFFAYK  209



>ref|XP_002865493.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41752.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q F+G+NYG  A+NLP P A+AKLLQST+ +KVRLYG+DPA+IKALANTGI I+IG +N
Sbjct  22   SQPFLGINYGLTADNLPPPSASAKLLQSTTFQKVRLYGSDPAVIKALANTGIEIVIGASN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DP +A+SW+  NV+ +YPASKI+ I VGNEI   GD NL++QLLPAM+N+Q+
Sbjct  82   GDVPGLASDPSFARSWVQTNVVPYYPASKIVLIAVGNEITTFGDNNLMSQLLPAMKNVQS  141

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL + S+ GGKIKVSTVH MS+L  S+PPS+  F P   D LK LL F   TG+PF +NP
Sbjct  142  ALEAVSLGGGKIKVSTVHVMSVLAGSDPPSAAVFKPEHADILKGLLEFNSETGSPFAVNP  201

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  202  YPFFAYQ  208



>ref|NP_199086.2| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AAL66985.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAN12906.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AED94854.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
Length=438

 Score =   241 bits (616),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q F+GVNYG  A+NLP P A+AKLLQST+ +KVRLYG+DPA+IKALANTGI I+IG +N
Sbjct  22   SQPFLGVNYGLTADNLPPPSASAKLLQSTTFQKVRLYGSDPAVIKALANTGIEIVIGASN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+DP +A+SW+  NV+ +YPASKI+ I VGNEI   GD +L++QLLPAM+N+Q 
Sbjct  82   GDVPGLASDPSFARSWVETNVVPYYPASKIVLIAVGNEITSFGDNSLMSQLLPAMKNVQT  141

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL +AS+ GGKIKVSTVH MS+L  S+PPS+  F P   D LK LL F   TG+PF +NP
Sbjct  142  ALEAASLGGGKIKVSTVHIMSVLAGSDPPSTAVFKPEHADILKGLLEFNSETGSPFAVNP  201

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  202  YPFFAYQ  208



>ref|XP_006403361.1| hypothetical protein EUTSA_v10003213mg [Eutrema salsugineum]
 gb|ESQ44814.1| hypothetical protein EUTSA_v10003213mg [Eutrema salsugineum]
Length=433

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q FIGVNYGQVA+NLP P ATAKLLQST+I+KVRLYG+DPA IKALANTGI I+IG   
Sbjct  24   SQPFIGVNYGQVADNLPPPSATAKLLQSTTIQKVRLYGSDPATIKALANTGIEIVIGT--  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             D+P +A+DP  A SW+  NV+ +YPASKI+ I VGNE+   GDRNL++QLLPAM+N+Q+
Sbjct  82   NDVPGLASDPNLAGSWVETNVVPYYPASKIILIAVGNEVTTFGDRNLMSQLLPAMRNVQS  141

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL +AS+ GGKIKVSTVH MS+L  S+PPS+G F P   D LK LL F   TG+PF +NP
Sbjct  142  ALEAASLGGGKIKVSTVHVMSVLGQSDPPSAGVFAPDHADILKGLLEFNRETGSPFAVNP  201

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  202  YPFFAYQ  208



>emb|CDY45313.1| BnaA03g52860D [Brassica napus]
Length=892

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P  TAKL+QSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  22   AEPFIGVNYGQVADNLPPPSETAKLIQSTSIQKVRLYGADPAIIKALAGTGVGIVIGTAN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++AADP  A  WI +NVL FYPASKI+ I VGNE+L S D NL++QLLPAMQN+Q 
Sbjct  82   GDLPSLAADPNAASQWISSNVLPFYPASKIILITVGNEVLLSKDPNLVSQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH MS+L SSEPPSSG F       LKD+L F+  TG+PF INPY
Sbjct  142  ALEAVSLGGKIKVSTVHAMSVLGSSEPPSSGSFASGYQAGLKDILQFLSDTGSPFAINPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>emb|CDX75437.1| BnaA01g02650D [Brassica napus]
Length=506

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVN GQVA+NLP P  T KLL+S+SIEKVRLYGADPA+IKALA TGIGI+IG  N
Sbjct  22   AEPFIGVNIGQVADNLPPPSETVKLLKSSSIEKVRLYGADPAIIKALAGTGIGIVIGAGN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++AADP  A  WI +NVL FYPASKI+ IN+GNE+L S D NL+ QLLPAMQN+Q 
Sbjct  82   GDIPSLAADPNAASQWINSNVLPFYPASKIILINIGNEVLMSNDPNLVNQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +AS+GGKIKVSTVH M++L SS+PPSSG F P     LK +L F+  TG+PF INPY
Sbjct  142  ALEAASLGGKIKVSTVHSMTVLGSSDPPSSGSFAPGSQAGLKGILQFLSDTGSPFTINPY  201

Query  653  PFFAFQ  670
            PFFA++
Sbjct  202  PFFAYR  207



>emb|CDX72483.1| BnaC07g45050D [Brassica napus]
Length=885

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            +A+ FIGVNYGQVA+NLP P  TAKL+QSTSI+KVRLYGADPA+IKALA TG+GI+IG A
Sbjct  21   NAEPFIGVNYGQVADNLPPPSETAKLIQSTSIQKVRLYGADPAIIKALAGTGVGIVIGTA  80

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            NGD+P++AADP  A  WI +NVL FYPASKI+ I VGNE+L S D NL++QLLPAMQN+Q
Sbjct  81   NGDLPSLAADPNAASQWISSNVLPFYPASKIILITVGNEVLLSKDPNLVSQLLPAMQNVQ  140

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL +AS+GGKIKVSTVH MS+L SSEPPSSG F       LK +L F+  TG+PF INP
Sbjct  141  KALEAASLGGKIKVSTVHAMSVLGSSEPPSSGSFASGYQAGLKGILQFLSDTGSPFAINP  200

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  201  YPFFAYQ  207



>ref|XP_009112198.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brassica rapa]
Length=506

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVN GQVA+NLP P  T KLL+S+SIEKVRLYGADPA+IKALA TGIGI+IG  N
Sbjct  22   AEPFIGVNIGQVADNLPPPSETVKLLKSSSIEKVRLYGADPAIIKALAGTGIGIVIGAGN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++AADP  A  WI +NVL FYPASKI+ IN+GNE+L S D NL+ QLLPAMQN+Q 
Sbjct  82   GDIPSLAADPNAASQWINSNVLPFYPASKIILINIGNEVLMSNDPNLVNQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +AS+GGKIKVSTVH M++L SS+PPSSG F P     LK +L F+  TG+PF INPY
Sbjct  142  ALEAASLGGKIKVSTVHSMTVLGSSDPPSSGSFAPGSQAGLKGILQFLSDTGSPFTINPY  201

Query  653  PFFAFQ  670
            PFFA++
Sbjct  202  PFFAYR  207



>ref|XP_010519110.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Tarenaya hassleriana]
Length=475

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++Q FIGVNYG+VA+NLP P  TAKLLQST+I+K+RLYG+DP +IKALANTGI I+IG +
Sbjct  23   NSQPFIGVNYGEVADNLPPPPETAKLLQSTTIQKLRLYGSDPGIIKALANTGIEIIIGTS  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            N D+P +A+DP YA++W+  NV+ ++PASKI  + VGNE+   GD NL+ QL PAM+N+Q
Sbjct  83   NNDVPGLASDPVYARNWVQINVVPYFPASKISLVTVGNEVTTFGDSNLMAQLAPAMRNVQ  142

Query  470  NALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLIN  646
            NAL++A + GGKI+VSTVH M++L +SEPPS+G+F+P + D LK +L F + TG+PF +N
Sbjct  143  NALDAAGLGGGKIRVSTVHTMAVLGASEPPSAGKFNPGLGDVLKGVLEFNNQTGSPFAVN  202

Query  647  PYPFFAFQ  670
            PYP+FA++
Sbjct  203  PYPYFAYR  210



>ref|NP_195174.6| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
 sp|Q9M069.2|E137_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 7; AltName: Full=(1->3)-beta-glucan 
endohydrolase 7; Short=(1->3)-beta-glucanase 
7; AltName: Full=Beta-1,3-endoglucanase 7; Short=Beta-1,3-glucanase 
7; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE86384.1| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
Length=504

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVNYGQVA+NLP P  T KLLQSTSI+KVRLYGADPA+IKALA TG+GI+IG AN
Sbjct  22   AEPFIGVNYGQVADNLPPPSETVKLLQSTSIQKVRLYGADPAIIKALAGTGVGIVIGAAN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P++A+DP  A  WI +NVL FYPASKIM I VGNEIL S D NL+ QLLPAMQN+Q 
Sbjct  82   GDVPSLASDPNAATQWINSNVLPFYPASKIMLITVGNEILMSNDPNLVNQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTV+ M++L SS+PPSSG F       LK +L F+  TG+PF INPY
Sbjct  142  ALEAVSLGGKIKVSTVNSMTVLGSSDPPSSGSFAAGYQTGLKGILQFLSDTGSPFAINPY  201

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  202  PFFAYQ  207



>emb|CDX69064.1| BnaC01g03890D [Brassica napus]
Length=505

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ FIGVN GQVA+NLP P  T KLL+S+SIEKVRLYGADPA+IKALA TGIGI+IG  N
Sbjct  22   AEPFIGVNIGQVADNLPPPTETVKLLKSSSIEKVRLYGADPAIIKALAGTGIGIVIGAGN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++AADP  A  WI +NVL FYPASKI+ I +GNE+L SGD NL+ QLLPAMQN+Q 
Sbjct  82   GDIPSLAADPNAASQWINSNVLPFYPASKIILITIGNEVLMSGDPNLVNQLLPAMQNVQK  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL + S+GGKIKVSTVH M++L SS+PPSSG F P     LK +L F+  TG+PF INPY
Sbjct  142  ALEATSLGGKIKVSTVHSMTVLGSSDPPSSGSFAPGSQAGLKGILQFLSDTGSPFTINPY  201

Query  653  PFFAFQ  670
            PFFA++
Sbjct  202  PFFAYR  207



>ref|XP_006375634.1| hypothetical protein POPTR_0014s18260g, partial [Populus trichocarpa]
 gb|ERP53431.1| hypothetical protein POPTR_0014s18260g, partial [Populus trichocarpa]
Length=352

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 138/184 (75%), Gaps = 15/184 (8%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYGQVA+NLP P +TAKLLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG AN
Sbjct  1    SQSFIGINYGQVADNLPPPPSTAKLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTAN  60

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP + +DP +AKSWI   VL FYPAS I+ I VGNE++ S ++NL  +LLPAMQN   
Sbjct  61   GDIPGLDSDPNFAKSWINTKVLPFYPASNIILITVGNEVMTSNNQNLFNKLLPAMQN---  117

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
                        VSTVH M +L  SEPPSSG FDP+  D +K LL F  A G+PF INPY
Sbjct  118  ------------VSTVHPMGVLKQSEPPSSGSFDPSYGDLMKGLLEFNSANGSPFAINPY  165

Query  653  PFFA  664
            P+FA
Sbjct  166  PYFA  169



>ref|XP_006856026.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Amborella trichopoda]
 gb|ERN17493.1| hypothetical protein AMTR_s00059p00061500 [Amborella trichopoda]
Length=457

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 145/186 (78%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYG+ A+NLP P    KLLQSTSI KVRLYGAD A+I+ALAN+GI IMIG AN
Sbjct  25   SQSFIGINYGESADNLPPPSVAVKLLQSTSIAKVRLYGADAAIIRALANSGICIMIGAAN  84

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            G+I ++  DP  AK WI  NVL +YPASKI+ I+VGNE+L S D+NLI+Q++PAMQNL  
Sbjct  85   GEIASLN-DPTAAKQWINTNVLPYYPASKIVAISVGNEVLTSNDQNLISQIIPAMQNLHT  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL  AS+  KIKV+TVH M++L  S PPSSGRF+P +   LK +L F+  TGAPF INPY
Sbjct  144  ALLGASLADKIKVTTVHSMAVLSQSAPPSSGRFNPDL-QVLKQVLGFLHDTGAPFTINPY  202

Query  653  PFFAFQ  670
            P+FA+Q
Sbjct  203  PYFAYQ  208



>ref|XP_006434974.1| hypothetical protein CICLE_v10003630mg, partial [Citrus clementina]
 gb|ESR48214.1| hypothetical protein CICLE_v10003630mg, partial [Citrus clementina]
Length=436

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 143/185 (77%), Gaps = 2/185 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++ FIG+NYG + +NLP+PE T KLLQSTSI+K+RLY  D  MIKALAN+GI I++G  N
Sbjct  1    SEPFIGINYGNLGDNLPSPEDTVKLLQSTSIQKIRLYNPDIPMIKALANSGIDIVVGTQN  60

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             +IPA+A+DP  AK+WI  NVL FYPAS I  I VGNE+  S D N   QLLPAMQN+QN
Sbjct  61   SEIPALASDPNAAKTWINTNVLPFYPASNIFLIMVGNEV--SLDENFRKQLLPAMQNMQN  118

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++AS+GGKIKVSTVH MS+L  S+PPSSG+F   + D +K  L F +ATG+PF INPY
Sbjct  119  ALDAASLGGKIKVSTVHSMSVLSHSDPPSSGKFQTWLVDVMKGFLGFNNATGSPFAINPY  178

Query  653  PFFAF  667
            P++A+
Sbjct  179  PYYAY  183



>ref|XP_009406752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP PE TA+LL+ST+I KVRLYGADPA+++ALA T I ++IG AN
Sbjct  25   SQSFIGVNYGQVADNLPPPEETARLLKSTTISKVRLYGADPAILRALAGTDISVVIGAAN  84

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDI ++A+DP  A +W+ ANVL F PA+ I  + VGNE L SGD  L +QLLPAMQN+ N
Sbjct  85   GDIASLASDPSAATNWVSANVLPFVPATSISVVAVGNEALTSGDATLASQLLPAMQNMYN  144

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++A+    IKVSTVH M++L  S+PPSSG F   +  +LK +L+F+  TGAPF+INPY
Sbjct  145  ALSAAAPSAGIKVSTVHIMTILAQSDPPSSGAFHADLVPALKGVLAFLQKTGAPFMINPY  204

Query  653  PFFAFQ  670
            P+FA++
Sbjct  205  PYFAYR  210



>gb|KDO84535.1| hypothetical protein CISIN_1g040787mg, partial [Citrus sinensis]
Length=436

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 141/185 (76%), Gaps = 2/185 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            ++ FIG+NYG + +NLP+PE T KLLQSTSI+K+RLY  D  MIKALAN+GI I++G  N
Sbjct  1    SEPFIGINYGNLGDNLPSPEDTVKLLQSTSIQKIRLYSPDIPMIKALANSGIDIVVGTQN  60

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             +IPA+A+DP  AK+WI  NVL FYPAS I  I VGNEI  S D N   QLLPAMQN+QN
Sbjct  61   SEIPALASDPNAAKTWINTNVLPFYPASNIFLIMVGNEI--SLDENFRKQLLPAMQNMQN  118

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++ S+GGKIKVSTVH MS+L  S+PPSSG F   + D +K  L F +ATG+PF INPY
Sbjct  119  ALDAGSLGGKIKVSTVHSMSVLSHSDPPSSGEFQTWLVDVMKGFLGFNNATGSPFAINPY  178

Query  653  PFFAF  667
            P++A+
Sbjct  179  PYYAY  183



>ref|XP_009407686.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=459

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSF+GVNYG+VA+NLP PEATA+LL+ST+I K+RLYG DP +++ALA T I ++IG A
Sbjct  23   ESQSFVGVNYGEVADNLPPPEATARLLKSTTISKIRLYGTDPPILRALAGTNISVIIGAA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            +GDIP++A+DP  A+ W+ ANVL F PA+ I  ++VGNE+L  GD +L  QLLPAM+NL 
Sbjct  83   DGDIPSLASDPSAARRWVSANVLPFLPATAISIVSVGNEVLAPGDASLGPQLLPAMRNLH  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +AL+ A+    IKVSTVH M++L SSEPPS+G F   +T +L  +L F+  TGAPF+INP
Sbjct  143  SALSEAAPSAGIKVSTVHSMAVLASSEPPSAGVFRADLTSNLAGVLGFLRETGAPFMINP  202

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  203  YPYFAYQ  209



>ref|XP_010942826.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Elaeis guineensis]
Length=464

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYG+VA+NLPAPEATAKLL+STSI KVRLYGADPAM++AL  T I ++IG AN
Sbjct  24   SQSFIGVNYGEVADNLPAPEATAKLLKSTSISKVRLYGADPAMLRALGGTNISVVIGAAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A+DP  A  W+ ANVL F PA+ I  I VGNE+L SGD +L  QL+PAMQNL  
Sbjct  84   GDIPSLASDPAAASRWVAANVLPFIPATDISVIAVGNEVLNSGDASLAAQLIPAMQNLAT  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+ +A+    IKVSTV+ M++L  SEPPSSG F   +T  LK +L F+  T +PF+INPY
Sbjct  144  AVAAAAPNSNIKVSTVNIMAVLAQSEPPSSGAFHSDLTTGLKGILQFLTKTKSPFMINPY  203

Query  653  PFFAFQ  670
            P+FA++
Sbjct  204  PYFAYR  209



>ref|XP_006375618.1| hypothetical protein POPTR_0014s18040g, partial [Populus trichocarpa]
 gb|ERP53415.1| hypothetical protein POPTR_0014s18040g, partial [Populus trichocarpa]
Length=348

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 136/186 (73%), Gaps = 22/186 (12%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYGQVA+ LP P +TA LLQSTSI+KVRLYG+DPA+IKALANTGIGI+IG AN
Sbjct  1    SQSFIGINYGQVADKLPPPPSTANLLQSTSIQKVRLYGSDPAIIKALANTGIGIVIGTAN  60

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDI  +A+D  + KSWI  NVL FYPAS I+ I VGNE++ S D+NL+ +LLPAMQN+QN
Sbjct  61   GDILGLASDSNFTKSWINKNVLPFYPASNIILITVGNEVMTSNDQNLMNKLLPAMQNVQN  120

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            ALN AS+GGKIKVSTVH M                        LL F  A G+PF INPY
Sbjct  121  ALNDASLGGKIKVSTVHSMG----------------------GLLEFNSANGSPFAINPY  158

Query  653  PFFAFQ  670
            P+FA++
Sbjct  159  PYFAYR  164



>ref|XP_008783477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Phoenix dactylifera]
Length=464

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +Q+FIGVNYG+VA+NLP PEATAKLL+ST+I KVRLYGADPA+++ALA T I ++IG AN
Sbjct  24   SQTFIGVNYGEVADNLPPPEATAKLLKSTTISKVRLYGADPAILRALAGTNISVIIGAAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A+DP  A  W+ ANVL F PA+ I  I VGNE+L SGD  L  QL+PAMQNL +
Sbjct  84   GDIPSLASDPAAASRWVAANVLPFIPATTISVIAVGNEVLNSGDPGLTAQLIPAMQNLAS  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+ +A+    IKVSTV+ M++L  SEPPSSG F   +T  LK +L F+  T +PF+INPY
Sbjct  144  AVAAAAPNSNIKVSTVNIMTVLAQSEPPSSGAFHSDLTSGLKGILQFLTKTNSPFMINPY  203

Query  653  PFFAFQ  670
            P+FA++
Sbjct  204  PYFAYR  209



>ref|XP_008375942.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
7 [Malus domestica]
Length=486

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 141/186 (76%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNY QVANNL  P  TAKLLQSTSI++V LY  DPA+IKALA + I I+I  AN
Sbjct  28   SQSFIGVNY-QVANNLSPPSNTAKLLQSTSIKRVHLYSVDPAIIKALAGSCITIVIDAAN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIPA+ +DP     W+ +NVL FYPASKI  INVGNE+L S D+ LI+QLL AM+N+Q+
Sbjct  87   GDIPALTSDPNATGQWVNSNVLPFYPASKIDLINVGNEVLLSNDQGLISQLLLAMRNVQS  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +AS+ GK++VSTVH M++LV S+PPS G F+    D LK LLSF    G+ F +NPY
Sbjct  147  ALTAASLDGKVRVSTVHSMAVLVQSDPPSVGLFNLGFQDILKGLLSFXRDNGSSFTVNPY  206

Query  653  PFFAFQ  670
            PFFA+Q
Sbjct  207  PFFAYQ  212



>gb|AFS50098.1| glucan endo-1,3-beta-glucosidase [Elaeis guineensis]
Length=465

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYG+VA+NLPAPEATAKLL+STSI KVRLYGADPAM++AL  T I ++IG AN
Sbjct  24   SQSFIGVNYGEVADNLPAPEATAKLLKSTSISKVRLYGADPAMLRALGGTNISVVIGAAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDIP++A+DP  A  WI ANVL F PA+ I  I VGNE+L SGD +L  QL+PAMQNL  
Sbjct  84   GDIPSLASDPAAASRWIAANVLPFIPATDISVIAVGNEVLNSGDASLAAQLIPAMQNLAT  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRF-DPAITDSLKDLLSFIDATGAPFLINP  649
            A+ +A+    IKVSTV+ M++L  SEPPSSG F  P +  + K +L F+  T +PF+INP
Sbjct  144  AVAAAAPNSNIKVSTVNIMAVLAQSEPPSSGAFPSPILPPASKRILQFLTKTKSPFMINP  203

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  204  YPYFAYR  210



>gb|AFK44108.1| unknown [Medicago truncatula]
Length=176

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            D+QSF+GVNYGQ A+NLP PEATAKLLQST+I KVR+YGADPA+IK+LAN+GIGI+IG A
Sbjct  23   DSQSFVGVNYGQTADNLPPPEATAKLLQSTTIGKVRIYGADPAIIKSLANSGIGIVIGAA  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            N D+P++A+DP  A  WI  NVL +YPAS I  I VGNE+L SGD  L++QL+PA++N+Q
Sbjct  83   NNDVPSLASDPNAATQWINTNVLPYYPASNITLITVGNEVLNSGDEGLVSQLMPAIRNVQ  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSS  562
             AL+S  +GGK+KV+TVH M++L  S+PPSS
Sbjct  143  TALSSVKLGGKVKVTTVHSMAVLAQSDPPSS  173



>ref|XP_009411141.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like, partial [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLP P  T  LLQST+I K RLYGADPA+I++LA T I +++GV+
Sbjct  4    ESQSFIGVNYGQVADNLPPPSETVSLLQSTTISKFRLYGADPAVIQSLAGTNISLVLGVS  63

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            N DI ++A+DP  A +W+ ANVL + PAS I  ++VGNE L SGD +L + LLPAMQNL+
Sbjct  64   NSDIASLASDPVAASNWVAANVLPYAPASSISVVSVGNEALNSGDSSLASNLLPAMQNLR  123

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            +AL++++    +KVSTVH M++L  S+PPSSG F P IT  L  +L F+  TG+PF+INP
Sbjct  124  SALSASAAASGVKVSTVHTMAVLSQSDPPSSGAFHPDITADLTGILGFLRDTGSPFMINP  183

Query  650  YPFFAFQ  670
            YPFFA++
Sbjct  184  YPFFAYR  190



>ref|XP_010939269.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Elaeis guineensis]
Length=456

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QS+IG+NYG+ A+NLP   ATA+LLQST+I KVR+YGADPA+I+ALA T I +++G  N
Sbjct  23   SQSYIGINYGEEADNLPPASATAQLLQSTTIGKVRMYGADPAIIQALAGTNISLVLGTTN  82

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             DIP+ A DP  A  W+ AN+L F P+S I T++VGNE L SGD +L + LLPAMQNL +
Sbjct  83   ADIPSFATDPSAASRWVSANILPFIPSSSIATVSVGNEALNSGDPSLASNLLPAMQNLHS  142

Query  473  ALNSA-SVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL+SA S    IKVSTVH M++L  SEPPSSG F   +  +L  +L+F+   G+PF+INP
Sbjct  143  ALSSAGSTAASIKVSTVHSMAVLSQSEPPSSGAFHSDLAPTLAGVLAFLRDNGSPFMINP  202

Query  650  YPFFAFQ  670
            YP+FA++
Sbjct  203  YPYFAYR  209



>ref|XP_006651673.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Oryza brachyantha]
Length=343

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQS+IGVNYG+VA+NLPAPE T KLL+ST+I KVRLYG DPA+++ALA TGI I++GVAN
Sbjct  25   AQSYIGVNYGEVADNLPAPEETVKLLKSTTISKVRLYGVDPAIMRALAGTGISIVVGVAN  84

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            G+IP++AADP  A  W+ ANVL F PAS I  + VGNE+L SGD +L   LLPAMQNL+ 
Sbjct  85   GEIPSLAADPAAASRWLAANVLPFVPASTISVVAVGNEVLESGDASLAAALLPAMQNLRA  144

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A  +      IK STV+ M++L  S+PPS+G F P +   L+ +L F+  T APF+INP
Sbjct  145  AAAAAGDGAAGIKFSTVNTMAVLAQSDPPSTGAFHPDVASQLQQILGFLSKTSAPFMINP  204

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  205  YPYFAYQ  211



>gb|AAP44659.1| putative beta 1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF98103.1| Glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEE63416.1| hypothetical protein OsJ_18228 [Oryza sativa Japonica Group]
Length=464

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 141/187 (75%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQS+IGVNYG+VA+NLPAPE TAKLL+ST+I KVRLYG DP +++ALA TGI +++GVAN
Sbjct  25   AQSYIGVNYGEVADNLPAPEETAKLLKSTTISKVRLYGVDPGIMRALAGTGISLVVGVAN  84

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            GDIP++AADP  A  W+ ANVL F PAS I  + VGNE+L SGD +L   LLPAMQNL+ 
Sbjct  85   GDIPSLAADPAAASRWLAANVLPFVPASTISVVAVGNEVLESGDASLAAALLPAMQNLRA  144

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A  +     +IK STV+ M++L  S+PPS+G F P I+  L  +L F+  T APF+INP
Sbjct  145  AAAAAGDGAARIKFSTVNTMAVLAQSDPPSTGAFHPDISPQLTQILGFLSKTTAPFMINP  204

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  205  YPYFAYQ  211



>gb|EAY91326.1| hypothetical protein OsI_12942 [Oryza sativa Indica Group]
Length=464

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQS+IGVNYG+VA+NLPAPE TAKLL+ST+I KVRLYG DP +++ALA TGI +++GVAN
Sbjct  25   AQSYIGVNYGEVADNLPAPEETAKLLKSTTISKVRLYGVDPGIMRALAGTGISLVVGVAN  84

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            GDIP++AADP  A  W+ ANVL F PAS I  + VGNE+L SGD +L   LLPAMQNL+ 
Sbjct  85   GDIPSLAADPAAASRWLAANVLPFVPASTISVVAVGNEVLESGDASLAAALLPAMQNLRA  144

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A  +      IK STV+ M++L  S+PPS+G F P I+  L  +L F+  T APF+INP
Sbjct  145  AAAAAGDGAAGIKFSTVNTMAVLAQSDPPSTGAFHPDISPQLTQILGFLSKTTAPFMINP  204

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  205  YPYFAYQ  211



>ref|XP_008681422.1| PREDICTED: uncharacterized protein LOC100273173 isoform X2 [Zea 
mays]
Length=463

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ +IGVNYG+VA+NLP+ + TA+LL+STSI KVRLYG D  +I+ALA +GI +++GVAN
Sbjct  26   AQPYIGVNYGEVADNLPSADETARLLRSTSISKVRLYGVDAGLIRALAGSGISVVVGVAN  85

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            GDIP++AADP  A  W+ ANVL F PA+ I  + VGNE+L SGD  L   LLPAMQNL+ 
Sbjct  86   GDIPSLAADPAAASRWLAANVLPFVPATTISAVAVGNEVLESGDATLGAALLPAMQNLRA  145

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A  +      I+ STV+ M ++  S+PPS+G F P +   L+ +L F+  TGAPF+INP
Sbjct  146  AAAAAGGGAAGIRFSTVNTMGVMAQSDPPSTGAFHPDVAPQLQQILGFLSRTGAPFMINP  205

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  206  YPWFAYQ  212



>ref|XP_008681421.1| PREDICTED: uncharacterized protein LOC100273173 isoform X1 [Zea 
mays]
Length=465

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ +IGVNYG+VA+NLP+ + TA+LL+STSI KVRLYG D  +I+ALA +GI +++GVAN
Sbjct  26   AQPYIGVNYGEVADNLPSADETARLLRSTSISKVRLYGVDAGLIRALAGSGISVVVGVAN  85

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            GDIP++AADP  A  W+ ANVL F PA+ I  + VGNE+L SGD  L   LLPAMQNL+ 
Sbjct  86   GDIPSLAADPAAASRWLAANVLPFVPATTISAVAVGNEVLESGDATLGAALLPAMQNLRA  145

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A  +      I+ STV+ M ++  S+PPS+G F P +   L+ +L F+  TGAPF+INP
Sbjct  146  AAAAAGGGAAGIRFSTVNTMGVMAQSDPPSTGAFHPDVAPQLQQILGFLSRTGAPFMINP  205

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  206  YPWFAYQ  212



>gb|KHN20071.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=445

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 135/187 (72%), Gaps = 14/187 (7%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QSFIGVNYGQVA+NLPAPE TA    ST++          A+IK L+N GI I+IG  
Sbjct  26   ESQSFIGVNYGQVADNLPAPEDTA----STNL----------AIIKTLSNYGIKIVIGPF  71

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            N DI ++  D   A  W+ ANVL +YPAS I  I VGNEIL   D+ L++QL+PAM+N+Q
Sbjct  72   NDDISSLVVDLNAATQWVNANVLPYYPASNITLITVGNEILTLADQGLLSQLVPAMRNVQ  131

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            NAL +AS+GGKI+VSTVH M++L  S+PPSSG F+PA+ D+LK LL+ +    +PF INP
Sbjct  132  NALGAASLGGKIRVSTVHSMAVLTQSDPPSSGLFNPALQDTLKQLLALLKDNKSPFTINP  191

Query  650  YPFFAFQ  670
            YPFFA+Q
Sbjct  192  YPFFAYQ  198



>ref|XP_002466692.1| hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
 gb|EER93690.1| hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
Length=475

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 139/187 (74%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A+ +IGVNYG+VA+NLP+P+ TAKLL+STSI KVRLYG D  +I+ALA +GI +++GVAN
Sbjct  33   AEPYIGVNYGEVADNLPSPDETAKLLKSTSISKVRLYGVDAGLIRALAGSGISVVVGVAN  92

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            GDIP++AADP  A  W+ ANVL F PA+ I  + VGNE+L SGD  L   LLPAMQNL+ 
Sbjct  93   GDIPSLAADPAAASRWLAANVLPFVPATTISAVAVGNEVLESGDATLAAALLPAMQNLRA  152

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL +      I+ STV+ M ++  S+PPS+G F P +   L+ +L+F+  TGAPF+INP
Sbjct  153  AALAAGDGAAGIRFSTVNTMGVMAQSDPPSTGAFHPDVAPQLQQILAFLSRTGAPFMINP  212

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  213  YPWFAYQ  219



>ref|NP_001148381.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 gb|ACG31222.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 tpg|DAA50560.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=461

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ +IGVNYG+VA+NLP+P+ TA+LL+STSI KVRLYG D  +I+ALA +GI +++GVAN
Sbjct  25   AQPYIGVNYGEVADNLPSPDKTARLLKSTSISKVRLYGVDAGLIRALAGSGISVVVGVAN  84

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            G+IP +AADP  A  W+ ANVL F PA+ I  + VGNE+L SGD  L   LLPAMQNL+ 
Sbjct  85   GEIPTLAADPAAASRWLAANVLPFVPATTISAVAVGNEVLESGDAALAAALLPAMQNLRA  144

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A  +      I+ STV+ M ++  SEPPS+G F P +   L+ +L F+  TGAPF++NP
Sbjct  145  AAAAAGDGAAGIRFSTVNTMGVMAQSEPPSAGAFHPDVAPQLQQILGFLSKTGAPFMVNP  204

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  205  YPWFAYQ  211



>gb|ADE76367.1| unknown [Picea sitchensis]
Length=472

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            +GVNYGQ  +NLP P A AKL+QST+I K+R+YGADPA+++A ANTGIG+++G++N  I 
Sbjct  40   LGVNYGQTGDNLPPPSAVAKLVQSTAISKLRIYGADPAILQAFANTGIGLLVGISNDQIA  99

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            ++      A++WI  N++ F PA+ I+ I+VGNE+L+SGD  LI+QLLPA+QNL  AL  
Sbjct  100  SLN-QLAVAQNWIKNNIVPFVPATDIIGISVGNEVLFSGDGVLISQLLPALQNLHTALAE  158

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
             S+  +IKVST H M++L +S PPS+GRF  +    +K LL F+   GAPF+INPYP+FA
Sbjct  159  VSLDRQIKVSTPHAMAILSTSAPPSAGRFSESF--DMKPLLDFLQKIGAPFMINPYPYFA  216

Query  665  FQ  670
            ++
Sbjct  217  YK  218



>ref|XP_004982217.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Setaria italica]
Length=483

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ +IGVNYG+VA+NLP PE TA+LL+ST+I KVRLYG D  +I+ALA + I +++GVAN
Sbjct  33   AQPYIGVNYGEVADNLPPPEETARLLKSTAISKVRLYGVDAGLIRALAGSNISVVVGVAN  92

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            GDIP++AADP  A  W+ ANVL F PA+ I  + VGNE+L SGD +L   LLPAMQNL+ 
Sbjct  93   GDIPSLAADPAAASRWLAANVLPFVPATSISAVAVGNEVLESGDASLAAALLPAMQNLRA  152

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A  +      I+ STV+ M ++  S+PPS+G F P I   L+ +L F+  TGAPF+INP
Sbjct  153  AAAAAGGAAAGIRFSTVNTMGVMAQSDPPSTGAFHPDIAPQLQGILGFLSRTGAPFMINP  212

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  213  YPWFAYQ  219



>ref|XP_004982218.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Setaria italica]
Length=469

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ +IGVNYG+VA+NLP PE TA+LL+ST+I KVRLYG D  +I+ALA + I +++GVAN
Sbjct  33   AQPYIGVNYGEVADNLPPPEETARLLKSTAISKVRLYGVDAGLIRALAGSNISVVVGVAN  92

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            GDIP++AADP  A  W+ ANVL F PA+ I  + VGNE+L SGD +L   LLPAMQNL+ 
Sbjct  93   GDIPSLAADPAAASRWLAANVLPFVPATSISAVAVGNEVLESGDASLAAALLPAMQNLRA  152

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A  +      I+ STV+ M ++  S+PPS+G F P I   L+ +L F+  TGAPF+INP
Sbjct  153  AAAAAGGAAAGIRFSTVNTMGVMAQSDPPSTGAFHPDIAPQLQGILGFLSRTGAPFMINP  212

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  213  YPWFAYQ  219



>ref|XP_009394306.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 141/186 (76%), Gaps = 4/186 (2%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYGQVA+NLP P ATA LLQST+I K+RLYGADPA+I++L+ T I +++GV N
Sbjct  22   SQSFIGVNYGQVADNLPPPSATASLLQSTTISKLRLYGADPAIIRSLSGTNISLVLGVPN  81

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             DIP++A+DP  A SW  ANVL + PA+ I  + VGNE L SGD  L +QLLPAM+NL +
Sbjct  82   ADIPSLASDPSAAASWAAANVLPYVPATSISLVAVGNEALDSGDAALASQLLPAMRNLGS  141

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+ ++ V    KVSTVH M++L  SEPPSSG F P ++  L  +L F+  TG+PF+INPY
Sbjct  142  AVAASGV----KVSTVHTMTVLAHSEPPSSGAFRPELSADLTGILGFLRDTGSPFMINPY  197

Query  653  PFFAFQ  670
            PFFA++
Sbjct  198  PFFAYR  203



>ref|XP_003561438.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Brachypodium 
distachyon]
Length=463

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 138/187 (74%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQS+IGVNYG+VA+NLP+P+ T KLL+ST+I KVRLYG D  +I+ALA TGI +++GVAN
Sbjct  27   AQSYIGVNYGEVADNLPSPDETVKLLKSTTISKVRLYGVDAGVIRALAGTGISLVVGVAN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            GDIPA+AADP  A  W+ ANVL F PAS I  + VGNE+L SGD +L   LLPA+QNL+ 
Sbjct  87   GDIPALAADPNAASGWLAANVLPFIPASTISVVAVGNEVLESGDASLAAALLPALQNLRA  146

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A+ +      IK STV+ M++L  S+PPS+G F P     L+ +L F+  T APF+INP
Sbjct  147  AAVAAGDAAAGIKFSTVNTMAVLAQSDPPSTGAFRPEAAAQLQQILGFLSKTSAPFMINP  206

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  207  YPYFAYQ  213



>gb|ABK24319.1| unknown [Picea sitchensis]
 gb|ACN40930.1| unknown [Picea sitchensis]
Length=491

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 135/182 (74%), Gaps = 3/182 (2%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            +GV+YG+ A+NLP P A AK++Q+T+I K+RLY ADPA+++A ANTGIG+++G+ N  IP
Sbjct  40   LGVDYGKTADNLPPPSAVAKMVQNTTISKLRLYEADPAILQAFANTGIGLVVGIGNDQIP  99

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            +++     A++WI  N++ F PA+ I+ I VGNE+L++GD  LI+QLLPA+QNL  AL  
Sbjct  100  SLS-QLTVAQNWIKNNIVPFVPATDIIGILVGNEVLFTGDGALISQLLPALQNLHTALVG  158

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
             S+  +IKVST H M++L SS PPS+GRF  +    +K LL F+   GAP +INPYP+FA
Sbjct  159  VSLDQQIKVSTPHSMALLSSSVPPSAGRFSESF--DMKSLLDFLQKIGAPLMINPYPYFA  216

Query  665  FQ  670
            ++
Sbjct  217  YK  218



>gb|ABK25242.1| unknown [Picea sitchensis]
Length=491

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 134/182 (74%), Gaps = 3/182 (2%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            +GV+YG+ A+NLP P A AK++Q+T+I K+RLY ADPA+++A ANTGIG+++G+ N  IP
Sbjct  40   LGVDYGKTADNLPPPSAVAKMVQNTTISKLRLYEADPAILQAFANTGIGLVVGIGNDQIP  99

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            +++     A++WI  N++ F PA+ I+ I VGNE+L++GD  LI+QLLPA+QNL  AL  
Sbjct  100  SLS-QLTVAQNWIKNNIVPFVPATDIIGILVGNEVLFTGDGALISQLLPALQNLHTALVG  158

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
             S+  +IKVST H M++L +S PPS+GRF       +K LL F+   GAP +INPYP+FA
Sbjct  159  VSLDQQIKVSTPHSMAILSTSVPPSAGRFSENF--DMKSLLDFLQKIGAPLMINPYPYFA  216

Query  665  FQ  670
            ++
Sbjct  217  YK  218



>gb|ABK24695.1| unknown [Picea sitchensis]
Length=485

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 134/185 (72%), Gaps = 8/185 (4%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYG++ +NLP P   AK LQ+T+I+KV+L+ ADP++++A A+T I +++ VAN +IP
Sbjct  27   IGVNYGRMGDNLPPPSEVAKFLQTTNIDKVKLFDADPSVLQAFADTNITVVVAVANDEIP  86

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            A+   P  A+ W+  NV  + PA+ I+ I+VGNEIL +G++ LI+QL+PAMQNL  AL  
Sbjct  87   ALNKLPA-AQDWVKKNVAPYVPATNIIAISVGNEILSTGNKVLISQLIPAMQNLHTALVG  145

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRF----DPAITDSLKDLLSFIDATGAPFLINPY  652
            AS+  +IKVST H + +L +SEPPS GRF    D  I   LK LL+F+  TGAPF+INPY
Sbjct  146  ASLDKQIKVSTPHSLGILAASEPPSIGRFRRGYDRVI---LKPLLNFLRTTGAPFMINPY  202

Query  653  PFFAF  667
            P+F +
Sbjct  203  PYFGY  207



>dbj|BAJ87172.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=461

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ  IGVNYG+VA+NLP P+ATAKLL+ST+I KVRLYG D  +I+ALA TG+ +++GVAN
Sbjct  24   AQPHIGVNYGEVADNLPPPDATAKLLKSTAITKVRLYGVDAGLIRALAGTGVSLVLGVAN  83

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-  469
            GDIPA+AADP  A  W+ ANVL F PAS I  + VGNE+L SGD  L   LLPAMQ+L+ 
Sbjct  84   GDIPAIAADPNAASGWLAANVLPFVPASSISVVAVGNEVLESGDAALAAALLPAMQDLRA  143

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             A+ +      I  STV+ M++L  S+PPS+G F       L+ +L F+  TGAPF++NP
Sbjct  144  AAVAAGGAAAGIGFSTVNTMAVLAQSDPPSAGAFRADAAAQLQQILGFLSRTGAPFMVNP  203

Query  650  YPFFAFQ  670
            YP+FA+Q
Sbjct  204  YPYFAYQ  210



>dbj|BAJ95272.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = +2

Query  116  QSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANG  295
            Q+FIG+NYG +A+NLP P +TA+LL+ST+I KVRLY  DPA++ A A TGI +++G ANG
Sbjct  25   QTFIGINYGDIADNLPPPASTARLLKSTTIGKVRLYRTDPAVVAAFAGTGISLLLGAANG  84

Query  296  DIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNA  475
            DIP+ A+ P  A +W+ A+ L    +  +  I+VGNE+LYSGD  LI+QL+PA+QN+ +A
Sbjct  85   DIPSFASSPSAAAAWVAAH-LPSSTSPAVNGISVGNEVLYSGDATLISQLVPALQNIYDA  143

Query  476  LNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYP  655
            L + S    IKVSTV+ M +L SS+PPSSG F P ++ +L  LL+F+  TG+PFL+NPYP
Sbjct  144  LPANS---GIKVSTVNAMDVLASSDPPSSGAFKPELSAALDPLLAFLSKTGSPFLVNPYP  200

Query  656  FFAFQ  670
            +FA+Q
Sbjct  201  YFAYQ  205



>ref|XP_008785661.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Phoenix dactylifera]
 ref|XP_008785662.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Phoenix dactylifera]
 ref|XP_008785663.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Phoenix dactylifera]
Length=415

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 125/176 (71%), Gaps = 1/176 (1%)
 Frame = +2

Query  146  VANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIPAMAADPG  325
            +A+NLP   ATAKLL+ST+  KVRLYGADP +I+ALA T I +++G AN DIP++AADP 
Sbjct  1    MADNLPPVSATAKLLESTTFGKVRLYGADPGIIQALAGTNISLVLGAANADIPSLAADPS  60

Query  326  YAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ-NALNSASVGGK  502
             A  W+ ANV  F PAS I  I+VGNE L S D +L + LLPAMQNL     ++ S    
Sbjct  61   AASRWVSANVAPFLPASSIAAISVGNEALNSSDPSLASNLLPAMQNLHSALSSAGSAAAS  120

Query  503  IKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFAFQ  670
            IKVSTVH M++L  SEPPSSG F   +  +L  +L+F+  TG+PF+INPYP+FA++
Sbjct  121  IKVSTVHSMAVLSQSEPPSSGAFRSDLGPALAAILAFLRDTGSPFMINPYPYFAYR  176



>ref|XP_002466550.1| hypothetical protein SORBIDRAFT_01g009770 [Sorghum bicolor]
 gb|EER93548.1| hypothetical protein SORBIDRAFT_01g009770 [Sorghum bicolor]
Length=445

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 139/185 (75%), Gaps = 6/185 (3%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYG+VA+NLP P +TA+L+QST+I KVRLYG DPA++ A A TGI +++G  N
Sbjct  28   SQSFIGINYGEVADNLPPPSSTARLVQSTTITKVRLYGTDPAIVSAFAGTGISLLLGATN  87

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDI  +A+ P  A SW+ AN+ A  PA  + T++VGNE+L++ D +L +QL+PAMQNL +
Sbjct  88   GDIANLASSPAAAASWVAANLPAKSPA--VSTVSVGNEVLFA-DASLASQLVPAMQNLYD  144

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL   S    +KVSTV+ M +L SS+PPSSG F P +  +L  LL+F+  TG+PFLINPY
Sbjct  145  ALPPNS---SVKVSTVNAMDVLASSDPPSSGSFKPELATALDPLLAFLSKTGSPFLINPY  201

Query  653  PFFAF  667
            P+FA+
Sbjct  202  PYFAY  206



>ref|XP_010230690.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brachypodium distachyon]
Length=433

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 136/185 (74%), Gaps = 4/185 (2%)
 Frame = +2

Query  116  QSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANG  295
            QSFIG+NYG VA+NLP P +TA+LL+ST+I KVRLY  DPA++ A A TGI +++G ANG
Sbjct  29   QSFIGINYGDVADNLPPPSSTARLLKSTTIGKVRLYRTDPAVVSAFAGTGISLLLGAANG  88

Query  296  DIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNA  475
            DIP+ A+ P  A +W+ A+ L    +  I  I+VGNE+L+S D +L +QL+PA+QN+ +A
Sbjct  89   DIPSFASSPSAAAAWVAAH-LPSTSSPAITGISVGNEVLFSDDASLASQLVPALQNIHDA  147

Query  476  LNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYP  655
            L   S    IKVSTV+ M +L SS+PPSSG F P +  +L  LL+F+  TG+PFL+NPYP
Sbjct  148  LPPNS---SIKVSTVNAMDVLASSDPPSSGAFKPGLATALDPLLAFLSKTGSPFLVNPYP  204

Query  656  FFAFQ  670
            +FA+Q
Sbjct  205  YFAYQ  209



>ref|XP_009394779.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=418

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +2

Query  110  DAQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVA  289
            ++QS IG+NYGQVA+NLP   ATA+LLQST+I K+RLYGAD A+I++LA T I +++GV+
Sbjct  23   ESQSMIGINYGQVADNLPPASATAQLLQSTTISKLRLYGADAAIIQSLAGTDISLVLGVS  82

Query  290  NGDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQ  469
            N DIP++A+DP  A +W   NVL + P+S I  ++VGNE + SGD +L + LLPAMQNL+
Sbjct  83   NSDIPSLASDPSAAANWAAVNVLPYVPSSSISVVSVGNEAINSGDPSLASGLLPAMQNLR  142

Query  470  NALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
             AL++++    +KVSTVH M++L  S+PPSSG F P    SL  +L F+   G+PF+INP
Sbjct  143  TALSASAAAASVKVSTVHSMAVLAQSDPPSSGAFHPDFAASLTGVLGFLRDAGSPFMINP  202

Query  650  YPFFAFQ  670
            YPFFA++
Sbjct  203  YPFFAYR  209



>ref|XP_009394780.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=415

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QS IG+NYGQVA+NLP   ATA+LLQST+I K+RLYGAD A+I++LA T I +++GV+N
Sbjct  21   SQSMIGINYGQVADNLPPASATAQLLQSTTISKLRLYGADAAIIQSLAGTDISLVLGVSN  80

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             DIP++A+DP  A +W   NVL + P+S I  ++VGNE + SGD +L + LLPAMQNL+ 
Sbjct  81   SDIPSLASDPSAAANWAAVNVLPYVPSSSISVVSVGNEAINSGDPSLASGLLPAMQNLRT  140

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL++++    +KVSTVH M++L  S+PPSSG F P    SL  +L F+   G+PF+INPY
Sbjct  141  ALSASAAAASVKVSTVHSMAVLAQSDPPSSGAFHPDFAASLTGVLGFLRDAGSPFMINPY  200

Query  653  PFFAFQ  670
            PFFA++
Sbjct  201  PFFAYR  206



>ref|XP_004986270.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Setaria italica]
Length=420

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 138/184 (75%), Gaps = 6/184 (3%)
 Frame = +2

Query  116  QSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANG  295
            QSFIG+NYG VA+NLP P +TA+LLQST+I KVRLYG DPA++ A A TGI +++G  NG
Sbjct  26   QSFIGINYGDVADNLPPPSSTARLLQSTTISKVRLYGTDPAVVSAFAGTGISLLLGATNG  85

Query  296  DIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNA  475
            DI  +A+ P  A +W+ A++ +  PA  + T++VGNE+L++ D +L +QL+PAMQNL +A
Sbjct  86   DIANLASSPAAASAWVAAHIPSSSPA--VSTVSVGNEVLFA-DASLASQLVPAMQNLYDA  142

Query  476  LNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYP  655
            L   S    +KVSTV+ M +L SS+PPSSG F P ++ +L  LL+F+  TG+PFLINPYP
Sbjct  143  LPPNS---SVKVSTVNAMDVLASSDPPSSGAFKPELSATLDPLLAFLSKTGSPFLINPYP  199

Query  656  FFAF  667
            +FA+
Sbjct  200  YFAY  203



>ref|XP_002456675.1| hypothetical protein SORBIDRAFT_03g040630 [Sorghum bicolor]
 gb|EES01795.1| hypothetical protein SORBIDRAFT_03g040630 [Sorghum bicolor]
Length=408

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 122/186 (66%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ   G+NYGQ+ANNLP P   A LLQS ++ KV+LY ADP ++ A ANTG+  +I V N
Sbjct  27   AQQKFGINYGQIANNLPEPTQVASLLQSMNVNKVKLYDADPRVLTAFANTGVEFIIAVGN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++  MAA P  A+ W+  NV  + PA++I  + VGNE+  S D +++  LLPAM+ +  
Sbjct  87   ENLQTMAASPAAARQWVATNVQPYLPATRITCVTVGNEVFSSNDTSMMASLLPAMKAVYA  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL    +G ++ VS+ H +++L +S PPSSG F   + + +K +L F   +G+PFLIN Y
Sbjct  147  ALGGLGLGSQVTVSSAHSVNVLATSFPPSSGAFREDLAEYIKPILDFHGQSGSPFLINAY  206

Query  653  PFFAFQ  670
            PFFA++
Sbjct  207  PFFAYK  212



>emb|CDM85083.1| unnamed protein product [Triticum aestivum]
Length=405

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 123/186 (66%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ   G+NYGQ+ANNLP P   A LL+S ++ +V+LY ADP ++ A ANTG+  +I V N
Sbjct  26   AQQKFGINYGQIANNLPDPTQVASLLRSMNVNRVKLYDADPKVLTAFANTGVEFIISVGN  85

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++  MA+ PG A+ W+  +V  F PA++I  I VGNE+L + D  +   L+PAMQ + +
Sbjct  86   ENLQTMASSPGAARQWVAQHVQPFIPATRITGIIVGNEVLGNNDTTMAASLVPAMQAVYD  145

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +  + G++ VS+ H +++L SS PPSSG F   +   +K LL F   TG+PFLIN Y
Sbjct  146  ALAALGLSGQVTVSSAHSVNVLASSFPPSSGTFQEGVAQYVKPLLDFHSKTGSPFLINAY  205

Query  653  PFFAFQ  670
            PFFA++
Sbjct  206  PFFAYK  211



>ref|NP_001149419.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 gb|ACG35378.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
Length=406

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 119/186 (64%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ   G+NYGQ+AN+LP P   A LLQS  + KV+LY ADP ++ A ANTG+G  I V N
Sbjct  27   AQHKFGINYGQIANDLPDPAQVATLLQSMGVNKVKLYDADPRVLTAFANTGVGFTIAVGN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             D+ AMAA P  A+ W+ ANV  + PA++I  + VGNE+L   D   +  LLPAM+ +  
Sbjct  87   EDLQAMAASPDAARRWVAANVQPYVPATRITCVTVGNEVLSGNDTAAMASLLPAMRAVHA  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL  A +G  + VS+ H + +L +S PPSSG F   +   ++ +L F   TG+PFL+N Y
Sbjct  147  ALGDAGLGQPVAVSSAHSVDVLATSFPPSSGAFXEDLAGYVRPILDFHAQTGSPFLVNAY  206

Query  653  PFFAFQ  670
            PFF+++
Sbjct  207  PFFSYK  212



>gb|ACF85574.1| unknown [Zea mays]
 gb|ACF85963.1| unknown [Zea mays]
 gb|AFW84482.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=416

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 119/186 (64%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ   G+NYGQ+AN+LP P   A LLQS  + KV+LY ADP ++ A ANTG+G  I V N
Sbjct  33   AQHKFGINYGQIANDLPDPAQVATLLQSMGVNKVKLYDADPRVLTAFANTGVGFTIAVGN  92

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             D+ AMAA P  A+ W+ ANV  + PA++I  + VGNE+L   D   +  LLPAM+ +  
Sbjct  93   EDLQAMAASPDAARRWVAANVQPYVPATRITCVTVGNEVLSGNDTAAMASLLPAMRAVHA  152

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL  A +G  + VS+ H + +L +S PPSSG F   +   ++ +L F   TG+PFL+N Y
Sbjct  153  ALGDAGLGQPVAVSSAHSVDVLATSFPPSSGAFREDLAGYVRPILDFHAQTGSPFLVNAY  212

Query  653  PFFAFQ  670
            PFF+++
Sbjct  213  PFFSYK  218



>dbj|BAJ98053.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=409

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 124/187 (66%), Gaps = 1/187 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ   G+NYGQ+ANNLP P   A LL+S ++ KV+LY ADP ++ A ANTG+  +I V N
Sbjct  27   AQQKFGINYGQIANNLPDPTQVASLLRSMNVNKVKLYDADPKVLTAFANTGVEFIISVGN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++  MA+ PG A+ W+  +V  F PA++I  I VGNE+L + D  +   L+PAMQ + +
Sbjct  87   ENLQTMASSPGAARQWVAQHVQPFIPATRITGIIVGNEVLGNNDTAMAASLVPAMQAVYD  146

Query  473  ALNSASV-GGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINP  649
            AL +  V GG++ VS+ H +++L +S PPSSG F   +   +K LL F   TG+PFLIN 
Sbjct  147  ALAALGVGGGQVTVSSAHSVNVLATSFPPSSGTFQEGVAQYVKPLLDFHSKTGSPFLINA  206

Query  650  YPFFAFQ  670
            YPFFA++
Sbjct  207  YPFFAYK  213



>ref|NP_001146374.1| putative O-glycosyl hydrolase family 17 protein precursor [Zea 
mays]
 gb|ACG31911.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 gb|ACL53818.1| unknown [Zea mays]
 tpg|DAA56720.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=403

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 119/186 (64%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ   G+NYGQ+ANNLP P   A LL+S ++ KV+LY ADP ++ A ANTG+  +I V N
Sbjct  27   AQQKFGINYGQIANNLPDPTQVATLLRSMNVNKVKLYDADPRVLTAFANTGVEFIIAVGN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++  MA  P  A+ W+ ANV  + PA++I  + VGNE+    D   +  LLPAM+ +  
Sbjct  87   ENLQTMAGSPAAARQWVAANVRPYIPATRITCVTVGNEVFSGNDTATMASLLPAMKAVHA  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL    +GG+  VS+ H +++L +S PPSSG F   + + +K +L F   TG+PFLIN Y
Sbjct  147  ALADLGLGGQATVSSAHSVNVLAASFPPSSGAFREDLAEYMKPILDFHAQTGSPFLINAY  206

Query  653  PFFAFQ  670
            PFFA++
Sbjct  207  PFFAYK  212



>ref|XP_004970663.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like isoform X1 
[Setaria italica]
Length=408

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 124/186 (67%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ   G+NYGQ+AN+LP P   A LLQS ++ KV+LY ADP ++ A ANTG+  +I V N
Sbjct  27   AQQKFGINYGQIANDLPDPTRVAGLLQSMNVNKVKLYDADPRVLTAFANTGVEFIIAVGN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++  MAA+P  A+ W+  +V  + PA++I  + VGNE+  S D  +++ LLPAM+ + +
Sbjct  87   ENLQTMAANPAAARQWVATHVQPYIPATRITCVTVGNEVFSSNDTVMMSSLLPAMKAVSD  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL    +GG++ VS+ H +++L +S PPSSG F   + + ++ +L F   T +PFLIN Y
Sbjct  147  ALGDLGLGGQVTVSSAHSVNVLATSFPPSSGAFREDLAEYIQPILDFHGQTRSPFLINAY  206

Query  653  PFFAFQ  670
            PFFA++
Sbjct  207  PFFAYK  212



>ref|XP_004970664.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like isoform X2 
[Setaria italica]
Length=399

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 124/186 (67%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ   G+NYGQ+AN+LP P   A LLQS ++ KV+LY ADP ++ A ANTG+  +I V N
Sbjct  27   AQQKFGINYGQIANDLPDPTRVAGLLQSMNVNKVKLYDADPRVLTAFANTGVEFIIAVGN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++  MAA+P  A+ W+  +V  + PA++I  + VGNE+  S D  +++ LLPAM+ + +
Sbjct  87   ENLQTMAANPAAARQWVATHVQPYIPATRITCVTVGNEVFSSNDTVMMSSLLPAMKAVSD  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL    +GG++ VS+ H +++L +S PPSSG F   + + ++ +L F   T +PFLIN Y
Sbjct  147  ALGDLGLGGQVTVSSAHSVNVLATSFPPSSGAFREDLAEYIQPILDFHGQTRSPFLINAY  206

Query  653  PFFAFQ  670
            PFFA++
Sbjct  207  PFFAYK  212



>gb|KJB52394.1| hypothetical protein B456_008G260000 [Gossypium raimondii]
Length=389

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+A+NLP+PE    L++S  + KV+LY ADP ++ A AN+G+  MIG+ NGD+ 
Sbjct  28   IGINYGQIADNLPSPENVVPLVKSIGVTKVKLYDADPRVLGAFANSGVEFMIGLGNGDLE  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A+ W+  NV A  P +KI  I VGNE+L   D NL   L+PAMQ++  AL +
Sbjct  88   KMR-DPNNAQDWVKQNVQAHLPDTKITCIFVGNEVLTFNDTNLSDNLVPAMQSVHTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H + +L +S PPS+G F   + D L   LSF   TG+PFLIN YPFFA
Sbjct  147  LGLDKQVTVTTAHSLGILQTSFPPSAGAFREDLVDILSQTLSFHQKTGSPFLINAYPFFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>gb|AAF31288.1|AC006424_17 CDS [Arabidopsis thaliana]
Length=419

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+P     L++S    KV+LY A+P ++KA +NTGI  +IG+ N  + 
Sbjct  29   IGVNYGQIGDNLPSPTDVIPLIKSIGATKVKLYDANPQILKAFSNTGIEFIIGLGNEYLS  88

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L T LLPAMQ + +AL +
Sbjct  89   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTTNLLPAMQGVHSALIT  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +S+L SS PPS+G F P + DSL  +L F   T +PFLIN YPFFA
Sbjct  148  AGLSDQISVTTAHSLSILKSSFPPSAGEFQPDLLDSLTPILEFHRKTDSPFLINAYPFFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>ref|NP_001044874.1| Os01g0860800 [Oryza sativa Japonica Group]
 dbj|BAD82033.1| putative elicitor inducible beta-1,3-glucanase NtEIG-E76 [Oryza 
sativa Japonica Group]
 dbj|BAD82640.1| putative elicitor inducible beta-1,3-glucanase NtEIG-E76 [Oryza 
sativa Japonica Group]
 dbj|BAF06788.1| Os01g0860800 [Oryza sativa Japonica Group]
 dbj|BAG91890.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95871.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55709.1| hypothetical protein OsJ_04150 [Oryza sativa Japonica Group]
Length=398

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 122/186 (66%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ F G+NYGQ+ANNLP P   A LLQS ++ KV+LY ADP ++ A ANTG+  +I + N
Sbjct  28   AQKF-GINYGQIANNLPDPTQVAGLLQSLNVNKVKLYDADPKVLMAFANTGVEFIIAIGN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++ +MA +PG A+ W+  +V  F PA++I  I VGNE+    D  ++  LLPAM+ +  
Sbjct  87   ENLQSMAGNPGAARQWVTQHVQPFLPATRITCITVGNEVFSGNDTGMMASLLPAMKAIYA  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+    +GG++ VS+ H +++L +S PPSSG F   +   ++ LL F   T +PFLIN Y
Sbjct  147  AVGELGLGGQVTVSSAHSVNVLATSFPPSSGAFREDLAQYIQPLLDFHGQTNSPFLINAY  206

Query  653  PFFAFQ  670
            PFFA++
Sbjct  207  PFFAYK  212



>gb|KHN33758.1| Glucan endo-1,3-beta-glucosidase 7, partial [Glycine soja]
Length=403

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 114/156 (73%), Gaps = 1/156 (1%)
 Frame = +2

Query  203  IEKVRLYGADPAMIKALANTGIGIMIGVANGDIPAMAADPGYAKSWIGANVLAFYPASKI  382
            I++V LYG + A+IK L+N GI I+IG  N DI ++  D   A  W+ ANVL +YPAS I
Sbjct  1    IKQVCLYGTNLAIIKTLSNYGIKIVIGPFNDDISSLVVDLNAATQWVNANVLPYYPASNI  60

Query  383  MTINVGNEILYSGDRNLITQLLPAMQNLQNALNSASVGGKIKVSTVHGMSMLVSSEPPSS  562
              I VGNEIL   D+ L +QL+PAM+N+QNAL +AS+ GKIKVSTVH M++L  S+PPSS
Sbjct  61   TLITVGNEILTLADQGLKSQLVPAMRNVQNALGAASL-GKIKVSTVHSMAVLTQSDPPSS  119

Query  563  GRFDPAITDSLKDLLSFIDATGAPFLINPYPFFAFQ  670
            G F+PA+ D+LK LL+ +    +PF INPYPFFA+Q
Sbjct  120  GLFNPALQDTLKQLLALLKDNKSPFTINPYPFFAYQ  155



>ref|NP_174563.2| glucan endo-1,3-beta-glucosidase 11 [Arabidopsis thaliana]
 sp|Q8L868.1|E1311_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 11; AltName: Full=(1->3)-beta-glucan 
endohydrolase 11; Short=(1->3)-beta-glucanase 
11; AltName: Full=Beta-1,3-endoglucanase 11; Short=Beta-1,3-glucanase 
11; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM53268.1| putative beta-1,3-glucanase precursor, putative [Arabidopsis 
thaliana]
 gb|AAN15367.1| putative beta-1,3-glucanase precursor, putative [Arabidopsis 
thaliana]
 gb|AEE31533.1| glucan endo-1,3-beta-glucosidase 11 [Arabidopsis thaliana]
Length=426

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+P     L++S    KV+LY A+P ++KA +NTGI  +IG+ N  + 
Sbjct  29   IGVNYGQIGDNLPSPTDVIPLIKSIGATKVKLYDANPQILKAFSNTGIEFIIGLGNEYLS  88

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L T LLPAMQ + +AL +
Sbjct  89   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTTNLLPAMQGVHSALIT  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +S+L SS PPS+G F P + DSL  +L F   T +PFLIN YPFFA
Sbjct  148  AGLSDQISVTTAHSLSILKSSFPPSAGEFQPDLLDSLTPILEFHRKTDSPFLINAYPFFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>gb|EMS63842.1| Glucan endo-1,3-beta-glucosidase 14 [Triticum urartu]
Length=492

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 123/186 (66%), Gaps = 0/186 (0%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ   G+NYGQ+ANNLP P   + LL+S ++ +V+LY ADP ++ A ANTG+  +I V N
Sbjct  74   AQQKFGINYGQIANNLPDPTQVSGLLRSMNVNRVKLYDADPKVLTAFANTGVEFIISVGN  133

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++  MAA PG A+ W+  +V  F PA++I  I VGNE+L + D  +   L+PAMQ + +
Sbjct  134  ENLQTMAASPGAARQWVAQHVQPFIPATRITGIIVGNEVLGNNDTAMAASLVPAMQAVYD  193

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL +  + G++ VS+ H +++L SS PPSSG F   +   ++ LL F   TG+PFLIN Y
Sbjct  194  ALAALGLSGRVTVSSAHSVNVLGSSFPPSSGAFQEGVAQYVRPLLDFHSKTGSPFLINAY  253

Query  653  PFFAFQ  670
            PFFA++
Sbjct  254  PFFAYK  259



>ref|XP_011470886.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=419

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 124/182 (68%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+ANNLP+PEA   + +S  I +++LY ADP ++KA ANTG+  ++G+ N +  
Sbjct  29   IGINYGQIANNLPSPEAVVPIAKSIGITRIKLYDADPKVLKAFANTGVEFIVGLGN-EYL  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            A   DPG A+ W+ +NV A+ PA+KI  I VGNE+L   D +L   LLPAMQ++  AL +
Sbjct  88   AKVQDPGKAQEWVKSNVQAYLPATKITCIFVGNEVLTFNDTSLTGNLLPAMQSVHTALVN  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
             ++  ++ V+T H +S+L +S PPS+G F   I + +  +L F   TG+PFLIN YP+FA
Sbjct  148  LNLDKQVTVTTAHSLSILENSFPPSAGTFRRDIKNCIAPILDFHSKTGSPFLINAYPYFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>gb|KJB52393.1| hypothetical protein B456_008G260000 [Gossypium raimondii]
 gb|KJB52395.1| hypothetical protein B456_008G260000 [Gossypium raimondii]
 gb|KJB52396.1| hypothetical protein B456_008G260000 [Gossypium raimondii]
Length=402

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+A+NLP+PE    L++S  + KV+LY ADP ++ A AN+G+  MIG+ NGD+ 
Sbjct  28   IGINYGQIADNLPSPENVVPLVKSIGVTKVKLYDADPRVLGAFANSGVEFMIGLGNGDLE  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A+ W+  NV A  P +KI  I VGNE+L   D NL   L+PAMQ++  AL +
Sbjct  88   KMR-DPNNAQDWVKQNVQAHLPDTKITCIFVGNEVLTFNDTNLSDNLVPAMQSVHTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H + +L +S PPS+G F   + D L   LSF   TG+PFLIN YPFFA
Sbjct  147  LGLDKQVTVTTAHSLGILQTSFPPSAGAFREDLVDILSQTLSFHQKTGSPFLINAYPFFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>ref|XP_004309523.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=420

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 124/182 (68%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+ANNLP+PEA   + +S  I +++LY ADP ++KA ANTG+  ++G+ N +  
Sbjct  29   IGINYGQIANNLPSPEAVVPIAKSIGITRIKLYDADPKVLKAFANTGVEFIVGLGN-EYL  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            A   DPG A+ W+ +NV A+ PA+KI  I VGNE+L   D +L   LLPAMQ++  AL +
Sbjct  88   AKVQDPGKAQEWVKSNVQAYLPATKITCIFVGNEVLTFNDTSLTGNLLPAMQSVHTALVN  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
             ++  ++ V+T H +S+L +S PPS+G F   I + +  +L F   TG+PFLIN YP+FA
Sbjct  148  LNLDKQVTVTTAHSLSILENSFPPSAGTFRRDIKNCIAPILDFHSKTGSPFLINAYPYFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>ref|XP_006307574.1| hypothetical protein CARUB_v10009196mg [Capsella rubella]
 gb|EOA40472.1| hypothetical protein CARUB_v10009196mg [Capsella rubella]
Length=431

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 118/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP P     L++S    KV+LY A+P ++KA ANTGI  ++G+ N  + 
Sbjct  30   IGVNYGQIGDNLPPPSEVIPLIKSIGATKVKLYDANPQILKAFANTGIEFIVGLGNEYLS  89

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L   LLPAMQ + +AL +
Sbjct  90   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTVNLLPAMQGVHSALTT  148

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A + G+I V+T H +S+L +S PPS+G F P + D+L  +L F   T +PFLIN YPFFA
Sbjct  149  AGLSGQISVTTAHSLSILKTSFPPSAGEFQPDLVDALTPILDFHRKTESPFLINAYPFFA  208

Query  665  FQ  670
            ++
Sbjct  209  YK  210



>gb|EEC71847.1| hypothetical protein OsI_04517 [Oryza sativa Indica Group]
Length=414

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 122/186 (66%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ F G+NYGQ+ANNLP P   A LLQS ++ KV+LY ADP ++ A ANTG+  +I + N
Sbjct  28   AQKF-GINYGQIANNLPDPTQVAGLLQSLNVNKVKLYDADPKVLMAFANTGVEFIIAIGN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++ +MA +PG A+ W+  +V  F PA++I  I VGNE+    D  ++  LLPAM+ +  
Sbjct  87   ENLQSMAGNPGAARQWVTQHVQPFLPATRITCITVGNEVFSGNDTGMMASLLPAMKAIYA  146

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+    +GG++ VS+ H +++L +S PPSSG F   +   ++ LL F   T +PFLIN Y
Sbjct  147  AVGELGLGGQVTVSSAHSVNVLATSFPPSSGAFREDLAQYIQPLLDFHGQTNSPFLINAY  206

Query  653  PFFAFQ  670
            PFFA++
Sbjct  207  PFFAYK  212



>ref|XP_011658156.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis sativus]
 gb|KGN65723.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=489

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 127/187 (68%), Gaps = 10/187 (5%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQS-TSIEKVRLYGADPAMIKALANTGIGIMIGVANGDI  301
            IGVNYG VANNLP P   A  L+S TSI++V+++ A+P +++A A TGI + + VANGDI
Sbjct  24   IGVNYGTVANNLPPPSQVAAFLKSHTSIDRVKIFDANPDILRAFAGTGIALTVSVANGDI  83

Query  302  PAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALN  481
            PA+A  P  A+SW+  N+L F+P + I  I VGNEIL + D+NLI  LLPAM+ + +AL 
Sbjct  84   PALAKLPA-AQSWVANNILPFHPTTLINHIAVGNEILATSDKNLIAHLLPAMKAIHSALK  142

Query  482  SASVGGKIKVSTVHGMSMLVSSEPPSSGRF----DPAITDSLKDLLSFIDATGAPFLINP  649
             A +   +KVST H + +L +SEPPS+GRF    D AI      +L F + T  PF++NP
Sbjct  143  LAHI-SDVKVSTPHSLGILSASEPPSTGRFRRGYDRAI---FAPILDFHNQTKTPFMVNP  198

Query  650  YPFFAFQ  670
            YP+F F+
Sbjct  199  YPYFGFR  205



>ref|XP_010478704.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Camelina 
sativa]
Length=419

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 118/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+P     L++S    KV+LY A+P ++KA ANTGI  ++G+ N  + 
Sbjct  29   IGVNYGQIGDNLPSPSEVIPLIKSIGATKVKLYDANPQILKAFANTGIEFIVGLGNEYLS  88

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L   LLPAMQ + +AL +
Sbjct  89   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTLSLLPAMQGVHSALTT  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +S+L +S PPS+G F P + DSL  +L F   T +PFLIN YPFFA
Sbjct  148  AGLSDQISVTTAHSLSILKTSFPPSAGEFQPDLLDSLTPILEFHRKTESPFLINAYPFFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>ref|XP_010461089.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Camelina sativa]
Length=428

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 118/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+P     L++S    KV+LY A+P ++KA ANTGI  ++G+ N  + 
Sbjct  29   IGVNYGQIGDNLPSPSEVIPLIKSIGATKVKLYDANPQILKAFANTGIEFIVGLGNEYLS  88

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L   LLPAMQ + +AL +
Sbjct  89   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTLSLLPAMQGVHSALTT  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +S+L +S PPS+G F P + DSL  +L F   T +PFLIN YPFFA
Sbjct  148  AGLSDQISVTTAHSLSILKTSFPPSAGEFQPDLLDSLTPILEFHRKTESPFLINAYPFFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>ref|XP_010499813.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Camelina 
sativa]
Length=430

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 118/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+P     L++S    KV+LY A+P ++KA ANTGI  ++G+ N  + 
Sbjct  29   IGVNYGQIGDNLPSPSEVIPLIKSIGATKVKLYDANPQILKAFANTGIEFIVGLGNEYLS  88

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L   LLPAMQ + +AL +
Sbjct  89   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTLSLLPAMQGVHSALTT  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +S+L +S PPS+G F P + DSL  +L F   T +PFLIN YPFFA
Sbjct  148  AGLSDQISVTTAHSLSILKTSFPPSAGEFQPDLLDSLTPILEFHRKTESPFLINAYPFFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>ref|XP_010906055.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Elaeis guineensis]
Length=412

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 123/184 (67%), Gaps = 0/184 (0%)
 Frame = +2

Query  119  SFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGD  298
            S +G+NYG+V NNLP+PEA  +L+ +  + +VRLY ADPA I+A ANTGI +++G+ +  
Sbjct  27   SLVGINYGRVGNNLPSPEAVPRLVSTIGVGRVRLYDADPAAIRAFANTGIELVVGLPDRC  86

Query  299  IPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNAL  478
            +P +A DPG A +W+ +NV A+ PA+KI  + VGNE+L S +  L   LLPAM NL +AL
Sbjct  87   LPKLAGDPGEALAWVRSNVQAYLPAAKIAFLTVGNEVLTSNNTALPHFLLPAMDNLHSAL  146

Query  479  NSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPF  658
             S  +  +I V+T H +++L  S PPS+  F   +   L  +L F   TG+PF IN YP+
Sbjct  147  ASLGLDRQIAVTTAHSLAVLGDSYPPSTATFRRDLLPLLCPILDFHARTGSPFFINAYPY  206

Query  659  FAFQ  670
            FA++
Sbjct  207  FAYK  210



>ref|XP_008457482.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=573

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 128/187 (68%), Gaps = 10/187 (5%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQS-TSIEKVRLYGADPAMIKALANTGIGIMIGVANGDI  301
            IGVNYG VANNLP P   A  L+S TSI++V+++ A+P +++A A TGI + + +ANGDI
Sbjct  104  IGVNYGTVANNLPPPTQVAAFLKSRTSIDRVKIFDANPDILRAFAGTGIALTVSIANGDI  163

Query  302  PAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALN  481
            PA+A  P  A+SW+  N+L F+P + I  I VGNEIL + D+NLI  LLPAM+ + +AL 
Sbjct  164  PALAKLPA-AQSWVANNILPFHPTTLINHIAVGNEILATSDKNLIAHLLPAMKAIHSALK  222

Query  482  SASVGGKIKVSTVHGMSMLVSSEPPSSGRF----DPAITDSLKDLLSFIDATGAPFLINP  649
             A++   +KVST H + +L +SEPPS+GRF    D AI      +L F + T  PF++NP
Sbjct  223  LANI-SDVKVSTPHSLGILSASEPPSTGRFRRGYDRAI---FAPILDFHNQTKTPFMVNP  278

Query  650  YPFFAFQ  670
            YPFF F+
Sbjct  279  YPFFGFR  285



>gb|ERN16505.1| hypothetical protein AMTR_s00031p00059420 [Amborella trichopoda]
Length=374

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            +G+NYGQ+ANNLP+P   A LL S SI KV+LY ADP +++A ANT +  ++G+ N ++ 
Sbjct  25   VGINYGQIANNLPSPSRVAGLLNSLSISKVKLYDADPNVLRAFANTNVEFVVGIGN-ELV  83

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            A   DP  A  W+  +V  + P +KI  I VGNEI    D  LIT L+PAMQ+L +AL +
Sbjct  84   ANITDPDKALQWLTTHVQPYIPYTKITCITVGNEIFSGNDTTLITNLVPAMQSLHSALQT  143

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ +ST H + +L +S PPSSG F P I + ++ +L+F   T +PFLIN YP+FA
Sbjct  144  LGLSHQVNISTAHSLMVLSTSYPPSSGTFKPDIQEYMQSILNFHAETNSPFLINAYPYFA  203

Query  665  FQ  670
            ++
Sbjct  204  YK  205



>ref|XP_006855038.2| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Amborella trichopoda]
Length=384

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            +G+NYGQ+ANNLP+P   A LL S SI KV+LY ADP +++A ANT +  ++G+ N ++ 
Sbjct  35   VGINYGQIANNLPSPSRVAGLLNSLSISKVKLYDADPNVLRAFANTNVEFVVGIGN-ELV  93

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            A   DP  A  W+  +V  + P +KI  I VGNEI    D  LIT L+PAMQ+L +AL +
Sbjct  94   ANITDPDKALQWLTTHVQPYIPYTKITCITVGNEIFSGNDTTLITNLVPAMQSLHSALQT  153

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ +ST H + +L +S PPSSG F P I + ++ +L+F   T +PFLIN YP+FA
Sbjct  154  LGLSHQVNISTAHSLMVLSTSYPPSSGTFKPDIQEYMQSILNFHAETNSPFLINAYPYFA  213

Query  665  FQ  670
            ++
Sbjct  214  YK  215



>ref|XP_002893744.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70003.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+P     L++S    KV+LY A+P ++KA +NTGI  +IG+ N  + 
Sbjct  28   IGVNYGQIGDNLPSPTDVIPLIKSIGATKVKLYDANPQILKAFSNTGIEFIIGLGNEYLS  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L + LLPAMQ + +AL +
Sbjct  88   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTSNLLPAMQGVHSALIT  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +S+L SS PPS+G F P + DSL  +L F   T +PFLIN YPFFA
Sbjct  147  AGLSDQITVTTAHSLSILKSSFPPSAGEFQPDLLDSLTPILEFHRKTDSPFLINAYPFFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>gb|ABF94756.1| Glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=426

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 126/185 (68%), Gaps = 6/185 (3%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYG +A+NLP P +TA LL+STSI KVRLY   P ++ ALA + I I++GV N
Sbjct  26   SQSFIGVNYGTIADNLPPPASTANLLKSTSIGKVRLYEPQPDLVAALAGSNISILLGVPN  85

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GD+P +A+ P  A +W  AN+    P S    I+VGNE+L SGD  L  QLLPAMQNL  
Sbjct  86   GDVPNLASSPAAASAWAAANIPTTVPVSA---ISVGNELLNSGDPTLAPQLLPAMQNLLA  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL     G   K+STVH M++L SS+PPSSG F   +  SL  +L F+   GAPF+INPY
Sbjct  143  AL---PAGSTTKISTVHSMAVLSSSDPPSSGAFHADLAGSLDPVLDFLKQNGAPFMINPY  199

Query  653  PFFAF  667
            P+FA+
Sbjct  200  PYFAY  204



>gb|KEH42913.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=407

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+ANNLP+PE    L++     KV+LY ADP ++KA ANTGI  M+G+ N  + 
Sbjct  31   IGINYGQIANNLPSPENVVTLIKCIGATKVKLYDADPKVLKAFANTGIEFMVGLGNEYLS  90

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++WI  N+  + P++KI +I VGNE+L   D +L + LLPAMQ++  AL  
Sbjct  91   KMK-DPKQAQAWIKTNIQPYLPSTKITSIFVGNEVLTFNDSSLTSSLLPAMQSVHTALIV  149

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  +I V+T H +++L +S PPSSG F   I   +  +LSF   TG+PFLIN YP+FA
Sbjct  150  LGLHKQITVTTTHSLAILQNSYPPSSGTFRSDIAPCIASILSFQSKTGSPFLINAYPYFA  209

Query  665  FQ  670
            ++
Sbjct  210  YK  211



>ref|XP_011081364.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Sesamum indicum]
Length=405

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 120/186 (65%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            A S IG+NYGQ+ANNLP PEA   L++S    +++LY ADP ++KA ANTG+  ++G+ N
Sbjct  21   AASSIGINYGQIANNLPHPEAVVPLVKSIDATRLKLYDADPRVLKAFANTGVEFIVGLGN  80

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
              +  M  DP  A++W+  NV  + PA+KI  I VGNE+L   D  L + LLPAM+N+  
Sbjct  81   EYLATMR-DPKQAQAWVKTNVQCYLPATKITCIAVGNEVLTFNDSTLASNLLPAMENIHA  139

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL S ++  ++ V+T H + +L  S PPS+G F   +T  L  +L F    G+PFL+N Y
Sbjct  140  ALVSLNLDKQVMVTTAHNLGILEVSYPPSAGAFRRDLTQKLSCILDFHSKVGSPFLVNAY  199

Query  653  PFFAFQ  670
            PFFA++
Sbjct  200  PFFAYR  205



>gb|KJB39530.1| hypothetical protein B456_007G018900 [Gossypium raimondii]
Length=404

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            +G+NYGQ+A+NLP PE    +++S    KV+LY ADP ++KA ANTG+  ++G+ N  + 
Sbjct  28   MGINYGQIADNLPLPEDVVPIVKSIGATKVKLYDADPKVLKAFANTGVEFIVGLGNEYLD  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++W+  NV +  PA+KI  I VGNE+L   D +L   LLPAMQ++  AL +
Sbjct  88   KMR-DPAKAQAWVKQNVQSHLPATKITCIFVGNEVLTFNDTSLSNSLLPAMQSVHTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H +S+L +S PPSSG F   + D L + LSF   TG+PFLIN YPFFA
Sbjct  147  LGLDKQVTVTTAHSLSILETSYPPSSGAFREDLVDCLSETLSFHQKTGSPFLINAYPFFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>gb|KJB39529.1| hypothetical protein B456_007G018900 [Gossypium raimondii]
Length=413

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            +G+NYGQ+A+NLP PE    +++S    KV+LY ADP ++KA ANTG+  ++G+ N  + 
Sbjct  28   MGINYGQIADNLPLPEDVVPIVKSIGATKVKLYDADPKVLKAFANTGVEFIVGLGNEYLD  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++W+  NV +  PA+KI  I VGNE+L   D +L   LLPAMQ++  AL +
Sbjct  88   KMR-DPAKAQAWVKQNVQSHLPATKITCIFVGNEVLTFNDTSLSNSLLPAMQSVHTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H +S+L +S PPSSG F   + D L + LSF   TG+PFLIN YPFFA
Sbjct  147  LGLDKQVTVTTAHSLSILETSYPPSSGAFREDLVDCLSETLSFHQKTGSPFLINAYPFFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>ref|XP_007163933.1| hypothetical protein PHAVU_L004500g [Phaseolus vulgaris]
 gb|ESW35927.1| hypothetical protein PHAVU_L004500g [Phaseolus vulgaris]
Length=410

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 124/182 (68%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ANNLP+P+    L++     KV+LY ADP ++KA ANTG+ +M+G+ N  + 
Sbjct  29   IGVNYGQIANNLPSPDDAVALVKCIGATKVKLYDADPRVLKAFANTGVEVMVGLGNEYMS  88

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++WI AN+  + PA+KI +I VGNE+L   D +L + LLPAMQ++  AL +
Sbjct  89   RMK-DPTKAQAWIKANLQPYLPATKITSIFVGNEVLTFNDTSLTSNLLPAMQSVHTALVN  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
             ++  +I V+T H +++L +S PPS+G F   +   L  +LSF   TG+PFLIN YP+FA
Sbjct  148  LALDKQITVTTTHSLAVLQTSYPPSAGAFRSDLAPCLAPILSFQAKTGSPFLINAYPYFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>ref|XP_009114852.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Brassica rapa]
Length=414

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+PE    L++S    KV+LY A+P ++KA + TG+  ++G+ N  + 
Sbjct  29   IGVNYGQIGDNLPSPEEVVPLVKSIGATKVKLYDANPEILKAFSGTGVEFIVGLGNEYLS  88

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L   LLPAMQ + +AL +
Sbjct  89   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTDSLLPAMQGVHSALVT  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +++L +S PPS+G F P++ D LK +L F   T +PFLIN YPFFA
Sbjct  148  AGLSDQIAVTTAHSLAILQTSFPPSAGEFSPSVIDYLKPILEFHRKTDSPFLINAYPFFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>ref|XP_012075958.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Jatropha 
curcas]
 gb|KDP34495.1| hypothetical protein JCGZ_11045 [Jatropha curcas]
Length=494

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 127/184 (69%), Gaps = 4/184 (2%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQS-TSIEKVRLYGADPAMIKALANTGIGIMIGVANGDI  301
            IGVNYG VA+NLP P   A  L++ T+I++++++ A+P +++A ANTGI + + V NGDI
Sbjct  27   IGVNYGTVADNLPTPSQVANFLKTKTTIDRIKIFDANPDILRAFANTGISVTVTVGNGDI  86

Query  302  PAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALN  481
            P++A  P  AK+WI AN+L ++P + I  I VGNEIL + D++LI   LPAM+ L++AL 
Sbjct  87   PSLAKLPA-AKAWIAANILPYHPKTIIKYIAVGNEILATSDKSLIAHTLPAMKALKSALE  145

Query  482  SASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAI-TDSLKDLLSFIDATGAPFLINPYPF  658
             A++   I+VST H + +L SSEPPS+GRF     T     +L F   T +PF++NPYPF
Sbjct  146  LANI-TNIQVSTPHSLGILSSSEPPSTGRFRKGYDTRIFAPILEFHRQTKSPFMVNPYPF  204

Query  659  FAFQ  670
            F F+
Sbjct  205  FGFK  208



>ref|XP_011070401.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Sesamum 
indicum]
Length=413

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            +G+NYGQ+ANNLP PEA   L++S    +V+LY ADP ++KA ANTG+  ++G+ N D+ 
Sbjct  26   LGINYGQIANNLPHPEAVVPLVKSIGATRVKLYDADPRVLKAFANTGVEFIVGLGNEDLA  85

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++W+  NV  + PA+ I +I VGNE+L   D  L T LLPAM+++ +AL S
Sbjct  86   RMR-DPKQAQAWVKTNVQRYLPATNITSIAVGNEVLTFNDSTLSTNLLPAMESVHSALVS  144

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
             ++  ++ V+T H + +L  S PPS+G F   +T  L  +L F    G+PFLIN YPFFA
Sbjct  145  LNLDKQVMVTTAHNLGILEVSYPPSAGAFRRDLTQKLSCILDFHSKVGSPFLINAYPFFA  204

Query  665  FQ  670
            ++
Sbjct  205  YK  206



>gb|KHG16903.1| hypothetical protein F383_04540 [Gossypium arboreum]
Length=408

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 121/182 (66%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            +G+NYGQ+A+NLP+PE    +++S    KV+LY ADP ++KA ANTG+  ++G+ N  + 
Sbjct  28   MGINYGQIADNLPSPEDVVPIVKSIGATKVKLYDADPKVLKAFANTGVEFIVGLGNEYLD  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             +  DP  A++W+  NV +  PA+KI  I VGNE+L   D +L   LLPAMQ++  AL +
Sbjct  88   KIR-DPAKAQAWVKQNVQSHLPATKITCIFVGNEVLTFNDTSLSNSLLPAMQSVHTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H +S+L +S PPSSG F   + D L + LSF   TG+PFLIN YPFFA
Sbjct  147  LGLDKQVTVTTAHSLSILETSYPPSSGAFREDLVDCLSETLSFHQKTGSPFLINAYPFFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>gb|AFW67776.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=386

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 139/185 (75%), Gaps = 6/185 (3%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYG+VA+NLP P +TA+L+QST+I KVRLYG DPA+I A + TG+ +++G  N
Sbjct  27   SQSFIGINYGEVADNLPPPSSTARLVQSTTITKVRLYGTDPAIISAFSGTGVSLLLGATN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDI  +A+ P  A +W+ A++ A  PA  + T++VGNE+L++ D +L +QL+PAMQNL +
Sbjct  87   GDIANLASSPAAAAAWVAAHLPASSPA--VSTVSVGNEVLFA-DASLASQLVPAMQNLHD  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL   S    +KVSTV+ M +L SS+PPSSG F P +  +L  LL+F+  TG+PFLINPY
Sbjct  144  ALPPNS---SVKVSTVNAMDVLASSDPPSSGAFKPELAAALDPLLAFLSKTGSPFLINPY  200

Query  653  PFFAF  667
            P+FA+
Sbjct  201  PYFAY  205



>ref|XP_012075957.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Jatropha 
curcas]
Length=506

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 127/184 (69%), Gaps = 4/184 (2%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQS-TSIEKVRLYGADPAMIKALANTGIGIMIGVANGDI  301
            IGVNYG VA+NLP P   A  L++ T+I++++++ A+P +++A ANTGI + + V NGDI
Sbjct  27   IGVNYGTVADNLPTPSQVANFLKTKTTIDRIKIFDANPDILRAFANTGISVTVTVGNGDI  86

Query  302  PAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALN  481
            P++A  P  AK+WI AN+L ++P + I  I VGNEIL + D++LI   LPAM+ L++AL 
Sbjct  87   PSLAKLPA-AKAWIAANILPYHPKTIIKYIAVGNEILATSDKSLIAHTLPAMKALKSALE  145

Query  482  SASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAI-TDSLKDLLSFIDATGAPFLINPYPF  658
             A++   I+VST H + +L SSEPPS+GRF     T     +L F   T +PF++NPYPF
Sbjct  146  LANI-TNIQVSTPHSLGILSSSEPPSTGRFRKGYDTRIFAPILEFHRQTKSPFMVNPYPF  204

Query  659  FAFQ  670
            F F+
Sbjct  205  FGFK  208



>emb|CDX93815.1| BnaA09g24150D [Brassica napus]
Length=414

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 118/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+PE    L++S    KV+LY A+P ++KA + TG+  ++G+ N  + 
Sbjct  29   IGVNYGQIGDNLPSPEEVVPLVKSIGATKVKLYDANPEILKAFSGTGVEFIVGLGNEYLS  88

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L   LLPAMQ + +AL +
Sbjct  89   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTDSLLPAMQGVHSALVT  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +++L +S PPS+G F P + D LK +L F   T +PFLIN YPFFA
Sbjct  148  AGLSDQIAVTTAHSLAILQTSFPPSAGEFSPGVIDYLKPILEFHRKTDSPFLINAYPFFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>emb|CDY69080.1| BnaCnng61800D [Brassica napus]
Length=418

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 118/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+PE    L++S    KV+LY A+P ++KA + TG+  ++G+ N  + 
Sbjct  29   IGVNYGQIGDNLPSPEEVVPLVKSIGATKVKLYDANPEILKAFSGTGVEFIVGLGNEYLS  88

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L   LLPAMQ + +AL +
Sbjct  89   KMK-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTDSLLPAMQGVHSALVT  147

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +++L +S PPS+G F P + D LK +L F   T +PFLIN YPFFA
Sbjct  148  AGLSDQIAVTTAHSLAILQTSFPPSAGEFSPGVIDYLKPILEFHRKTDSPFLINAYPFFA  207

Query  665  FQ  670
            ++
Sbjct  208  YK  209



>ref|XP_007039346.1| Glucan endo-1,3-beta-glucosidase 11 isoform 4 [Theobroma cacao]
 gb|EOY23847.1| Glucan endo-1,3-beta-glucosidase 11 isoform 4 [Theobroma cacao]
Length=387

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+ANNLP+PE    L++S    KV+LY ADP ++ A ANTG+  ++G+ N  + 
Sbjct  28   IGINYGQIANNLPSPEDVVPLVKSIGATKVKLYDADPGVLSAFANTGVEFIVGLGNEYLD  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++W+  NV A  PA+K+  I VGNE+L   D  L   LLPAMQ++  AL +
Sbjct  88   RMQ-DPAKAEAWVKQNVQAHLPATKVTCIFVGNEVLTFNDTTLSDNLLPAMQSVHTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H +++L +S PPS+G F   + D L + LSF   TG+PFLIN YP+FA
Sbjct  147  LGLDKQVTVTTAHSLAILETSYPPSAGAFREDLIDCLSETLSFHQKTGSPFLINAYPYFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>ref|XP_010267530.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=455

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  QSFIGVNYGQVANNLPAPEATAK-LLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            Q  IGVNYG +ANNLP P   A  LL+ T+I +VRL+ A+PA+++A A+TGI + I V N
Sbjct  29   QGTIGVNYGTIANNLPPPAEVAHFLLEETTINRVRLFDANPAILQAFAHTGIAVTITVPN  88

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
              IP +     +A+ W+ +NVL + P++ I+ I VGNE+L + ++ LI  L+PAMQNL  
Sbjct  89   QQIPDLT-KLSFAQHWVKSNVLPYTPSTNIIRILVGNEVLSTANKLLIASLVPAMQNLHT  147

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAI-TDSLKDLLSFIDATGAPFLINP  649
            AL   S+  +I+VST H + +L +S PPS+G+F     T  LK LLSF+ AT +PF+INP
Sbjct  148  ALVGVSLDRRIQVSTPHSLGILSTSSPPSTGKFRRGYDTVVLKPLLSFLKATNSPFMINP  207

Query  650  YPFF  661
            YPFF
Sbjct  208  YPFF  211



>ref|XP_007039348.1| Glucan endo-1,3-beta-glucosidase 11 isoform 6 [Theobroma cacao]
 gb|EOY23849.1| Glucan endo-1,3-beta-glucosidase 11 isoform 6 [Theobroma cacao]
Length=396

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+ANNLP+PE    L++S    KV+LY ADP ++ A ANTG+  ++G+ N  + 
Sbjct  28   IGINYGQIANNLPSPEDVVPLVKSIGATKVKLYDADPGVLSAFANTGVEFIVGLGNEYLD  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++W+  NV A  PA+K+  I VGNE+L   D  L   LLPAMQ++  AL +
Sbjct  88   RMQ-DPAKAEAWVKQNVQAHLPATKVTCIFVGNEVLTFNDTTLSDNLLPAMQSVHTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H +++L +S PPS+G F   + D L + LSF   TG+PFLIN YP+FA
Sbjct  147  LGLDKQVTVTTAHSLAILETSYPPSAGAFREDLIDCLSETLSFHQKTGSPFLINAYPYFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>ref|XP_008800671.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Phoenix 
dactylifera]
Length=426

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 122/184 (66%), Gaps = 0/184 (0%)
 Frame = +2

Query  119  SFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGD  298
            S +G+NYG+V NNLP+PE   +L+ +  + +VRLY ADPA I+A ANTGI +++G+ +  
Sbjct  27   SLVGINYGRVGNNLPSPETVPRLVSTIGVGRVRLYDADPAAIRAFANTGIELVVGLPDRC  86

Query  299  IPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNAL  478
            +P +A D G A +W+ +NV A+ PA+KI  + VGNE+L S +  L   LLPAM+NL +AL
Sbjct  87   LPKLAGDAGQALAWVRSNVQAYLPAAKIAFLTVGNEVLTSNNTALPRFLLPAMENLHSAL  146

Query  479  NSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPF  658
             S  +  +I V+T H +++L  S PPS+  F   +   +  LL F   TG+PF IN YP+
Sbjct  147  TSLGLDRQIAVTTAHSLAVLGDSYPPSTATFRRDLLPLVCPLLDFHARTGSPFFINAYPY  206

Query  659  FAFQ  670
            FA++
Sbjct  207  FAYE  210



>gb|AFW67777.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=442

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 139/185 (75%), Gaps = 6/185 (3%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIG+NYG+VA+NLP P +TA+L+QST+I KVRLYG DPA+I A + TG+ +++G  N
Sbjct  27   SQSFIGINYGEVADNLPPPSSTARLVQSTTITKVRLYGTDPAIISAFSGTGVSLLLGATN  86

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            GDI  +A+ P  A +W+ A++ A  PA  + T++VGNE+L++ D +L +QL+PAMQNL +
Sbjct  87   GDIANLASSPAAAAAWVAAHLPASSPA--VSTVSVGNEVLFA-DASLASQLVPAMQNLHD  143

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL   S    +KVSTV+ M +L SS+PPSSG F P +  +L  LL+F+  TG+PFLINPY
Sbjct  144  ALPPNS---SVKVSTVNAMDVLASSDPPSSGAFKPELAAALDPLLAFLSKTGSPFLINPY  200

Query  653  PFFAF  667
            P+FA+
Sbjct  201  PYFAY  205



>gb|ADW08741.1| 1,3-beta-D-glucanase GH17_33 [Populus tremula x Populus tremuloides]
Length=413

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+ANNLP P+    L++S    KV+LY ADP ++KA ANTG+  ++G+ N  + 
Sbjct  28   IGINYGQIANNLPTPDNVIPLVKSIGATKVKLYDADPRVLKAFANTGVEFIVGLGNEYLS  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++W+ ANV A+ PA+KI  I +GNEIL   D +L   LLPAMQ +Q AL +
Sbjct  88   KMR-DPDKAQAWVKANVQAYLPATKITCITIGNEILTFNDTSLTDNLLPAMQGIQTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H +++L  S PPS+G F   +  S+  +L+F   T +PFLIN YPFFA
Sbjct  147  LGLDKQVSVTTAHSLAVLEVSFPPSAGSFRKDLVGSITPILNFHAKTNSPFLINAYPFFA  206

Query  665  FQ  670
            F+
Sbjct  207  FK  208



>ref|XP_007039344.1| Glucan endo-1,3-beta-glucosidase 11 isoform 2 [Theobroma cacao]
 gb|EOY23845.1| Glucan endo-1,3-beta-glucosidase 11 isoform 2 [Theobroma cacao]
Length=409

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+ANNLP+PE    L++S    KV+LY ADP ++ A ANTG+  ++G+ N  + 
Sbjct  28   IGINYGQIANNLPSPEDVVPLVKSIGATKVKLYDADPGVLSAFANTGVEFIVGLGNEYLD  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++W+  NV A  PA+K+  I VGNE+L   D  L   LLPAMQ++  AL +
Sbjct  88   RMQ-DPAKAEAWVKQNVQAHLPATKVTCIFVGNEVLTFNDTTLSDNLLPAMQSVHTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H +++L +S PPS+G F   + D L + LSF   TG+PFLIN YP+FA
Sbjct  147  LGLDKQVTVTTAHSLAILETSYPPSAGAFREDLIDCLSETLSFHQKTGSPFLINAYPYFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>ref|XP_006645060.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Oryza brachyantha]
Length=400

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 121/186 (65%), Gaps = 1/186 (1%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            AQ F G+NYGQ+ANNLP P   A LLQS ++ KV+LY ADP ++ + ANTG+  +I + N
Sbjct  29   AQKF-GINYGQIANNLPDPTQVAGLLQSLNVNKVKLYDADPKVLMSFANTGVEFIIAIGN  87

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
             ++ AMA +PG A+ W+  +V  F PA++I  I VGNE+    D  ++  LLPAM+ +  
Sbjct  88   ENLQAMADNPGAARQWVTQHVQPFIPATRITCITVGNEVFSGNDTGMMASLLPAMKAIYA  147

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            A+    + G++ VS+ H +++L +S PPSSG F   +   ++ LL F   T +PFLIN Y
Sbjct  148  AVGDLGLRGQVTVSSAHSVNVLATSFPPSSGAFREDLAQYIQPLLDFHGQTNSPFLINAY  207

Query  653  PFFAFQ  670
            PFFA++
Sbjct  208  PFFAYK  213



>ref|NP_001147326.1| LOC100280934 precursor [Zea mays]
 gb|ACF87237.1| unknown [Zea mays]
 gb|ACG26810.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 gb|ACN31798.1| unknown [Zea mays]
 tpg|DAA44251.2| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=427

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 126/185 (68%), Gaps = 6/185 (3%)
 Frame = +2

Query  113  AQSFIGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVAN  292
            +QSFIGVNYG +A+NLP P +TA LL STSI K+RLY   P ++ ALA + I I++G+ N
Sbjct  26   SQSFIGVNYGTIADNLPPPASTASLLMSTSIAKLRLYEPQPDLVAALAGSNISILLGIPN  85

Query  293  GDIPAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQN  472
            G +P +A+ P  A SW  AN+    P S   +I+VGNE+L SGD  L  QLLPAMQNL  
Sbjct  86   GAVPNLASSPAAAASWAAANIPTTLPVS---SISVGNELLNSGDPTLAPQLLPAMQNLLA  142

Query  473  ALNSASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPY  652
            AL     G   K+STVH M++L +S+PPSSG F P +  SL  +L F+   GAPF+INPY
Sbjct  143  AL---PAGSTTKISTVHSMAVLSASDPPSSGAFHPDLAGSLDPVLDFLHQNGAPFMINPY  199

Query  653  PFFAF  667
            P+FA+
Sbjct  200  PYFAY  204



>ref|XP_007039345.1| Glucan endo-1,3-beta-glucosidase 11 isoform 3 [Theobroma cacao]
 ref|XP_007039347.1| Glucan endo-1,3-beta-glucosidase 11 isoform 3 [Theobroma cacao]
 gb|EOY23846.1| Glucan endo-1,3-beta-glucosidase 11 isoform 3 [Theobroma cacao]
 gb|EOY23848.1| Glucan endo-1,3-beta-glucosidase 11 isoform 3 [Theobroma cacao]
Length=408

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+ANNLP+PE    L++S    KV+LY ADP ++ A ANTG+  ++G+ N  + 
Sbjct  28   IGINYGQIANNLPSPEDVVPLVKSIGATKVKLYDADPGVLSAFANTGVEFIVGLGNEYLD  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++W+  NV A  PA+K+  I VGNE+L   D  L   LLPAMQ++  AL +
Sbjct  88   RMQ-DPAKAEAWVKQNVQAHLPATKVTCIFVGNEVLTFNDTTLSDNLLPAMQSVHTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H +++L +S PPS+G F   + D L + LSF   TG+PFLIN YP+FA
Sbjct  147  LGLDKQVTVTTAHSLAILETSYPPSAGAFREDLIDCLSETLSFHQKTGSPFLINAYPYFA  206

Query  665  FQ  670
            ++
Sbjct  207  YK  208



>emb|CDP12246.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 124/182 (68%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            I +NYGQ+ANNLP+PE+   L++S    +++LY ADP ++KA ANTG+  ++ + N  + 
Sbjct  46   IAINYGQIANNLPSPESVVPLVKSIGATRLKLYDADPTVLKAFANTGVEFIVSLGNQYL-  104

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
            +   DP  A +W+ ANV  F PA++I  I VGNE+L   D +L + LLPAMQ++ +AL S
Sbjct  105  SKTRDPKQALAWVKANVQPFLPATRITCIAVGNEVLTFNDTSLSSNLLPAMQSVYSALCS  164

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
             ++  K+ V+T H +++L +S PPS+GRF P +   L  +L+F   TG+PFLIN YP+FA
Sbjct  165  LNLQDKVSVTTAHSLAVLQTSYPPSAGRFRPDLAPCLTAILNFHLKTGSPFLINAYPYFA  224

Query  665  FQ  670
            ++
Sbjct  225  YK  226



>ref|XP_006415143.1| hypothetical protein EUTSA_v10007671mg [Eutrema salsugineum]
 gb|ESQ33496.1| hypothetical protein EUTSA_v10007671mg [Eutrema salsugineum]
Length=437

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IGVNYGQ+ +NLP+PE    L++S    KV+LY A+P ++KA + TG+  ++G+ N  + 
Sbjct  30   IGVNYGQIGDNLPSPEQVVPLVKSIGATKVKLYDANPQILKAFSGTGVEFIVGLGNEYLS  89

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A +WI  NV  F PA+ I  I +GNEIL   D +L   LLPAMQ + +AL +
Sbjct  90   KMR-DPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLADNLLPAMQGVHSALIT  148

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
            A +  +I V+T H +S+L +S PPS+G F P + D+LK +L F   T +PFLIN YPFFA
Sbjct  149  AGLSDQIAVTTAHSLSILQTSFPPSAGEFHPDLIDTLKPILEFHRKTDSPFLINAYPFFA  208

Query  665  FQ  670
            ++
Sbjct  209  YK  210



>ref|XP_010662898.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
 emb|CBI23036.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 123/183 (67%), Gaps = 3/183 (2%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAK-LLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDI  301
            IGVNYG VAN+LP P   A+ LL+ST+I +VR++ ADP MI+A A+TGI + + V N  I
Sbjct  24   IGVNYGTVANDLPPPSEVARFLLESTTINRVRMFDADPEMIQAFAHTGIAVTVTVPNELI  83

Query  302  PAMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALN  481
            P +     +A+ W+  NV  + PA+ ++ I VGNE+L + ++ LI  L+PAMQ L  AL 
Sbjct  84   PRLT-KLSFAQQWVKTNVQPYVPATNLIRILVGNEVLSTANKLLIAGLVPAMQTLHTALA  142

Query  482  SASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAI-TDSLKDLLSFIDATGAPFLINPYPF  658
            + S+  +IKVST H + +L +S PPS+GRF        +K LLSF+ AT +PF+INPYPF
Sbjct  143  AVSLDRRIKVSTPHSLGILSTSSPPSTGRFRQGYDVHVIKPLLSFLRATNSPFMINPYPF  202

Query  659  FAF  667
            F +
Sbjct  203  FGY  205



>ref|XP_011038000.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 
[Populus euphratica]
Length=416

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +2

Query  125  IGVNYGQVANNLPAPEATAKLLQSTSIEKVRLYGADPAMIKALANTGIGIMIGVANGDIP  304
            IG+NYGQ+ANNLP P+    L++S    KV+LY ADP ++KA ANTG+  ++G+ N  + 
Sbjct  28   IGINYGQIANNLPTPDNVIPLVKSIGATKVKLYDADPRVLKAFANTGVEFIVGLGNEYLS  87

Query  305  AMAADPGYAKSWIGANVLAFYPASKIMTINVGNEILYSGDRNLITQLLPAMQNLQNALNS  484
             M  DP  A++W+ ANV A+ PA+KI  I +GNEIL   D +L   LLPAMQ +Q AL +
Sbjct  88   KMR-DPDKAQAWVKANVQAYLPATKITCITIGNEILTFNDTSLTDNLLPAMQGIQTALVN  146

Query  485  ASVGGKIKVSTVHGMSMLVSSEPPSSGRFDPAITDSLKDLLSFIDATGAPFLINPYPFFA  664
              +  ++ V+T H +++L  S PPS+G F   +  S+  +L+F   T +PFLIN YPFFA
Sbjct  147  LGLDKQVSVTTAHSLAVLDVSFPPSAGSFRKDLVGSITPILNFHAKTNSPFLINAYPFFA  206

Query  665  FQ  670
            F+
Sbjct  207  FK  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1119419305360