BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1785

Length=1692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP01505.1|  unnamed protein product                                659   0.0      Coffea canephora [robusta coffee]
ref|XP_009605819.1|  PREDICTED: lanC-like protein GCL1                  652   0.0      Nicotiana tomentosiformis
ref|XP_009800854.1|  PREDICTED: lanC-like protein GCL1                  644   0.0      Nicotiana sylvestris
ref|XP_004250112.1|  PREDICTED: lanC-like protein GCL1                  642   0.0      Solanum lycopersicum
ref|XP_006353211.1|  PREDICTED: lanC-like protein 2-like                639   0.0      Solanum tuberosum [potatoes]
gb|AAF75794.1|AF272710_1  putative 7-transmembrane G-protein-coup...    639   0.0      Solanum chacoense
ref|XP_007047870.1|  GCR2-like 1                                        624   0.0      
ref|XP_002262692.1|  PREDICTED: lanC-like protein GCL1 isoform X2       623   0.0      Vitis vinifera
ref|XP_002306296.2|  hypothetical protein POPTR_0005s07360g             623   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002268951.3|  PREDICTED: lanC-like protein GCL1                  623   0.0      Vitis vinifera
ref|XP_011031065.1|  PREDICTED: lanC-like protein GCL1                  622   0.0      Populus euphratica
gb|EYU30985.1|  hypothetical protein MIMGU_mgv1a006900mg                622   0.0      Erythranthe guttata [common monkey flower]
emb|CAN83415.1|  hypothetical protein VITISV_029722                     621   0.0      Vitis vinifera
ref|XP_010652678.1|  PREDICTED: lanC-like protein GCL1 isoform X1       621   0.0      Vitis vinifera
ref|XP_011100038.1|  PREDICTED: lanC-like protein GCL1                  620   0.0      Sesamum indicum [beniseed]
ref|XP_002309963.2|  hypothetical protein POPTR_0007s05070g             619   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006466262.1|  PREDICTED: lanC-like protein GCL1-like             619   0.0      Citrus sinensis [apfelsine]
ref|XP_004288166.1|  PREDICTED: lanC-like protein GCL1                  617   0.0      Fragaria vesca subsp. vesca
ref|XP_011022825.1|  PREDICTED: lanC-like protein GCL1                  617   0.0      Populus euphratica
gb|KDO60700.1|  hypothetical protein CISIN_1g013959mg                   616   0.0      Citrus sinensis [apfelsine]
ref|XP_006426333.1|  hypothetical protein CICLE_v10025657mg             614   0.0      Citrus clementina [clementine]
gb|KDO60699.1|  hypothetical protein CISIN_1g013959mg                   611   0.0      Citrus sinensis [apfelsine]
ref|XP_008387575.1|  PREDICTED: lanC-like protein GCL1                  610   0.0      
ref|XP_008235076.1|  PREDICTED: lanC-like protein GCL1                  608   0.0      Prunus mume [ume]
ref|XP_010267103.1|  PREDICTED: lanC-like protein GCL1                  607   0.0      
gb|KHG19988.1|  LanC-like protein 2                                     604   0.0      Gossypium arboreum [tree cotton]
ref|XP_012081620.1|  PREDICTED: lanC-like protein GCL1                  600   0.0      Jatropha curcas
emb|CBI33140.3|  unnamed protein product                                602   0.0      Vitis vinifera
gb|KJB48857.1|  hypothetical protein B456_008G090400                    600   0.0      Gossypium raimondii
ref|XP_002531667.1|  catalytic, putative                                597   0.0      Ricinus communis
ref|XP_010025417.1|  PREDICTED: lanC-like protein GCL1                  597   0.0      Eucalyptus grandis [rose gum]
gb|ADU04150.1|  hypothetical protein                                    597   0.0      Gossypium hirsutum [American cotton]
ref|XP_009339587.1|  PREDICTED: lanC-like protein GCL1                  595   0.0      Pyrus x bretschneideri [bai li]
ref|XP_004146876.1|  PREDICTED: lanC-like protein GCL1                  594   0.0      Cucumis sativus [cucumbers]
gb|ADU04157.1|  hypothetical protein                                    594   0.0      Gossypium hirsutum [American cotton]
ref|XP_008453808.1|  PREDICTED: lanC-like protein GCL1                  593   0.0      Cucumis melo [Oriental melon]
ref|XP_009365826.1|  PREDICTED: lanC-like protein GCL1                  592   0.0      Pyrus x bretschneideri [bai li]
gb|KHN44353.1|  LanC-like protein 2                                     581   0.0      Glycine soja [wild soybean]
ref|XP_003538606.1|  PREDICTED: lanC-like protein 2-like isoform X1     581   0.0      Glycine max [soybeans]
ref|XP_004502406.1|  PREDICTED: lanC-like protein 2-like                580   0.0      Cicer arietinum [garbanzo]
ref|XP_008358138.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    581   0.0      
ref|XP_003552029.2|  PREDICTED: lanC-like protein GCL1-like             582   0.0      Glycine max [soybeans]
ref|XP_007163665.1|  hypothetical protein PHAVU_001G253500g             577   0.0      Phaseolus vulgaris [French bean]
ref|XP_006591491.1|  PREDICTED: lanC-like protein 2-like isoform X2     577   0.0      Glycine max [soybeans]
ref|XP_010519354.1|  PREDICTED: lanC-like protein GCL1                  577   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010463250.1|  PREDICTED: lanC-like protein GCL1                  576   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_002866662.1|  hypothetical protein ARALYDRAFT_358729             576   0.0      Arabidopsis lyrata subsp. lyrata
ref|XP_003601926.1|  G protein-coupled receptor-like protein            575   0.0      Medicago truncatula
ref|XP_009150615.1|  PREDICTED: lanC-like protein GCL1                  569   0.0      Brassica rapa
ref|XP_010484384.1|  PREDICTED: lanC-like protein GCL1                  569   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010444546.1|  PREDICTED: lanC-like protein GCL1                  565   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_006280490.1|  hypothetical protein CARUB_v10026430mg             565   0.0      
ref|XP_010680997.1|  PREDICTED: lanC-like protein GCL1                  564   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|NP_201331.1|  protein GCR2-like 1                                   563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394052.1|  hypothetical protein EUTSA_v10004256mg             562   0.0      Eutrema salsugineum [saltwater cress]
gb|AAK96841.1|  G protein-coupled receptor-like protein                 562   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY08803.1|  BnaA06g24210D                                          561   0.0      Brassica napus [oilseed rape]
gb|KFK28210.1|  hypothetical protein AALP_AA8G486800                    561   0.0      Arabis alpina [alpine rockcress]
gb|KHN31391.1|  LanC-like protein 2                                     554   0.0      Glycine soja [wild soybean]
ref|XP_010937380.1|  PREDICTED: lanC-like protein GCL1                  537   0.0      Elaeis guineensis
gb|KJB48858.1|  hypothetical protein B456_008G090400                    508   3e-173   Gossypium raimondii
gb|ABK24484.1|  unknown                                                 508   2e-172   Picea sitchensis
gb|KCW62074.1|  hypothetical protein EUGRSUZ_H04744                     444   5e-147   Eucalyptus grandis [rose gum]
emb|CDY55165.1|  BnaCnng28300D                                          429   9e-144   Brassica napus [oilseed rape]
ref|XP_001776967.1|  predicted protein                                  429   4e-142   
ref|XP_006829929.2|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    427   3e-141   Amborella trichopoda
ref|XP_006591493.1|  PREDICTED: lanC-like protein 2-like isoform X4     423   2e-140   Glycine max [soybeans]
ref|XP_002966453.1|  hypothetical protein SELMODRAFT_86123              425   3e-140   
ref|XP_003601927.1|  G protein-coupled receptor-like protein            415   5e-138   
ref|XP_001758715.1|  predicted protein                                  418   1e-137   
ref|XP_004141231.1|  PREDICTED: lanC-like protein GCR2                  370   7e-119   Cucumis sativus [cucumbers]
ref|XP_010462143.1|  PREDICTED: lanC-like protein GCR2                  369   1e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002894411.1|  predicted protein                                  368   3e-118   Arabidopsis lyrata subsp. lyrata
ref|XP_010500915.1|  PREDICTED: lanC-like protein GCR2                  367   6e-118   Camelina sativa [gold-of-pleasure]
gb|KDO74125.1|  hypothetical protein CISIN_1g015433mg                   365   4e-117   Citrus sinensis [apfelsine]
ref|XP_006464716.1|  PREDICTED: lanC-like protein GCR2-like             365   4e-117   Citrus sinensis [apfelsine]
ref|XP_002284781.1|  PREDICTED: lanC-like protein GCR2                  365   6e-117   Vitis vinifera
ref|XP_006303704.1|  hypothetical protein CARUB_v10011802mg             364   1e-116   Capsella rubella
gb|ACU17850.1|  unknown                                                 357   2e-116   Glycine max [soybeans]
ref|XP_007021343.1|  G protein coupled receptor                         363   2e-116   
gb|KFK35758.1|  hypothetical protein AALP_AA4G032600                    363   2e-116   Arabis alpina [alpine rockcress]
ref|XP_010099009.1|  hypothetical protein L484_025669                   362   9e-116   Morus notabilis
gb|EYU26400.1|  hypothetical protein MIMGU_mgv1a007259mg                362   1e-115   Erythranthe guttata [common monkey flower]
ref|XP_006451926.1|  hypothetical protein CICLE_v10008488mg             361   2e-115   Citrus clementina [clementine]
ref|XP_012084921.1|  PREDICTED: lanC-like protein GCR2                  361   2e-115   Jatropha curcas
ref|XP_010234867.1|  PREDICTED: lanC-like protein GCR2 isoform X1       363   2e-115   Brachypodium distachyon [annual false brome]
ref|XP_002517941.1|  catalytic, putative                                360   3e-115   Ricinus communis
gb|KJB84324.1|  hypothetical protein B456_N018400                       360   4e-115   Gossypium raimondii
ref|XP_010245303.1|  PREDICTED: lanC-like protein GCL2                  360   7e-115   Nelumbo nucifera [Indian lotus]
ref|XP_006370294.1|  hypothetical protein POPTR_0001s41360g             359   8e-115   Populus trichocarpa [western balsam poplar]
gb|ERM95223.1|  hypothetical protein AMTR_s00009p00267750               357   1e-114   Amborella trichopoda
ref|XP_011042485.1|  PREDICTED: lanC-like protein GCR2                  359   1e-114   Populus euphratica
ref|XP_003574129.2|  PREDICTED: lanC-like protein GCR2 isoform X2       361   2e-114   Brachypodium distachyon [annual false brome]
ref|XP_004487685.1|  PREDICTED: lanC-like protein 2-like                359   2e-114   Cicer arietinum [garbanzo]
gb|ABB47830.2|  Lanthionine synthetase C-like protein, expressed        358   2e-114   Oryza sativa Japonica Group [Japonica rice]
gb|KEH38770.1|  G protein coupled receptor                              358   3e-114   Medicago truncatula
gb|ABB47829.2|  Lanthionine synthetase C-like protein, expressed        357   4e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010062888.1|  PREDICTED: lanC-like protein GCR2                  357   6e-114   Eucalyptus grandis [rose gum]
gb|KHG14999.1|  LanC-like protein 2                                     357   7e-114   Gossypium arboreum [tree cotton]
ref|NP_001064963.1|  Os10g0497900                                       358   8e-114   
gb|AAG52264.1|AC019018_1  putative G protein-coupled receptor; 80...    356   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011626219.1|  PREDICTED: lanC-like protein GCR2                  354   1e-113   
ref|NP_175700.2|  G-protein coupled receptor 2                          356   1e-113   Arabidopsis thaliana [mouse-ear cress]
pdb|3T33|A  Chain A, Crystal Structure Of Arabidopsis Gcr2              356   2e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147647.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    356   2e-113   Brassica rapa
gb|AAL58268.1|AC068923_10  putative lanthionine synthetase              357   2e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004244211.1|  PREDICTED: lanC-like protein GCL2                  355   3e-113   Solanum lycopersicum
ref|XP_010051804.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    355   4e-113   Eucalyptus grandis [rose gum]
ref|XP_008452476.1|  PREDICTED: lanC-like protein GCL2 isoform X2       355   6e-113   Cucumis melo [Oriental melon]
emb|CDP05888.1|  unnamed protein product                                354   1e-112   Coffea canephora [robusta coffee]
ref|XP_004982728.1|  PREDICTED: lanC-like protein 2-like                355   1e-112   
ref|XP_003540453.1|  PREDICTED: lanC-like protein GCR2-like             353   2e-112   Glycine max [soybeans]
gb|KHN28043.1|  LanC-like protein 2                                     353   2e-112   Glycine soja [wild soybean]
gb|ACN31611.1|  unknown                                                 353   2e-112   Zea mays [maize]
gb|KJB84326.1|  hypothetical protein B456_N018400                       352   4e-112   Gossypium raimondii
tpg|DAA49457.1|  TPA: LOW QUALITY PROTEIN: lanC-like protein 2          352   4e-112   
ref|NP_001149305.1|  LOC100282928                                       352   5e-112   
ref|XP_008676974.1|  PREDICTED: LOC100282928 isoform X1                 353   5e-112   Zea mays [maize]
ref|XP_006392852.1|  hypothetical protein EUTSA_v10011533mg             352   6e-112   Eutrema salsugineum [saltwater cress]
gb|AES74528.2|  G protein coupled receptor                              353   6e-112   Medicago truncatula
ref|XP_006348234.1|  PREDICTED: lanC-like protein 2-like                352   7e-112   Solanum tuberosum [potatoes]
gb|EMS68258.1|  LanC-like protein 2                                     352   1e-111   Triticum urartu
ref|XP_007149603.1|  hypothetical protein PHAVU_005G083500g             352   1e-111   Phaseolus vulgaris [French bean]
tpg|DAA49459.1|  TPA: hypothetical protein ZEAMMB73_373795              352   1e-111   
ref|XP_011085355.1|  PREDICTED: lanC-like protein GCL2                  350   3e-111   Sesamum indicum [beniseed]
ref|XP_008452475.1|  PREDICTED: lanC-like protein GCL2 isoform X1       350   3e-111   Cucumis melo [Oriental melon]
ref|XP_006661914.1|  PREDICTED: lanC-like protein GCR2-like             348   1e-110   
ref|XP_011098332.1|  PREDICTED: lanC-like protein GCR2                  348   1e-110   
ref|XP_010542278.1|  PREDICTED: lanC-like protein GCR2                  348   1e-110   Tarenaya hassleriana [spider flower]
ref|XP_002534246.1|  catalytic, putative                                348   2e-110   Ricinus communis
ref|XP_007212308.1|  hypothetical protein PRUPE_ppa006721mg             347   4e-110   Prunus persica
ref|XP_010918434.1|  PREDICTED: lanC-like protein GCL2 isoform X1       347   4e-110   Elaeis guineensis
ref|XP_003539910.1|  PREDICTED: lanC-like protein GCL2-like             345   3e-109   Glycine max [soybeans]
ref|XP_009400288.1|  PREDICTED: lanC-like protein GCL2                  344   6e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ16566.1|  hypothetical protein OsJ_32039                          346   6e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008226665.1|  PREDICTED: lanC-like protein GCR2                  344   7e-109   Prunus mume [ume]
gb|AGV54697.1|  lanC-like protein 2                                     343   9e-109   Phaseolus vulgaris [French bean]
ref|XP_010241998.1|  PREDICTED: lanC-like protein GCL2 isoform X2       343   1e-108   Nelumbo nucifera [Indian lotus]
gb|EMT26581.1|  LanC-like protein 2                                     349   1e-108   
ref|XP_010241999.1|  PREDICTED: lanC-like protein GCL2 isoform X3       343   2e-108   Nelumbo nucifera [Indian lotus]
ref|XP_012088306.1|  PREDICTED: lanC-like protein GCL2                  343   2e-108   Jatropha curcas
ref|XP_008366750.1|  PREDICTED: lanC-like protein GCL2                  343   2e-108   Malus domestica [apple tree]
ref|XP_007132705.1|  hypothetical protein PHAVU_011G117700g             342   3e-108   Phaseolus vulgaris [French bean]
ref|XP_004514463.1|  PREDICTED: lanC-like protein 2-like                343   4e-108   
ref|XP_008229171.1|  PREDICTED: lanC-like protein GCL2                  340   2e-107   Prunus mume [ume]
gb|ABQ14360.1|  abscisic acid ABA receptor                              341   2e-107   Populus trichocarpa [western balsam poplar]
ref|XP_007215460.1|  hypothetical protein PRUPE_ppa006408mg             340   3e-107   Prunus persica
gb|KHG20582.1|  LanC-like protein 2                                     340   3e-107   Gossypium arboreum [tree cotton]
gb|KJB79968.1|  hypothetical protein B456_013G075200                    339   5e-107   Gossypium raimondii
ref|XP_002263345.1|  PREDICTED: lanC-like protein GCL2                  339   5e-107   Vitis vinifera
emb|CAN64758.1|  hypothetical protein VITISV_008093                     339   5e-107   Vitis vinifera
ref|XP_008809400.1|  PREDICTED: lanC-like protein GCL2                  338   7e-107   Phoenix dactylifera
ref|XP_003618310.1|  LanC-like protein                                  341   7e-107   
ref|XP_008381258.1|  PREDICTED: lanC-like protein GCL2                  339   7e-107   
ref|XP_009767465.1|  PREDICTED: lanC-like protein GCL2 isoform X1       338   2e-106   Nicotiana sylvestris
ref|XP_010675629.1|  PREDICTED: lanC-like protein GCR2                  337   2e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009357824.1|  PREDICTED: lanC-like protein GCL2                  337   3e-106   Pyrus x bretschneideri [bai li]
gb|EYU26156.1|  hypothetical protein MIMGU_mgv1a007017mg                337   4e-106   Erythranthe guttata [common monkey flower]
ref|XP_007043559.1|  GCR2-like 2 isoform 1                              337   4e-106   
ref|XP_004244212.1|  PREDICTED: lanC-like protein GCR2                  337   4e-106   Solanum lycopersicum
ref|XP_009767466.1|  PREDICTED: lanC-like protein GCL2 isoform X2       337   4e-106   Nicotiana sylvestris
ref|XP_006348233.1|  PREDICTED: lanC-like protein 2-like                337   4e-106   Solanum tuberosum [potatoes]
ref|XP_009766748.1|  PREDICTED: lanC-like protein GCL2                  337   5e-106   Nicotiana sylvestris
ref|XP_006409014.1|  hypothetical protein EUTSA_v10002001mg             336   6e-106   Eutrema salsugineum [saltwater cress]
gb|KFK40450.1|  hypothetical protein AALP_AA3G374700                    336   9e-106   Arabis alpina [alpine rockcress]
ref|XP_002467007.1|  hypothetical protein SORBIDRAFT_01g018190          337   1e-105   
emb|CAJ86377.1|  OSIGBa0155K17.4                                        335   2e-105   Oryza sativa [red rice]
ref|NP_001174024.1|  Os04g0529600                                       335   2e-105   
ref|XP_002884221.1|  hypothetical protein ARALYDRAFT_480913             334   3e-105   
ref|XP_011045509.1|  PREDICTED: lanC-like protein GCL2                  333   1e-104   Populus euphratica
ref|XP_009588409.1|  PREDICTED: lanC-like protein GCL2                  333   1e-104   Nicotiana tomentosiformis
ref|XP_009343572.1|  PREDICTED: lanC-like protein GCR2                  333   1e-104   Pyrus x bretschneideri [bai li]
ref|XP_009617548.1|  PREDICTED: lanC-like protein GCL2 isoform X1       332   2e-104   Nicotiana tomentosiformis
ref|XP_009400289.1|  PREDICTED: lanC-like protein GCL2                  332   4e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004291663.1|  PREDICTED: lanC-like protein GCR2                  331   7e-104   Fragaria vesca subsp. vesca
ref|XP_009617549.1|  PREDICTED: lanC-like protein GCL2 isoform X2       331   7e-104   Nicotiana tomentosiformis
ref|NP_850003.1|  protein GCR2-LIKE 2                                   331   8e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248157.1|  PREDICTED: lanC-like protein GCL2 isoform X1       331   1e-103   Solanum lycopersicum
ref|XP_010241996.1|  PREDICTED: lanC-like protein GCL2 isoform X1       329   1e-102   Nelumbo nucifera [Indian lotus]
ref|XP_006299729.1|  hypothetical protein CARUB_v10015922mg             326   5e-102   Capsella rubella
gb|AAD20918.1|  hypothetical protein                                    322   8e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53809.1|  BnaA06g01740D                                          322   8e-101   Brassica napus [oilseed rape]
emb|CDP14758.1|  unnamed protein product                                323   2e-100   Coffea canephora [robusta coffee]
emb|CDY26028.1|  BnaC06g05960D                                          318   5e-99    Brassica napus [oilseed rape]
ref|XP_007207243.1|  hypothetical protein PRUPE_ppa006265m1g            312   6e-99    
gb|KDO74127.1|  hypothetical protein CISIN_1g015433mg                   311   1e-97    Citrus sinensis [apfelsine]
gb|AGV54199.1|  lanC-like protein                                       313   5e-97    Phaseolus vulgaris [French bean]
ref|XP_010555129.1|  PREDICTED: lanC-like protein GCL2                  313   7e-97    Tarenaya hassleriana [spider flower]
ref|XP_010555131.1|  PREDICTED: lanC-like protein GCL2                  312   1e-96    Tarenaya hassleriana [spider flower]
ref|XP_009102106.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    311   2e-96    Brassica rapa
ref|XP_010686440.1|  PREDICTED: lanC-like protein GCL2                  311   3e-96    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB84322.1|  hypothetical protein B456_N018400                       305   2e-95    Gossypium raimondii
gb|KJB84323.1|  hypothetical protein B456_N018400                       305   8e-95    Gossypium raimondii
ref|XP_010918435.1|  PREDICTED: lanC-like protein GCL2 isoform X2       304   5e-94    
ref|XP_007207244.1|  hypothetical protein PRUPE_ppa006265m2g            273   2e-84    
ref|XP_007043561.1|  GCR2-like 2 isoform 3                              264   9e-80    
ref|XP_002982067.1|  hypothetical protein SELMODRAFT_115837             261   1e-79    
gb|ERM97345.1|  hypothetical protein AMTR_s00073p00158570               259   2e-78    Amborella trichopoda
gb|KDO74126.1|  hypothetical protein CISIN_1g015433mg                   259   2e-77    Citrus sinensis [apfelsine]
ref|XP_008781994.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    252   3e-75    
gb|KDO74128.1|  hypothetical protein CISIN_1g015433mg                   250   3e-75    Citrus sinensis [apfelsine]
ref|XP_010327070.1|  PREDICTED: lanC-like protein GCL2 isoform X2       251   5e-74    
ref|XP_007043560.1|  GCR2-like 2 isoform 2                              247   5e-73    
emb|CBG76444.1|  OO_Ba0013J05-OO_Ba0033A15.31                           262   4e-72    Oryza officinalis
gb|KEH24852.1|  G protein coupled receptor                              245   1e-71    Medicago truncatula
emb|CDY05791.1|  BnaC07g00120D                                          238   5e-70    
dbj|BAJ96048.1|  predicted protein                                      225   2e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002319360.2|  hypothetical protein POPTR_0013s13850g             224   2e-64    
gb|KCW89517.1|  hypothetical protein EUGRSUZ_A01805                     214   6e-62    Eucalyptus grandis [rose gum]
ref|XP_006634360.1|  PREDICTED: lanC-like protein 2-like                216   6e-60    Lepisosteus oculatus
ref|XP_003424467.1|  PREDICTED: lanC-like protein 2 isoform X2          213   3e-59    Nasonia vitripennis
ref|XP_001605213.2|  PREDICTED: lanC-like protein 1 isoform X1          214   7e-59    
ref|XP_418874.2|  PREDICTED: lanC-like protein 2                        214   9e-59    Gallus gallus [bantam]
ref|XP_010711417.1|  PREDICTED: lanC-like protein 2                     211   2e-58    Meleagris gallopavo [common turkey]
ref|XP_010137609.1|  PREDICTED: lanC-like protein 2                     210   2e-58    Buceros rhinoceros silvestris
ref|XP_009946789.1|  PREDICTED: lanC-like protein 2                     210   2e-58    Leptosomus discolor
gb|EOB04765.1|  LanC-like protein 2                                     211   3e-58    Anas platyrhynchos [duck]
gb|KGL96810.1|  LanC-like 2                                             210   3e-58    Charadrius vociferus
ref|XP_009966730.1|  PREDICTED: lanC-like protein 2                     210   3e-58    Tyto alba [Schleiereule]
ref|XP_009887721.1|  PREDICTED: lanC-like protein 2                     210   3e-58    Charadrius vociferus
ref|XP_010311253.1|  PREDICTED: lanC-like protein 2                     209   4e-58    Balearica regulorum gibbericeps
ref|XP_008489494.1|  PREDICTED: lanC-like protein 2                     210   4e-58    Calypte anna
ref|XP_008934094.1|  PREDICTED: lanC-like protein 2                     210   6e-58    Merops nubicus
ref|XP_005014987.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    211   6e-58    
ref|XP_009863709.1|  PREDICTED: lanC-like protein 2                     209   7e-58    Apaloderma vittatum
gb|KFU97310.1|  LanC-like 2                                             209   7e-58    Pterocles gutturalis
gb|KFP85016.1|  LanC-like 2                                             209   7e-58    Apaloderma vittatum
gb|KFO54122.1|  LanC-like 1                                             209   8e-58    Corvus brachyrhynchos
gb|KFV83634.1|  LanC-like 2                                             209   8e-58    Struthio camelus australis
ref|XP_009896607.1|  PREDICTED: lanC-like protein 2                     209   9e-58    Picoides pubescens
ref|XP_008919586.1|  PREDICTED: lanC-like protein 2                     209   9e-58    
ref|XP_009677694.1|  PREDICTED: lanC-like protein 2                     208   1e-57    Struthio camelus australis
ref|XP_009566764.1|  PREDICTED: lanC-like protein 2                     208   1e-57    Cuculus canorus
ref|XP_010085360.1|  PREDICTED: lanC-like protein 2                     208   1e-57    Pterocles gutturalis
ref|XP_009273304.1|  PREDICTED: lanC-like protein 2                     209   1e-57    Aptenodytes forsteri
ref|XP_010396952.1|  PREDICTED: lanC-like protein 2                     208   2e-57    
ref|XP_010162821.1|  PREDICTED: lanC-like protein 2                     208   2e-57    
gb|KFW01635.1|  LanC-like 2                                             208   2e-57    Fulmarus glacialis
ref|XP_004602091.1|  PREDICTED: lanC-like protein 2                     209   2e-57    Sorex araneus [Eurasian shrew]
ref|XP_010179314.1|  PREDICTED: lanC-like protein 2                     208   2e-57    Mesitornis unicolor
gb|KFZ55043.1|  LanC-like 2                                             208   2e-57    Antrostomus carolinensis
ref|XP_009463056.1|  PREDICTED: lanC-like protein 2                     207   2e-57    Nipponia nippon
ref|XP_005287377.1|  PREDICTED: lanC-like protein 2 isoform X4          207   2e-57    Chrysemys picta bellii
ref|XP_010406143.1|  PREDICTED: lanC-like protein 1                     209   2e-57    Corvus cornix cornix
ref|XP_005658651.1|  PREDICTED: lanC-like protein 2-like                209   2e-57    
gb|KGL77828.1|  LanC-like 2                                             208   2e-57    Tinamus guttatus
ref|XP_010213784.1|  PREDICTED: lanC-like protein 2                     207   2e-57    Tinamus guttatus
ref|XP_010148638.1|  PREDICTED: lanC-like protein 2                     207   3e-57    Eurypyga helias
ref|XP_009092160.1|  PREDICTED: lanC-like protein 2                     208   3e-57    
ref|XP_005041412.1|  PREDICTED: lanC-like protein 2                     209   3e-57    
ref|XP_009643058.1|  PREDICTED: lanC-like protein 2                     207   3e-57    Egretta garzetta
ref|XP_011954667.1|  PREDICTED: lanC-like protein 2 isoform X1          208   3e-57    
ref|XP_009572443.1|  PREDICTED: lanC-like protein 2                     207   3e-57    Fulmarus glacialis
ref|XP_006757252.1|  PREDICTED: lanC-like protein 2                     207   3e-57    Myotis davidii
ref|XP_008167878.1|  PREDICTED: lanC-like protein 2 isoform X3          208   4e-57    Chrysemys picta bellii
ref|XP_005695556.1|  PREDICTED: lanC-like protein 2                     209   4e-57    
ref|XP_005287375.1|  PREDICTED: lanC-like protein 2 isoform X2          208   4e-57    Chrysemys picta bellii
ref|XP_005170667.1|  PREDICTED: lanC-like protein 2 isoform X1          209   4e-57    
ref|NP_001039268.1|  LanC lantibiotic synthetase component C-like 2     208   4e-57    Xenopus tropicalis [western clawed frog]
ref|XP_006074845.1|  PREDICTED: lanC-like protein 2                     207   4e-57    
ref|NP_001014209.1|  lanC-like protein 2                                209   4e-57    Rattus norvegicus [brown rat]
ref|XP_009987546.1|  PREDICTED: lanC-like protein 2                     207   4e-57    Tauraco erythrolophus
ref|XP_009703975.1|  PREDICTED: lanC-like protein 2                     207   4e-57    Cariama cristata
gb|KFP67740.1|  LanC-like 2                                             207   5e-57    Cariama cristata
ref|NP_598498.1|  lanC-like protein 2                                   209   5e-57    Mus musculus [mouse]
ref|XP_009820748.1|  PREDICTED: lanC-like protein 2                     207   5e-57    Gavia stellata
ref|XP_009999832.1|  PREDICTED: lanC-like protein 2                     207   5e-57    Chaetura pelagica
ref|XP_008641803.1|  PREDICTED: lanC-like protein 1                     208   5e-57    
ref|XP_008111107.1|  PREDICTED: lanC-like protein 2                     209   5e-57    Anolis carolinensis [Carolina anole]
ref|XP_008632157.1|  PREDICTED: lanC-like protein 2                     209   5e-57    
gb|AAI35989.1|  LOC734145 protein                                       208   6e-57    Xenopus tropicalis [western clawed frog]
ref|XP_009319938.1|  PREDICTED: lanC-like protein 2                     207   7e-57    Pygoscelis adeliae
ref|XP_005975688.1|  PREDICTED: lanC-like protein 2                     207   7e-57    Pantholops hodgsonii [Tibetan antelope]
ref|XP_007059434.1|  PREDICTED: lanC-like protein 2                     207   7e-57    
ref|XP_004646693.1|  PREDICTED: lanC-like protein 2                     208   8e-57    Octodon degus
ref|XP_012022260.1|  PREDICTED: lanC-like protein 2 isoform X3          208   8e-57    Ovis aries musimon
ref|NP_001095726.1|  lanC-like protein 2                                208   9e-57    Bos taurus [bovine]
ref|XP_007423495.1|  PREDICTED: lanC-like protein 2                     209   9e-57    Python bivittatus
ref|XP_007633708.1|  PREDICTED: lanC-like protein 2 isoform X2          206   9e-57    
ref|XP_005506618.1|  PREDICTED: lanC-like protein 2                     208   9e-57    
ref|XP_006219526.1|  PREDICTED: lanC-like protein 2-like                207   1e-56    
ref|XP_010017204.1|  PREDICTED: lanC-like protein 2                     206   1e-56    
ref|NP_001133442.1|  LanC-like protein 2                                207   1e-56    
gb|ELK12680.1|  LanC-like protein 2                                     208   1e-56    
ref|XP_010114065.1|  PREDICTED: lanC-like protein 2                     206   1e-56    
ref|XP_005360945.1|  PREDICTED: lanC-like protein 2                     208   1e-56    
ref|XP_008825772.1|  PREDICTED: lanC-like protein 2                     207   1e-56    
gb|ERE66398.1|  lanC-like protein 2                                     206   1e-56    
ref|XP_005519153.1|  PREDICTED: lanC-like protein 2                     208   1e-56    
ref|XP_009941337.1|  PREDICTED: lanC-like protein 2                     206   1e-56    
ref|XP_005487037.1|  PREDICTED: lanC-like protein 2                     208   1e-56    
ref|XP_010884003.1|  PREDICTED: lanC-like protein 2                     207   1e-56    
ref|XP_005904454.1|  PREDICTED: lanC-like protein 2                     207   1e-56    
emb|CAG12678.1|  unnamed protein product                                207   2e-56    
ref|XP_005425762.1|  PREDICTED: lanC-like protein 2                     209   2e-56    
ref|XP_010967451.1|  PREDICTED: lanC-like protein 2                     206   2e-56    
ref|XP_008068662.1|  PREDICTED: lanC-like protein 2                     205   2e-56    
ref|XP_005287374.1|  PREDICTED: lanC-like protein 2 isoform X1          207   2e-56    
ref|XP_008148865.1|  PREDICTED: lanC-like protein 2                     206   2e-56    
ref|XP_006022221.1|  PREDICTED: lanC-like protein 2                     206   2e-56    
ref|NP_001076472.1|  lanC-like protein 2                                207   2e-56    
ref|XP_004839897.1|  PREDICTED: lanC-like protein 2 isoform X2          204   2e-56    
ref|XP_006236643.1|  PREDICTED: lanC-like protein 2 isoform X2          204   3e-56    
ref|XP_010201115.1|  PREDICTED: lanC-like protein 1                     204   3e-56    
ref|XP_011173043.1|  PREDICTED: lanC-like protein 1 isoform X1          206   3e-56    
ref|XP_011588107.1|  PREDICTED: lanC-like protein 2                     204   3e-56    
ref|XP_003504936.1|  PREDICTED: lanC-like protein 2 isoform X1          207   3e-56    
ref|XP_005445171.1|  PREDICTED: lanC-like protein 2                     207   3e-56    
ref|XP_006912141.1|  PREDICTED: lanC-like protein 2                     205   3e-56    
gb|KFP32110.1|  LanC-like 1                                             204   4e-56    
ref|XP_007463743.1|  PREDICTED: lanC-like protein 2                     204   4e-56    
ref|XP_010995335.1|  PREDICTED: lanC-like protein 2                     205   4e-56    
ref|XP_006124173.1|  PREDICTED: lanC-like protein 2                     205   4e-56    
ref|XP_009500817.1|  PREDICTED: lanC-like protein 2                     204   4e-56    
gb|KFP97922.1|  LanC-like 2                                             204   4e-56    
ref|XP_009928472.1|  PREDICTED: lanC-like protein 2                     204   6e-56    
ref|XP_007118424.1|  PREDICTED: lanC-like protein 2                     207   6e-56    
ref|XP_004582540.1|  PREDICTED: lanC-like protein 2                     206   6e-56    
ref|XP_008701796.1|  PREDICTED: lanC-like protein 2                     204   6e-56    
ref|XP_009484901.1|  PREDICTED: lanC-like protein 2                     203   7e-56    
ref|XP_011173045.1|  PREDICTED: lanC-like protein 1 isoform X3          204   7e-56    
ref|XP_006992062.1|  PREDICTED: lanC-like protein 2-like                206   8e-56    
ref|XP_001364295.2|  PREDICTED: lanC-like protein 1 isoform X1          204   8e-56    
ref|XP_011369800.1|  PREDICTED: lanC-like protein 2                     204   8e-56    
ref|XP_006236642.2|  PREDICTED: lanC-like protein 2 isoform X1          204   8e-56    
ref|XP_006192458.1|  PREDICTED: lanC-like protein 2-like                206   8e-56    
ref|XP_007233451.1|  PREDICTED: lanC-like protein 2                     205   9e-56    
ref|XP_011589243.1|  PREDICTED: lanC-like protein 1                     204   9e-56    
ref|XP_007500444.1|  PREDICTED: lanC-like protein 2                     205   1e-55    
ref|XP_006275683.1|  PREDICTED: lanC-like protein 2 isoform X2          204   1e-55    
ref|XP_009565204.1|  PREDICTED: lanC-like protein 1                     202   1e-55    
ref|XP_005235317.1|  PREDICTED: lanC-like protein 2                     206   1e-55    
ref|XP_005428015.1|  PREDICTED: lanC-like protein 1                     203   2e-55    
ref|XP_004839896.1|  PREDICTED: lanC-like protein 2 isoform X1          205   2e-55    
ref|XP_004877353.1|  PREDICTED: lanC-like protein 2                     204   2e-55    
ref|XP_010581555.1|  PREDICTED: lanC-like protein 1                     203   2e-55    
gb|KFD57694.1|  hypothetical protein M513_01364                         203   2e-55    
ref|XP_005486943.1|  PREDICTED: lanC-like protein 1                     203   2e-55    
ref|XP_009015183.1|  hypothetical protein HELRODRAFT_188186             204   2e-55    
ref|XP_005941324.1|  PREDICTED: lanC-like protein 2-like isoform X2     202   2e-55    
ref|XP_010281072.1|  PREDICTED: lanC-like protein 1                     201   2e-55    
gb|KFW84735.1|  LanC-like 1                                             203   2e-55    
ref|XP_007895817.1|  PREDICTED: lanC-like protein 2                     204   3e-55    
ref|XP_002197149.1|  PREDICTED: lanC-like protein 1                     203   3e-55    
gb|KFO80625.1|  LanC-like 1                                             202   3e-55    
ref|XP_005747530.1|  PREDICTED: lanC-like protein 2-like isoform X3     201   3e-55    
gb|EFB24809.1|  hypothetical protein PANDA_020566                       204   3e-55    
ref|XP_009885875.1|  PREDICTED: lanC-like protein 1 isoform X2          201   3e-55    
ref|XP_002930203.1|  PREDICTED: lanC-like protein 2 isoform X1          204   3e-55    
ref|XP_007501858.1|  PREDICTED: lanC-like protein 1 isoform X2          204   3e-55    
ref|XP_003470156.1|  PREDICTED: lanC-like protein 2                     204   3e-55    
ref|XP_011513750.1|  PREDICTED: lanC-like protein 2 isoform X1          201   4e-55    
ref|XP_011634566.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    202   4e-55    
ref|XP_005021837.1|  PREDICTED: lanC-like protein 1                     202   4e-55    
ref|XP_011954668.1|  PREDICTED: lanC-like protein 2 isoform X2          201   4e-55    
ref|XP_005549615.1|  PREDICTED: lanC-like protein 2 isoform X2          201   5e-55    
ref|XP_008143428.1|  PREDICTED: lanC-like protein 1                     202   5e-55    
ref|XP_008926719.1|  PREDICTED: lanC-like protein 1                     203   5e-55    
ref|XP_007187727.1|  PREDICTED: lanC-like protein 2                     201   5e-55    
ref|XP_004694568.1|  PREDICTED: lanC-like protein 2                     203   5e-55    
ref|XP_008260063.1|  PREDICTED: lanC-like protein 2 isoform X2          202   5e-55    
ref|XP_005147051.1|  PREDICTED: lanC-like protein 2                     205   6e-55    
gb|KFM08745.1|  LanC-like 1                                             201   6e-55    
ref|XP_006275682.1|  PREDICTED: lanC-like protein 2 isoform X1          203   6e-55    
ref|XP_005528946.1|  PREDICTED: lanC-like protein 1                     202   6e-55    
gb|KFO33010.1|  LanC-like protein 2                                     201   6e-55    
gb|EHH52121.1|  Testis-specific adriamycin sensitivity protein          201   7e-55    
ref|XP_009885874.1|  PREDICTED: lanC-like protein 1 isoform X1          202   7e-55    
gb|KGL95390.1|  LanC-like 1                                             202   7e-55    
gb|KFQ90951.1|  LanC-like 1                                             202   7e-55    
ref|XP_011758794.1|  PREDICTED: lanC-like protein 2 isoform X2          201   7e-55    
ref|XP_010309333.1|  PREDICTED: lanC-like protein 1                     200   8e-55    
ref|XP_005501752.1|  PREDICTED: lanC-like protein 1                     201   8e-55    
ref|XP_003455790.1|  PREDICTED: lanC-like protein 2 isoform X1          202   8e-55    
ref|XP_009460226.1|  PREDICTED: lanC-like protein 1                     201   9e-55    
ref|XP_004283055.1|  PREDICTED: lanC-like protein 2                     203   9e-55    
ref|XP_011879209.1|  PREDICTED: lanC-like protein 2                     201   9e-55    
gb|EHH17302.1|  Testis-specific adriamycin sensitivity protein          201   9e-55    
ref|XP_009634935.1|  PREDICTED: lanC-like protein 1                     200   1e-54    
ref|XP_008260062.1|  PREDICTED: lanC-like protein 2 isoform X1          203   1e-54    
ref|XP_006022339.1|  PREDICTED: lanC-like protein 1                     201   1e-54    
ref|XP_005941323.1|  PREDICTED: lanC-like protein 2-like isoform X1     202   1e-54    
ref|XP_005609226.1|  PREDICTED: lanC-like protein 2                     201   1e-54    
ref|XP_011782832.1|  PREDICTED: lanC-like protein 2                     202   1e-54    
ref|XP_009279358.1|  PREDICTED: lanC-like protein 1                     201   1e-54    
gb|KFO96908.1|  LanC-like 1                                             201   1e-54    
ref|XP_006729895.1|  PREDICTED: lanC-like protein 2                     202   1e-54    
ref|XP_008503139.1|  PREDICTED: lanC-like protein 1                     201   1e-54    
ref|XP_010330054.1|  PREDICTED: lanC-like protein 2 isoform X2          200   1e-54    
ref|XP_004573726.1|  PREDICTED: lanC-like protein 2-like                202   1e-54    
ref|XP_009327921.1|  PREDICTED: lanC-like protein 1                     199   1e-54    
ref|XP_009501831.1|  PREDICTED: lanC-like protein 1                     199   2e-54    
ref|XP_005144230.1|  PREDICTED: lanC-like protein 1                     201   2e-54    
dbj|BAG63209.1|  unnamed protein product                                201   2e-54    
emb|CAD28471.1|  hypothetical protein                                   202   2e-54    
gb|KFP09242.1|  LanC-like 1                                             200   2e-54    
ref|XP_010084089.1|  PREDICTED: lanC-like protein 1                     199   2e-54    
gb|KFW90395.1|  LanC-like 1                                             200   2e-54    
dbj|BAE00722.1|  unnamed protein product                                199   2e-54    
ref|XP_007979469.1|  PREDICTED: lanC-like protein 2 isoform X1          202   2e-54    
ref|XP_010623360.1|  PREDICTED: lanC-like protein 2                     201   2e-54    
ref|NP_001248105.1|  lanC-like protein 2                                202   2e-54    
ref|XP_004045515.1|  PREDICTED: lanC-like protein 2                     202   2e-54    
ref|XP_003318497.1|  PREDICTED: lanC-like protein 2                     202   2e-54    
gb|AAH70049.1|  LanC lantibiotic synthetase component C-like 2 (b...    202   2e-54    
ref|NP_061167.1|  lanC-like protein 2                                   202   2e-54    
ref|XP_003896011.1|  PREDICTED: lanC-like protein 2 isoform X1          201   2e-54    
gb|KFV02516.1|  LanC-like 1                                             199   2e-54    
gb|ELU13947.1|  hypothetical protein CAPTEDRAFT_174165                  200   2e-54    
gb|KFQ83337.1|  LanC-like 1                                             199   2e-54    
ref|NP_001026416.2|  lanC-like protein 1                                200   2e-54    
ref|XP_006148979.1|  PREDICTED: lanC-like protein 2                     201   3e-54    
ref|XP_003815868.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    201   3e-54    
ref|XP_003766010.1|  PREDICTED: lanC-like protein 1                     201   3e-54    
ref|XP_009491749.1|  PREDICTED: lanC-like protein 1                     199   3e-54    
dbj|BAG53147.1|  unnamed protein product                                201   3e-54    
ref|XP_002833100.1|  PREDICTED: lanC-like protein 2                     201   3e-54    
ref|XP_003744937.1|  PREDICTED: lanC-like protein 2-like                199   3e-54    
ref|XP_011661024.1|  PREDICTED: lanC-like protein 2                     198   3e-54    
gb|KFP88412.1|  LanC-like 2                                             198   3e-54    
gb|EHA98285.1|  LanC-like protein 2                                     204   3e-54    
ref|XP_006276713.1|  PREDICTED: lanC-like protein 1                     200   4e-54    
ref|XP_009942928.1|  PREDICTED: lanC-like protein 1                     198   4e-54    
ref|XP_009810346.1|  PREDICTED: lanC-like protein 1                     198   4e-54    
ref|XP_003215180.1|  PREDICTED: lanC-like protein 1                     199   5e-54    
ref|XP_003733613.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    201   6e-54    
ref|XP_007094861.1|  PREDICTED: lanC-like protein 2                     199   6e-54    
ref|XP_003943908.1|  PREDICTED: lanC-like protein 2 isoform X1          201   6e-54    
ref|XP_011053545.1|  PREDICTED: lanC-like protein 2                     199   8e-54    
ref|XP_008289518.1|  PREDICTED: lanC-like protein 2                     199   9e-54    
ref|XP_009995128.1|  PREDICTED: lanC-like protein 1                     197   1e-53    
gb|KFR03138.1|  LanC-like 1                                             199   1e-53    
ref|XP_010745166.1|  PREDICTED: lanC-like protein 2                     199   1e-53    
ref|XP_005279741.1|  PREDICTED: lanC-like protein 1                     198   1e-53    
gb|KFP61249.1|  LanC-like 1                                             197   1e-53    
ref|XP_009686963.1|  PREDICTED: lanC-like protein 1                     197   1e-53    
ref|XP_004417378.1|  PREDICTED: lanC-like protein 2                     200   1e-53    
ref|XP_006898659.1|  PREDICTED: lanC-like protein 2-like                200   1e-53    
ref|XP_009980699.1|  PREDICTED: lanC-like protein 1                     197   1e-53    
ref|XP_009086433.1|  PREDICTED: lanC-like protein 1                     198   1e-53    
ref|XP_005441569.1|  PREDICTED: lanC-like protein 1                     198   1e-53    
ref|XP_003982670.1|  PREDICTED: lanC-like protein 2                     200   1e-53    
ref|XP_005049050.1|  PREDICTED: lanC-like protein 1 isoform X1          198   1e-53    
emb|CBI38513.3|  unnamed protein product                                189   1e-53    
ref|XP_011173044.1|  PREDICTED: lanC-like protein 1 isoform X2          198   1e-53    
ref|XP_006082817.1|  PREDICTED: lanC-like protein 1                     198   2e-53    
ref|XP_007470076.1|  PREDICTED: lanC-like protein 1                     198   2e-53    
ref|XP_003406133.1|  PREDICTED: lanC-like protein 1 isoform X1          198   2e-53    
ref|XP_009065953.1|  hypothetical protein LOTGIDRAFT_179770             197   2e-53    
gb|KFZ53917.1|  LanC-like 1                                             196   2e-53    
gb|KFV64229.1|  LanC-like 1                                             197   2e-53    
ref|XP_005396650.1|  PREDICTED: lanC-like protein 2 isoform X2          197   2e-53    
ref|XP_009894709.1|  PREDICTED: lanC-like protein 1                     196   2e-53    
ref|XP_005874242.1|  PREDICTED: lanC-like protein 1                     198   2e-53    
ref|XP_006872805.1|  PREDICTED: lanC-like protein 1                     198   2e-53    
ref|XP_009080741.1|  PREDICTED: lanC-like protein 2                     196   2e-53    
gb|KFV14132.1|  LanC-like 1                                             197   2e-53    
ref|XP_005396649.1|  PREDICTED: lanC-like protein 2 isoform X1          197   2e-53    
gb|KFV88367.1|  LanC-like 1                                             197   2e-53    
ref|XP_009704758.1|  PREDICTED: lanC-like protein 1                     197   2e-53    
ref|XP_010012429.1|  PREDICTED: lanC-like protein 1                     196   2e-53    
gb|KFQ71604.1|  LanC-like 1                                             197   2e-53    
ref|XP_004384021.1|  PREDICTED: lanC-like protein 2                     199   2e-53    
ref|XP_003275065.1|  PREDICTED: lanC-like protein 2                     199   3e-53    
ref|XP_007939437.1|  PREDICTED: lanC-like protein 2                     199   3e-53    
ref|XP_007071974.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    198   3e-53    
ref|XP_003762577.1|  PREDICTED: lanC-like protein 2                     199   4e-53    
ref|XP_006205316.1|  PREDICTED: lanC-like protein 1                     197   4e-53    
gb|EFZ09548.1|  hypothetical protein SINV_11015                         197   4e-53    
ref|XP_004438431.1|  PREDICTED: lanC-like protein 2                     198   4e-53    
ref|XP_004447944.1|  PREDICTED: lanC-like protein 2 isoform 2           198   5e-53    
ref|XP_010711615.1|  PREDICTED: lanC-like protein 1                     197   5e-53    
ref|XP_007524577.1|  PREDICTED: lanC-like protein 1                     197   5e-53    
ref|XP_005337466.1|  PREDICTED: lanC-like protein 2                     198   5e-53    
ref|XP_005631064.1|  PREDICTED: lanC-like protein 2                     201   5e-53    
ref|XP_012057840.1|  PREDICTED: lanC-like protein 2                     197   5e-53    
ref|XP_004004942.1|  PREDICTED: lanC-like protein 1                     196   6e-53    
ref|XP_005244494.1|  PREDICTED: lanC-like protein 1                     198   7e-53    
gb|KFV53555.1|  LanC-like 1                                             196   7e-53    
gb|KFW71076.1|  LanC-like 1                                             196   7e-53    
ref|XP_005676543.1|  PREDICTED: lanC-like protein 1 isoform X1          197   7e-53    
gb|KFQ04380.1|  LanC-like 1                                             194   7e-53    
ref|XP_004739432.1|  PREDICTED: lanC-like protein 2 isoform X2          197   7e-53    
ref|XP_008576884.1|  PREDICTED: lanC-like protein 2                     197   7e-53    
ref|XP_006779000.1|  PREDICTED: lanC-like protein 1                     196   8e-53    
gb|KFP49501.1|  LanC-like 1                                             194   8e-53    
ref|XP_006190570.1|  PREDICTED: lanC-like protein 1                     196   9e-53    
ref|XP_008506329.1|  PREDICTED: lanC-like protein 2                     195   9e-53    
ref|XP_006050069.1|  PREDICTED: lanC-like protein 1 isoform X1          196   1e-52    
ref|XP_009075666.1|  PREDICTED: lanC-like protein 1                     196   1e-52    
ref|XP_005889054.1|  PREDICTED: lanC-like protein 1                     196   1e-52    
gb|KFO15126.1|  LanC-like 1                                             195   1e-52    
gb|ELR61273.1|  LanC-like protein 1                                     196   1e-52    
ref|XP_003791072.1|  PREDICTED: lanC-like protein 2                     198   1e-52    
ref|XP_007567618.1|  PREDICTED: lanC-like protein 1                     196   2e-52    
ref|XP_009575790.1|  PREDICTED: lanC-like protein 1                     194   2e-52    
gb|KGL84870.1|  LanC-like 1                                             195   2e-52    
gb|KFW04656.1|  LanC-like 1                                             194   2e-52    
ref|XP_010890392.1|  PREDICTED: lanC-like protein 1                     195   3e-52    
ref|XP_007086146.1|  PREDICTED: lanC-like protein 1                     194   3e-52    



>emb|CDP01505.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/427 (75%), Positives = 363/427 (85%), Gaps = 3/427 (1%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             MSSSIV  AS E+N T+ ++          D TAP+  LPAET LQAA+SLKD+VV +TW
Sbjct  1     MSSSIVKYASQETNSTHEDNKERIDLPHGSDLTAPNLSLPAETLLQAAISLKDKVVQVTW  60

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  417
             + +      + DPTVYTGLLGTA+TCLR+++ATG+ QDL LC +IVDTCAS A ++ RH+
Sbjct  61    RGQWND-YGNTDPTVYTGLLGTAFTCLRAYEATGSLQDLSLCTEIVDTCASIARSSTRHL  119

Query  418   TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  597
             TFLCGRGG+YALGAVAANYCGDQQKRD Y+D FFEVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  120   TFLCGRGGVYALGAVAANYCGDQQKRDLYMDRFFEVAQERALPVGPEEGGFGMSYDLLYG  179

Query  598   RAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGA  777
             RAGFLW ALFI +HLG+EAVP++ LMPVVEA+L GGRAG+SDN+ CPLMYRWHGTRYWGA
Sbjct  180   RAGFLWTALFINKHLGAEAVPSDLLMPVVEAVLAGGRAGASDNTACPLMYRWHGTRYWGA  239

Query  778   AHGLAGILNVLLHF-PLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHG  954
             AHGLAGIL+VLLHF  LS D +EDVKGTLRYMM+NRFP SGNYPVSEGNPRDKLVQWCHG
Sbjct  240   AHGLAGILHVLLHFQALSADDIEDVKGTLRYMMSNRFPRSGNYPVSEGNPRDKLVQWCHG  299

Query  955   ATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRL  1134
             ATGIGITLCKAS+V P DREFR+AAIEAGEVVWKSGLVKKVGLADG AGNAYA LSLYRL
Sbjct  300   ATGIGITLCKASEVLPTDREFRNAAIEAGEVVWKSGLVKKVGLADGAAGNAYAFLSLYRL  359

Query  1135  TGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNS  1314
             TGESIY++RA+AF + LYH+  +    S   G ADHAYSLFQGLAGVACLWFDL+AP  S
Sbjct  360   TGESIYEDRAKAFANCLYHDQRNATTSSPSTG-ADHAYSLFQGLAGVACLWFDLLAPEKS  418

Query  1315  RFPGYEI  1335
             +FPGYEI
Sbjct  419   KFPGYEI  425



>ref|XP_009605819.1| PREDICTED: lanC-like protein GCL1 [Nicotiana tomentosiformis]
Length=430

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/433 (74%), Positives = 361/433 (83%), Gaps = 10/433 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGT----NHEDGN---DSGFRTVLDPTAPSFILPAETFLQAAVSLKD  216
             MSSS+V  AS E+N       HEDGN   DS       PTA +  LP+ETFLQAA+SLKD
Sbjct  1     MSSSVVQFASQENNSNSSNHQHEDGNERLDSDHHN--HPTAHNISLPSETFLQAAISLKD  58

Query  217   QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             QVVDMTWK  G SA    DPTVYTGLLGTA+TCLRS++ATG+R+DL LC++IVD CA  A
Sbjct  59    QVVDMTWKGNGRSAGGVTDPTVYTGLLGTAFTCLRSYEATGDRKDLELCSEIVDACAELA  118

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
                 RH+TFLCGRGG+YALGAVAANYCGDQ KR  YL++FFEVAQE+ALPVGPE+GGFGM
Sbjct  119   RTVTRHVTFLCGRGGVYALGAVAANYCGDQHKRVLYLNHFFEVAQERALPVGPEDGGFGM  178

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
             SYDLLYGRAGFLWAALFI+++LG+E VP+E LMPVVEAIL GGRAG++DN  CPLMYRWH
Sbjct  179   SYDLLYGRAGFLWAALFIRKYLGAETVPDEYLMPVVEAILAGGRAGATDNPACPLMYRWH  238

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             GTRYWGAAHGLAGIL+VLLHFPLS++ +EDVK TLRYMM+NRFPHSGNYPVSEGNPRDKL
Sbjct  239   GTRYWGAAHGLAGILHVLLHFPLSQEDIEDVKETLRYMMSNRFPHSGNYPVSEGNPRDKL  298

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             VQW HGATGI IT+CKAS+V  NDREFRDAAIE GEVVWK+GLVKKVGLADG +G AYA 
Sbjct  299   VQWSHGATGITITMCKASEVLSNDREFRDAAIEGGEVVWKNGLVKKVGLADGASGIAYAF  358

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSL+RLTGESIY+ERARAF S LYHNA  IM   +    ADH+YSLFQGL GVAC  FDL
Sbjct  359   LSLFRLTGESIYEERARAFASCLYHNARTIM-NERHHNEADHSYSLFQGLGGVACFLFDL  417

Query  1297  IAPHNSRFPGYEI  1335
             + P NSRFPGYE+
Sbjct  418   LTPENSRFPGYEL  430



>ref|XP_009800854.1| PREDICTED: lanC-like protein GCL1 [Nicotiana sylvestris]
Length=432

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/433 (73%), Positives = 359/433 (83%), Gaps = 8/433 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTN---HEDGNDSGFRTVLD----PTAPSFILPAETFLQAAVSLKD  216
             MSSS+V  AS E++  +   H+   D   R   D    PTA +  LP+ETFLQAA+SLKD
Sbjct  1     MSSSVVQFASQENSSNSSSNHQHDQDGNERLDSDHHNHPTAHNVSLPSETFLQAAISLKD  60

Query  217   QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             QVV+MTWK  G SA    DPTVYTGLLGTA+TCLRS++ATG+ +DL LC++IVD CA  A
Sbjct  61    QVVEMTWKGNGRSAGGVTDPTVYTGLLGTAFTCLRSYEATGDPKDLELCSEIVDACAELA  120

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
                 RH+TFLCGRGG+YALGAVAANYCGD  KRD YL++F EVAQE+ALPVGPE+GGFGM
Sbjct  121   RTVTRHVTFLCGRGGVYALGAVAANYCGDLYKRDLYLNHFLEVAQERALPVGPEDGGFGM  180

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
             SYDLLYGRAGFLWAALFI+++LG E VP+E LMPVVEAILEGGRAG++DN  CPLMYRWH
Sbjct  181   SYDLLYGRAGFLWAALFIRKYLGEETVPDEYLMPVVEAILEGGRAGATDNPACPLMYRWH  240

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             GTRYWGAAHGLAGIL+VLLHFP+S++ +EDVK TLRYMM+NRFPHSGNYPVSEGNPRDKL
Sbjct  241   GTRYWGAAHGLAGILHVLLHFPVSQEDIEDVKETLRYMMSNRFPHSGNYPVSEGNPRDKL  300

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             VQW HGATGI IT+CKAS+V  NDREFRDAAIE GEVVWK+GLVKKVGLADG +GNAYA 
Sbjct  301   VQWSHGATGITITMCKASEVLSNDREFRDAAIEGGEVVWKNGLVKKVGLADGASGNAYAF  360

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSL+RLTGESIY+ERAR+F S LYHNA  IM   +    ADH+YSLFQGL GVAC  FDL
Sbjct  361   LSLFRLTGESIYEERARSFASCLYHNARTIM-NERHHNEADHSYSLFQGLGGVACFLFDL  419

Query  1297  IAPHNSRFPGYEI  1335
             + P NSRFPGYE+
Sbjct  420   LTPENSRFPGYEL  432



>ref|XP_004250112.1| PREDICTED: lanC-like protein GCL1 [Solanum lycopersicum]
Length=424

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/427 (72%), Positives = 359/427 (84%), Gaps = 4/427 (1%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDS-GFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMT  234
             MSSS+V   + + N  N +DGN+       L P   S    +ETFLQAA+SLKDQVV+MT
Sbjct  1     MSSSVVQFTASQQN--NSDDGNERLDSDQHLHPAVHSVPHTSETFLQAAISLKDQVVEMT  58

Query  235   WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  414
             WK  G SA +  DPT+YTGLLGTA+TCLRS+++TG+R+DL LC++IVD+CA  A    RH
Sbjct  59    WKENGRSASSVTDPTMYTGLLGTAFTCLRSYESTGDRKDLELCSEIVDSCADLARTFTRH  118

Query  415   ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  594
             +TFLCGRGG+YALGAVAA+YCGDQ KRD YL++F EVAQE+ALPVGPE+GGFGMSYDLLY
Sbjct  119   VTFLCGRGGVYALGAVAASYCGDQHKRDLYLNHFLEVAQERALPVGPEDGGFGMSYDLLY  178

Query  595   GRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWG  774
             GRAGFLWAALFI+++LG E+VP+++LMPVVEAIL GGRAG+SDNS CPLMYRWHGTRYWG
Sbjct  179   GRAGFLWAALFIRKYLGVESVPDDSLMPVVEAILAGGRAGASDNSACPLMYRWHGTRYWG  238

Query  775   AAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHG  954
             AAHGLAGIL+VLLHFPLS++ +EDVK TLRYMM+NRFPHSGNYPVSEGNPRDKLVQW HG
Sbjct  239   AAHGLAGILHVLLHFPLSQEDIEDVKETLRYMMSNRFPHSGNYPVSEGNPRDKLVQWSHG  298

Query  955   ATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRL  1134
             ATGI IT+CK S+V  +DREFRDAAIE GEVVWKSGLV+KVGLADG +GNAYA LSLYRL
Sbjct  299   ATGITITMCKVSKVLSDDREFRDAAIEGGEVVWKSGLVEKVGLADGASGNAYAFLSLYRL  358

Query  1135  TGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNS  1314
             TGESIY+ERA+AF S LY NA  IM   +    ADH+YSLFQGL GVAC  FDL+AP NS
Sbjct  359   TGESIYEERAKAFASCLYQNARTIM-NEREHNEADHSYSLFQGLGGVACFLFDLLAPKNS  417

Query  1315  RFPGYEI  1335
             RFPG+E+
Sbjct  418   RFPGFEL  424



>ref|XP_006353211.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=424

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/430 (72%), Positives = 359/430 (83%), Gaps = 10/430 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLD----PTAPSFILPAETFLQAAVSLKDQVV  225
             MSSS+V L + + N  N +DGN+   R   D    PTA +    +ETFLQAA+SLKDQVV
Sbjct  1     MSSSVVQLTASQKN--NSDDGNE---RVDSDQHHHPTAHNVSHTSETFLQAAISLKDQVV  55

Query  226   DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  405
             +MTWK  G SA +  DPT+YTGLLGTA+TCLRS++ATG+R+DL LC++IVD CA  A   
Sbjct  56    EMTWKENGRSAGSVTDPTMYTGLLGTAFTCLRSYEATGDRKDLELCSEIVDACADLARTV  115

Query  406   IRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYD  585
              RH+TFLCGRGG+YALGAVAANYCGDQ KRD YL++F EVAQE+ALPVGPE+GGFGMSYD
Sbjct  116   TRHVTFLCGRGGVYALGAVAANYCGDQHKRDLYLNHFLEVAQERALPVGPEDGGFGMSYD  175

Query  586   LLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTR  765
             LLYGRAGFLWAALFI+++LG E+VP++ LMPVVEAIL GGRAG+SDN  CPLMYRWHGTR
Sbjct  176   LLYGRAGFLWAALFIRKYLGVESVPDDYLMPVVEAILAGGRAGASDNPACPLMYRWHGTR  235

Query  766   YWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQW  945
             YWGAAHGLAGIL+VLLHFPLS++ +EDVK TLRYMM+NRFPHSGNYPVSEGNPRDKLVQW
Sbjct  236   YWGAAHGLAGILHVLLHFPLSQEDIEDVKETLRYMMSNRFPHSGNYPVSEGNPRDKLVQW  295

Query  946   CHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSL  1125
              HGATGI IT+CK S+V  +DREFR AAIE GEVVWKSGLV++VGLADG +GNAYA LSL
Sbjct  296   SHGATGITITMCKVSEVLSDDREFRGAAIEGGEVVWKSGLVERVGLADGASGNAYAFLSL  355

Query  1126  YRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAP  1305
             YRLTGESIY+ERA+AF S LY NA  IM   +    ADH+YSLFQGL GVAC  FDL+AP
Sbjct  356   YRLTGESIYEERAKAFASCLYQNARTIM-NERHHNEADHSYSLFQGLGGVACFLFDLLAP  414

Query  1306  HNSRFPGYEI  1335
              NSRFPGYE+
Sbjct  415   KNSRFPGYEL  424



>gb|AAF75794.1|AF272710_1 putative 7-transmembrane G-protein-coupled receptor [Solanum 
chacoense]
Length=424

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/430 (72%), Positives = 358/430 (83%), Gaps = 10/430 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLD----PTAPSFILPAETFLQAAVSLKDQVV  225
             M SS+V L + + N  N +DGN+   R   D    PTA S    +ETFLQAA+SLKDQVV
Sbjct  1     MYSSVVQLTASQKN--NSDDGNE---RVDTDQHHQPTAHSVSHTSETFLQAAISLKDQVV  55

Query  226   DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  405
             +MTWK  G SA +  DPT+YTGLLGTA+TCLRS++ATG+R+DL LC++IVD CA  A   
Sbjct  56    EMTWKENGRSAGSVTDPTMYTGLLGTAFTCLRSYEATGDRKDLELCSEIVDACADLARTV  115

Query  406   IRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYD  585
              RH+TFLCGRGG+YALGAVAANYCGDQ KRD YL++F EVAQE+ALPVGPE+GGFGMSYD
Sbjct  116   TRHVTFLCGRGGVYALGAVAANYCGDQHKRDLYLNHFLEVAQERALPVGPEDGGFGMSYD  175

Query  586   LLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTR  765
             LLYGRAGFLWAALFI+++LG E+VP++ LMPVVEAIL GGRAG+SDN  CPLMYRWHGTR
Sbjct  176   LLYGRAGFLWAALFIRKYLGVESVPDDYLMPVVEAILAGGRAGASDNPACPLMYRWHGTR  235

Query  766   YWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQW  945
             YWGAAHGLAGIL+VLLHFPLS++ +EDVK TLRYMM+NRFPHSGNYPVSEGNPRDKLVQW
Sbjct  236   YWGAAHGLAGILHVLLHFPLSQEDIEDVKETLRYMMSNRFPHSGNYPVSEGNPRDKLVQW  295

Query  946   CHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSL  1125
              HGATGI IT+CK S+V  +DREFR AAIE GEVVWKSGLV++VGLADG +GNAYA LSL
Sbjct  296   SHGATGITITMCKVSEVLSDDREFRGAAIEGGEVVWKSGLVERVGLADGASGNAYAFLSL  355

Query  1126  YRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAP  1305
             YRLTGESIY+ERA+AF S LY NA  IM   +    ADH+YSLFQGL GVAC  FDL+AP
Sbjct  356   YRLTGESIYEERAKAFASCLYQNARTIM-NERHHNEADHSYSLFQGLGGVACFLFDLLAP  414

Query  1306  HNSRFPGYEI  1335
              NSRFPGYE+
Sbjct  415   KNSRFPGYEL  424



>ref|XP_007047870.1| GCR2-like 1 [Theobroma cacao]
 gb|EOX92027.1| GCR2-like 1 [Theobroma cacao]
Length=424

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/427 (71%), Positives = 359/427 (84%), Gaps = 7/427 (2%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGNDSGFRTV-LDPT-APSFILPAETFLQAAVSLKDQVVDMTW  237
             SS+V LA+ + +   HE+GN+     + +DPT A +  L A+T L+AA++LKDQVV++TW
Sbjct  2     SSVVELAASKES---HEEGNNERLGMLNMDPTVANNLSLSADTLLKAAIALKDQVVEVTW  58

Query  238   KARGGS-AVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  414
             K  GGS A + MDPTV TGLLGTA+TCLRS++ TGN+QDL L A IVDTCAS A A+ RH
Sbjct  59    KEGGGSCAGSGMDPTVNTGLLGTAFTCLRSYEVTGNQQDLLLSAKIVDTCASVARASTRH  118

Query  415   ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  594
             +TFLCGRGG+Y+LGAV ANY GD Q+ + +L+ F EVAQE+ALPVGPEEGGFGMSYDLLY
Sbjct  119   VTFLCGRGGVYSLGAVVANYMGDPQRLNFFLNQFLEVAQERALPVGPEEGGFGMSYDLLY  178

Query  595   GRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWG  774
             GRAGFLWAALF+ +HLG E VP++ LMP+++AIL GGR G+SD+  CPLMYRWHGTRYWG
Sbjct  179   GRAGFLWAALFLNKHLGKETVPSDVLMPIIDAILAGGRTGASDHPACPLMYRWHGTRYWG  238

Query  775   AAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHG  954
             AA+GLAGIL+VLLHFPLSE+  EDVKGTLRYMM+NRFPHSGNYP SEGNPRDKLVQW HG
Sbjct  239   AANGLAGILHVLLHFPLSENDAEDVKGTLRYMMSNRFPHSGNYPSSEGNPRDKLVQWSHG  298

Query  955   ATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRL  1134
             AT + ITL KASQV+P++REFRDAAIEAGEVVWK+GLVKKVGLADG AGNAYA LSLYRL
Sbjct  299   ATSMAITLAKASQVYPSEREFRDAAIEAGEVVWKNGLVKKVGLADGVAGNAYAFLSLYRL  358

Query  1135  TGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNS  1314
             TGE+IY+ERA+AF SFLYHNA  ++      G ADHAYSLFQGLAG ACLWFDL+ P NS
Sbjct  359   TGETIYEERAKAFASFLYHNARKLVNVGHACG-ADHAYSLFQGLAGTACLWFDLLEPQNS  417

Query  1315  RFPGYEI  1335
             +FPG+E+
Sbjct  418   KFPGFEL  424



>ref|XP_002262692.1| PREDICTED: lanC-like protein GCL1 isoform X2 [Vitis vinifera]
Length=421

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/426 (71%), Positives = 348/426 (82%), Gaps = 8/426 (2%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2     SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  417
             K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +    RH+
Sbjct  57    KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHV  116

Query  418   TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  597
             TFLCG GG+YALGAV AN+ GD Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  117   TFLCGSGGVYALGAVVANHIGDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYG  176

Query  598   RAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGA  777
             RAGFLWAALFI +HLG + +PN+ +MPVV A+L GGRAG+SDN+ CPLMYRWHGTRYWGA
Sbjct  177   RAGFLWAALFINKHLGEQTLPNDLIMPVVNAVLAGGRAGASDNTTCPLMYRWHGTRYWGA  236

Query  778   AHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGA  957
             AHGLAGIL VLLHFPLSE+  EDVKGTLRYM +NRFPHSGNYP  EGNPRDKLVQW HGA
Sbjct  237   AHGLAGILQVLLHFPLSEEDSEDVKGTLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGA  296

Query  958   TGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLT  1137
             TG+ ITLCKASQVF  DREFRDAAIEAGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLT
Sbjct  297   TGVAITLCKASQVFSRDREFRDAAIEAGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLT  356

Query  1138  GESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSR  1317
             GE +Y+ERA+AF SFLYHNAG ++      G  +HAYSLFQGLAG ACL FDL++P NSR
Sbjct  357   GEPVYEERAKAFASFLYHNAGKLVTVGHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSR  415

Query  1318  FPGYEI  1335
             FPGYE+
Sbjct  416   FPGYEL  421



>ref|XP_002306296.2| hypothetical protein POPTR_0005s07360g [Populus trichocarpa]
 gb|EEE93292.2| hypothetical protein POPTR_0005s07360g [Populus trichocarpa]
Length=421

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/397 (74%), Positives = 344/397 (87%), Gaps = 2/397 (1%)
 Frame = +1

Query  145   LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRS  324
             +DPT+   +LP ET L+AA+SLK+QVV++TW+ R G   T +DPTVYTGLLGTA+TCLRS
Sbjct  27    IDPTSTDMLLPHETLLRAAISLKNQVVEVTWE-RDGKTGTGIDPTVYTGLLGTAFTCLRS  85

Query  325   FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  504
             ++ TGN QDL LC++IVDTC+ +A  + RHITFLCGRGGLYALGAVAA+Y GD+++RD +
Sbjct  86    YEVTGNEQDLLLCSEIVDTCSVSARTSSRHITFLCGRGGLYALGAVAASYKGDRRRRDFF  145

Query  505   LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVV  684
             ++ F EVAQE+ALPVGPEEGGFGMSY+L+YGRAGFLWAALFI +HLG   +P + LMPVV
Sbjct  146   VNLFLEVAQERALPVGPEEGGFGMSYELMYGRAGFLWAALFINKHLGEGTLPCDLLMPVV  205

Query  685   EAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLR  864
             +A+L GGRAG+SDN+ CPLMYRWHGTRYWGA +GLAGIL VLLHFPLS + VEDVK TLR
Sbjct  206   DAVLAGGRAGASDNAACPLMYRWHGTRYWGAPNGLAGILQVLLHFPLSIEDVEDVKATLR  265

Query  865   YMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGE  1044
             YMM+NRFPHSGNYP SEGNPRDKLVQW HGATG+ ITLCKAS++FPNDREFR+AAIEAGE
Sbjct  266   YMMSNRFPHSGNYPSSEGNPRDKLVQWSHGATGMAITLCKASEMFPNDREFRNAAIEAGE  325

Query  1045  VVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQG  1224
             VVWKSGLVKKVGLADG AGNAYA LSLYRLTGESIY+ERA AF SFLYHNA +++     
Sbjct  326   VVWKSGLVKKVGLADGAAGNAYAFLSLYRLTGESIYEERANAFASFLYHNASELVTIGDA  385

Query  1225  DGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              G A+HAYSLFQGLAG ACLWFDL+ P +SRFPGYE+
Sbjct  386   RG-ANHAYSLFQGLAGTACLWFDLLKPESSRFPGYEL  421



>ref|XP_002268951.3| PREDICTED: lanC-like protein GCL1 [Vitis vinifera]
Length=421

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/426 (71%), Positives = 348/426 (82%), Gaps = 8/426 (2%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2     SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  417
             K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +    RH+
Sbjct  57    KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAMTSREFTRHV  116

Query  418   TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  597
             TFLCG GG+YALGAV AN+ GD Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  117   TFLCGSGGVYALGAVVANHIGDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYG  176

Query  598   RAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGA  777
             RAGFLWAALFI +HLG + +PN+ +MPVV A+L GGRAG+SDN+ CPLMYRWHGTRYWGA
Sbjct  177   RAGFLWAALFINKHLGEQTLPNDLVMPVVNAVLAGGRAGASDNTTCPLMYRWHGTRYWGA  236

Query  778   AHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGA  957
             AHGLAGIL VLLHFPLSE+  EDVKGTLRYM +NRFPHSGNYP  EGNPRDKLVQW HGA
Sbjct  237   AHGLAGILQVLLHFPLSEEDSEDVKGTLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGA  296

Query  958   TGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLT  1137
             TG+ ITLCKASQVF  DREFRDAAIEAGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLT
Sbjct  297   TGVAITLCKASQVFSRDREFRDAAIEAGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLT  356

Query  1138  GESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSR  1317
             GE +Y+ERA+AF SFLYHNAG ++      G  +HAYSLFQGLAG ACL FDL++P NSR
Sbjct  357   GEPVYEERAKAFASFLYHNAGKLVTVGHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSR  415

Query  1318  FPGYEI  1335
             FPGYE+
Sbjct  416   FPGYEL  421



>ref|XP_011031065.1| PREDICTED: lanC-like protein GCL1 [Populus euphratica]
Length=421

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/396 (74%), Positives = 342/396 (86%), Gaps = 2/396 (1%)
 Frame = +1

Query  148   DPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSF  327
             DPT+   +LP ET L+AA+SLK+QVV+MTW+ R G   T +DPTVYTGLLGTA+TCLRS+
Sbjct  28    DPTSTDMLLPHETLLRAAISLKNQVVEMTWE-RDGKTGTGIDPTVYTGLLGTAFTCLRSY  86

Query  328   QATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYL  507
             + TGN QDL LC++IVDTC+ +A  + RHITFLCGRGGLYALGAVAA+Y GD+++RD ++
Sbjct  87    EVTGNEQDLLLCSEIVDTCSVSARTSSRHITFLCGRGGLYALGAVAASYKGDRRRRDFFV  146

Query  508   DYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVE  687
             + F EVAQE+ALPVGPEEGGFGMSY+L+YGRAGFLWAALFI +HLG   +P + L PVV+
Sbjct  147   NLFLEVAQERALPVGPEEGGFGMSYELMYGRAGFLWAALFINKHLGEGTLPCDLLRPVVD  206

Query  688   AILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRY  867
             A+L GGRAG+SDN+ CPLMYRWHGTRYWGAA+GLAGIL VLLHFPLS + VEDVK TLRY
Sbjct  207   AVLAGGRAGASDNAACPLMYRWHGTRYWGAANGLAGILQVLLHFPLSIEDVEDVKATLRY  266

Query  868   MMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEV  1047
             MM+NRFPHSGNYP SEGNPRDKLVQW HGAT + ITLCKAS++FPNDREFR+AAIEAGEV
Sbjct  267   MMSNRFPHSGNYPSSEGNPRDKLVQWSHGATSMAITLCKASEMFPNDREFRNAAIEAGEV  326

Query  1048  VWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGD  1227
             VWKSGLVKKVGLADG AGNAYA LSLYRLTGESIY+ERA AF SFLYHNA +++      
Sbjct  327   VWKSGLVKKVGLADGAAGNAYAFLSLYRLTGESIYEERANAFASFLYHNASELVTIGDAR  386

Query  1228  GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             G A+HAYSLFQGLAG ACLWFDL+ P +SRFPGYE+
Sbjct  387   G-ANHAYSLFQGLAGTACLWFDLLKPESSRFPGYEL  421



>gb|EYU30985.1| hypothetical protein MIMGU_mgv1a006900mg [Erythranthe guttata]
Length=427

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/431 (71%), Positives = 354/431 (82%), Gaps = 9/431 (2%)
 Frame = +1

Query  58    MSSSI-VHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVD  228
             MSSS+ V  AS ESN   HED +      RT  DPTA +  LPA+ FL+AA+SLKDQVV+
Sbjct  1     MSSSLGVEYASEESN--RHEDVDQWLQLLRTSCDPTATNLSLPADAFLRAAISLKDQVVE  58

Query  229   MTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  408
             MTW+ RGG     +DPTVYTGL+GTA+TCLRS++ATG+ +DLRLCA+IVD CA+A   + 
Sbjct  59    MTWRRRGGKG--SLDPTVYTGLMGTAFTCLRSYEATGDHRDLRLCAEIVDACAAATHISN  116

Query  409   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  588
             RH+TFLCGRGG+YALGA+ ANYCGDQ KRD YLD F E+A+EKALPVGPEEGGFGMSYDL
Sbjct  117   RHVTFLCGRGGVYALGAITANYCGDQTKRDFYLDRFLEMAREKALPVGPEEGGFGMSYDL  176

Query  589   LYGRAGFLWAALFIKQHLG-SEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTR  765
             LYGRAGFLWAA F+ +H G  E +PN+ + PVV+A+L GGRAG+S N+ CPLMYRWHGT 
Sbjct  177   LYGRAGFLWAASFLNKHFGGQEIIPNDVITPVVDAVLAGGRAGASVNTACPLMYRWHGTP  236

Query  766   YWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQW  945
             YWGAAHGLAGIL+VLLHFPL  D VEDVK TLRYMM+ R P SGNYPVSEG+ RD+LVQW
Sbjct  237   YWGAAHGLAGILHVLLHFPLRGDHVEDVKATLRYMMSKRDPQSGNYPVSEGHTRDELVQW  296

Query  946   CHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSL  1125
              HGA G+ ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYA LSL
Sbjct  297   SHGAGGLAITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYALLSL  356

Query  1126  YRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAA-DHAYSLFQGLAGVACLWFDLIA  1302
              RLTGE +Y+ERA +F S+LYH+A  IMAG +  GA+ D  YSLFQG AG ACL+FDL+ 
Sbjct  357   LRLTGERVYEERAESFASYLYHSARKIMAGGEYSGASEDLDYSLFQGFAGSACLFFDLLK  416

Query  1303  PHNSRFPGYEI  1335
             P NSRFPGYEI
Sbjct  417   PENSRFPGYEI  427



>emb|CAN83415.1| hypothetical protein VITISV_029722 [Vitis vinifera]
Length=421

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/426 (71%), Positives = 347/426 (81%), Gaps = 8/426 (2%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2     SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  417
             K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +    RH+
Sbjct  57    KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHV  116

Query  418   TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  597
             TFLCG GG+YALGAV AN+  D Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  117   TFLCGSGGVYALGAVVANHIXDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYG  176

Query  598   RAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGA  777
             RAGFLWAALFI +HLG + +PN+ +MPVV A+L GGRAG+SDN+ CPLMYRWHGTRYWGA
Sbjct  177   RAGFLWAALFINKHLGEQTLPNDLIMPVVNAVLAGGRAGASDNTTCPLMYRWHGTRYWGA  236

Query  778   AHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGA  957
             AHGLAGIL VLLHFPLSE+  EDVKGTLRYM +NRFPHSGNYP  EGNPRDKLVQW HGA
Sbjct  237   AHGLAGILQVLLHFPLSEEDSEDVKGTLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGA  296

Query  958   TGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLT  1137
             TG+ ITLCKASQVF  DREFRDAAIEAGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLT
Sbjct  297   TGVAITLCKASQVFSRDREFRDAAIEAGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLT  356

Query  1138  GESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSR  1317
             GE +Y+ERA+AF SFLYHNAG ++      G  +HAYSLFQGLAG ACL FDL++P NSR
Sbjct  357   GEPVYEERAKAFASFLYHNAGKLVTVGHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSR  415

Query  1318  FPGYEI  1335
             FPGYE+
Sbjct  416   FPGYEL  421



>ref|XP_010652678.1| PREDICTED: lanC-like protein GCL1 isoform X1 [Vitis vinifera]
Length=421

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/426 (71%), Positives = 347/426 (81%), Gaps = 8/426 (2%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2     SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  417
             K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +    RH+
Sbjct  57    KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHV  116

Query  418   TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  597
             TFLCG GG+YALGAV AN+  D Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  117   TFLCGSGGVYALGAVVANHIRDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYG  176

Query  598   RAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGA  777
             RAGFLWAALFI +HLG + +PN+ +MPVV A+L GGRAG+SDN+ CPLMYRWHGTRYWGA
Sbjct  177   RAGFLWAALFINKHLGEQTLPNDLIMPVVNAVLAGGRAGASDNTTCPLMYRWHGTRYWGA  236

Query  778   AHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGA  957
             AHGLAGIL VLLHFPLSE+  EDVKGTLRYM +NRFPHSGNYP  EGNPRDKLVQW HGA
Sbjct  237   AHGLAGILQVLLHFPLSEEDSEDVKGTLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGA  296

Query  958   TGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLT  1137
             TG+ ITLCKASQVF  DREFRDAAIEAGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLT
Sbjct  297   TGVAITLCKASQVFSRDREFRDAAIEAGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLT  356

Query  1138  GESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSR  1317
             GE +Y+ERA+AF SFLYHNAG ++      G  +HAYSLFQGLAG ACL FDL++P NSR
Sbjct  357   GEPVYEERAKAFASFLYHNAGKLVTVGHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSR  415

Query  1318  FPGYEI  1335
             FPGYE+
Sbjct  416   FPGYEL  421



>ref|XP_011100038.1| PREDICTED: lanC-like protein GCL1 [Sesamum indicum]
Length=427

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/431 (70%), Positives = 352/431 (82%), Gaps = 9/431 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTN---HEDGNDSG--FRTVLDPTAPSFILPAETFLQAAVSLKDQV  222
             MSS +V  A+ ESN TN   HEDG++     R   D T  S  LP + FL AAVSLKD+V
Sbjct  1     MSSWVVEYAAQESNKTNNSSHEDGDECFDLLRAGCDLTGSSLSLPVDAFLGAAVSLKDKV  60

Query  223   VDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPA  402
             V++TW  RG      +DPTVYTGL+GTA+TCLRS++ TGN +DL+LCA+IVD CA+AA  
Sbjct  61    VEVTWGRRGNKG--SLDPTVYTGLMGTAFTCLRSYEVTGNHRDLQLCAEIVDACAAAAH-  117

Query  403   TIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSY  582
             T RH+TFLCGRGG+YALGA+ ANYCGDQ+KRD ++D F E+AQE+ALP GPEEGGFGMSY
Sbjct  118   TNRHVTFLCGRGGVYALGAITANYCGDQKKRDFFVDRFLEMAQERALPAGPEEGGFGMSY  177

Query  583   DLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGT  762
             DLLYGRAGFLWAAL + ++LG E + N+ LMPVV+A+L GGRAG+SD + CPLMYRWHGT
Sbjct  178   DLLYGRAGFLWAALLVNKYLGGETIANDLLMPVVQAVLAGGRAGASDVTACPLMYRWHGT  237

Query  763   RYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQ  942
             RYWGAAHGLAGIL+VLLHFPLS D +EDVK TLRYMM+NRFPHSGNYPVSEGNPRD+LVQ
Sbjct  238   RYWGAAHGLAGILHVLLHFPLSGDDIEDVKSTLRYMMSNRFPHSGNYPVSEGNPRDRLVQ  297

Query  943   WCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLS  1122
             W HGA+GI +TLCKAS+V P+DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYA LS
Sbjct  298   WSHGASGIAVTLCKASEVLPSDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAFLS  357

Query  1123  LYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIA  1302
             L RLTGESIY+ERA AF S+LYH+A   +    G   A+HA SLF GLAG ACLWFDL  
Sbjct  358   LLRLTGESIYKERATAFASYLYHSATKTIT-ENGSVGAEHACSLFHGLAGAACLWFDLHR  416

Query  1303  PHNSRFPGYEI  1335
               ++RFPGYEI
Sbjct  417   QEDTRFPGYEI  427



>ref|XP_002309963.2| hypothetical protein POPTR_0007s05070g [Populus trichocarpa]
 gb|EEE90413.2| hypothetical protein POPTR_0007s05070g [Populus trichocarpa]
Length=423

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/428 (71%), Positives = 351/428 (82%), Gaps = 10/428 (2%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGNDSGFRTV--LDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             SS V   S E    NHE+ ++     +  LDPTA   ++P E  L+AA+SLKDQVV+ TW
Sbjct  2     SSAVEATSQE----NHEESSNERLDLIHHLDPTATDMLIPNEVLLKAAISLKDQVVEATW  57

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH-  414
             K R  +    +DPTVYTGLLGTA+TCLRSF+ TGN QDL LC++IVDTC+ +A A+ R  
Sbjct  58    K-RDSNMGAGIDPTVYTGLLGTAFTCLRSFEVTGNEQDLLLCSNIVDTCSVSAHASSRQM  116

Query  415   -ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLL  591
              +TFLCG+GGLYALGAVAANY GD Q RD +L+ F EVAQE+ALPVGPEEGGFGMSY+L+
Sbjct  117   TLTFLCGKGGLYALGAVAANYKGDHQGRDFFLNLFLEVAQERALPVGPEEGGFGMSYELM  176

Query  592   YGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYW  771
             YGRAGFLWAALFI +HLG   +P++ L+PVV+A+L GGRAG+SDN+ CPLMYRWHGTRYW
Sbjct  177   YGRAGFLWAALFINKHLGEGTLPSDLLLPVVDAVLAGGRAGASDNAACPLMYRWHGTRYW  236

Query  772   GAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCH  951
             GAA+GLAGIL VLL+FPLS++  EDVK TLRYMM+NRF HSGNYP SEGNPRDKLVQW H
Sbjct  237   GAANGLAGILQVLLNFPLSKEDAEDVKATLRYMMSNRFRHSGNYPSSEGNPRDKLVQWSH  296

Query  952   GATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYR  1131
             GATG+ ITLCKAS++FPNDREFRDAAIEAGEVVWKSGLVKK GLADG AGNAYA LSLYR
Sbjct  297   GATGMVITLCKASEMFPNDREFRDAAIEAGEVVWKSGLVKKAGLADGVAGNAYAFLSLYR  356

Query  1132  LTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHN  1311
             LTGESIY+ERA+AF SFLYHNA  ++      G ADHAYSLFQGLAG ACLWFDL+ P +
Sbjct  357   LTGESIYEERAKAFASFLYHNASGLVTIGHARG-ADHAYSLFQGLAGTACLWFDLLKPES  415

Query  1312  SRFPGYEI  1335
             SRFPGYE+
Sbjct  416   SRFPGYEL  423



>ref|XP_006466262.1| PREDICTED: lanC-like protein GCL1-like [Citrus sinensis]
Length=431

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/433 (70%), Positives = 354/433 (82%), Gaps = 13/433 (3%)
 Frame = +1

Query  67    SIVHLASPESNGTNHEDGNDSGFR------TVLDPTAP-SFILPAETFLQAAVSLKDQVV  225
             S V  AS +S+   HED N+S         +++DPTA  +  LP ETFL+AAVSLKDQVV
Sbjct  2     SSVKFASQDSHA--HEDNNNSERHDLLHHDSIVDPTAAINMSLPCETFLKAAVSLKDQVV  59

Query  226   DMTWK---ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             ++TW+     GG     MDPT+YTGLLGTA+ CLRS++ TGN+Q+L L A+I+DTCAS  
Sbjct  60    EVTWRRLSGGGGEPGRGMDPTLYTGLLGTAFICLRSYELTGNQQELLLSAEIIDTCASVV  119

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
               + RH+TFLCGRGG+YA+GAV AN  GD+ +RD +L+ F E+AQE+ALP GPEEGGFGM
Sbjct  120   RDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFFLNLFLEIAQERALPAGPEEGGFGM  179

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
             SYDLLYGRAGFLWAALF+ +HLG+  +PNE LMP+V+A+L GGRAG++ N+ CPLMYRWH
Sbjct  180   SYDLLYGRAGFLWAALFVNKHLGAGTLPNELLMPIVDAVLAGGRAGATANTACPLMYRWH  239

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             GTRYWGAA+GLAGIL VLLHFPLSE+  EDVKGTLRYMM+NRFP SGNYPVSEGNPRDKL
Sbjct  240   GTRYWGAANGLAGILQVLLHFPLSEEDAEDVKGTLRYMMSNRFPQSGNYPVSEGNPRDKL  299

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             VQW HGATG+ ITLCKASQVFP+DREFRDAAIEAGEVVWK+GLVKKVGLADG AGNAYA 
Sbjct  300   VQWSHGATGVAITLCKASQVFPSDREFRDAAIEAGEVVWKNGLVKKVGLADGAAGNAYAF  359

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSLYRLTGE+IY ERA AF SFLYHNA +++      G ADH YSLFQGLAG AC+WFDL
Sbjct  360   LSLYRLTGETIYVERANAFSSFLYHNAQNLVTSGHAHG-ADHGYSLFQGLAGTACIWFDL  418

Query  1297  IAPHNSRFPGYEI  1335
             + P N+RFPGYE+
Sbjct  419   LEPVNARFPGYEL  431



>ref|XP_004288166.1| PREDICTED: lanC-like protein GCL1 [Fragaria vesca subsp. vesca]
Length=427

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/428 (71%), Positives = 344/428 (80%), Gaps = 3/428 (1%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTN-HEDGNDSGFRTVL-DPTAPSFILPAETFLQAAVSLKDQVVDM  231
             MSS + +LAS  S+    H+DGN+     V    T P   LP ETFL AAVSLKDQVV  
Sbjct  1     MSSVVGYLASSSSSSPEGHDDGNNERLDFVRPTTTTPDLSLPGETFLHAAVSLKDQVVKA  60

Query  232   TWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIR  411
             TW+    S +  +DP VYTGL+GTA+TCLRS++ATGNRQDL LCA+I D CA+ A  + R
Sbjct  61    TWEGEWSSGMG-LDPNVYTGLMGTAFTCLRSYEATGNRQDLLLCAEIADKCAAVARVSAR  119

Query  412   HITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLL  591
             H+TFLCGRGG+YALGAV AN  GDQQ+RD YL+ F EVAQEKAL VGPEEGGFGMSYDLL
Sbjct  120   HVTFLCGRGGVYALGAVVANLVGDQQRRDLYLNLFLEVAQEKALSVGPEEGGFGMSYDLL  179

Query  592   YGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYW  771
             YGRAGFLWAALFI +H G + VP+E LMP+V+A+L GGRAG+SDN  CPLMYRWHGTRY 
Sbjct  180   YGRAGFLWAALFINKHFGEDIVPSELLMPIVDAVLAGGRAGASDNPSCPLMYRWHGTRYL  239

Query  772   GAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCH  951
             GAA+G+AGIL VLLHF LS++  EDVKGTLRYMM NRFPHSGNYP SEGNPRDK VQW H
Sbjct  240   GAANGVAGILQVLLHFSLSDEDAEDVKGTLRYMMANRFPHSGNYPSSEGNPRDKFVQWSH  299

Query  952   GATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYR  1131
             GA G+ ITLCKASQVF  DR+FRDAAIEAGEVVWK+GL+KKVGLADG AGNAYA LSLYR
Sbjct  300   GAAGMAITLCKASQVFSGDRDFRDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLYR  359

Query  1132  LTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHN  1311
             LTGESIY+ERA+AF SFLYHNA  ++   Q    A+HAYSLFQGLAG ACLWFD+  P N
Sbjct  360   LTGESIYEERAKAFASFLYHNARQLVTAGQTTHGAEHAYSLFQGLAGTACLWFDVHVPEN  419

Query  1312  SRFPGYEI  1335
             SRFPGYE+
Sbjct  420   SRFPGYEL  427



>ref|XP_011022825.1| PREDICTED: lanC-like protein GCL1 [Populus euphratica]
Length=423

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/428 (70%), Positives = 351/428 (82%), Gaps = 10/428 (2%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGNDSGFRTV--LDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             SS V  +S E    N E+ ++     +  LDPTA   ++P E  L+AA+SLKDQVV  TW
Sbjct  2     SSAVEASSQE----NREESSNERLDLIHHLDPTATDMLIPNEILLKAAISLKDQVVAATW  57

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  417
             K R  +    +DPTVYTGLLGTA+TCLRS++  GN QDL LC++IV+TC+ +A A+ R +
Sbjct  58    K-RDSNMGAGIDPTVYTGLLGTAFTCLRSYEVAGNEQDLLLCSNIVETCSVSALASSRQL  116

Query  418   T--FLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLL  591
             T  FLCGRGGLYALGAVAANY GDQQ RD +L+ F E+AQE+ALPVGPEEGGFGMSY+L+
Sbjct  117   TLTFLCGRGGLYALGAVAANYKGDQQGRDFFLNLFLELAQERALPVGPEEGGFGMSYELM  176

Query  592   YGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYW  771
             YGRAGFLWAALFI +HLG   +P++ L+PVV+A+L GGRAG+SDN+ CPLMYRWHGTRYW
Sbjct  177   YGRAGFLWAALFINKHLGEGTLPSDLLLPVVDAVLAGGRAGASDNAACPLMYRWHGTRYW  236

Query  772   GAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCH  951
             GAA+GLAGIL VLL+FPLS++  EDVK TLRYMM+NRF HSGNYP SEGNPRDKLVQW H
Sbjct  237   GAANGLAGILQVLLNFPLSKEDAEDVKATLRYMMSNRFCHSGNYPSSEGNPRDKLVQWSH  296

Query  952   GATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYR  1131
             GATG+ ITLCKAS++FPNDREFRDAAIEAGEVVWKSGLVKKVGLADG AGNAYA LSLYR
Sbjct  297   GATGMAITLCKASEMFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLYR  356

Query  1132  LTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHN  1311
             LTGESIY+ERA+AF SFLYHNA  ++      G ADHAYSLFQGLAG ACLWFDL+ P N
Sbjct  357   LTGESIYEERAKAFASFLYHNASGLVTIGHARG-ADHAYSLFQGLAGTACLWFDLLKPEN  415

Query  1312  SRFPGYEI  1335
             SRFPGYE+
Sbjct  416   SRFPGYEL  423



>gb|KDO60700.1| hypothetical protein CISIN_1g013959mg [Citrus sinensis]
Length=431

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/433 (69%), Positives = 353/433 (82%), Gaps = 13/433 (3%)
 Frame = +1

Query  67    SIVHLASPESNGTNHEDGNDSGFR------TVLDPTAP-SFILPAETFLQAAVSLKDQVV  225
             S V  AS +S+   HED N+S         +++DPTA  +  LP ETFL+AAVSLKDQVV
Sbjct  2     SSVKFASQDSHA--HEDNNNSERHDLLHHDSIVDPTAAINMSLPCETFLKAAVSLKDQVV  59

Query  226   DMTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             ++TW+   G        MDPT+YTGLLGTA+ CLRS++ TGN+Q+L L A+I+DTCAS  
Sbjct  60    EVTWRRGSGGGGEPGRGMDPTLYTGLLGTAFICLRSYELTGNQQELLLSAEIIDTCASVV  119

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
               + RH+TFLCGRGG+YA+GAV AN  GD+ +RD +L+ F E+AQE+ALP GPEEGGFGM
Sbjct  120   RDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFFLNLFLEIAQERALPAGPEEGGFGM  179

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
             SYDLLYGRAGFLWAALF+ +HLG+  +PNE LMP+V+A+L GGRAG++ N+ CPLMYRWH
Sbjct  180   SYDLLYGRAGFLWAALFVNKHLGAGTLPNELLMPIVDAVLAGGRAGATANTACPLMYRWH  239

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             GTRYWGAA+GLAGIL VLLHFPLSE+  EDVKGTLRYMM+NRFP SGNYPVSEGNPRDKL
Sbjct  240   GTRYWGAANGLAGILQVLLHFPLSEEDAEDVKGTLRYMMSNRFPQSGNYPVSEGNPRDKL  299

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             VQW HGATG+ ITLCKASQVFP+DREFRDAAIEAGEV+WK+GLVKKVGLADG AGNAYA 
Sbjct  300   VQWSHGATGVAITLCKASQVFPSDREFRDAAIEAGEVLWKNGLVKKVGLADGAAGNAYAF  359

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSLYRLTGE+IY ERA AF SFLYHNA +++      G ADH YSLFQGLAG AC+WFDL
Sbjct  360   LSLYRLTGETIYVERANAFSSFLYHNAQNLVTSGHTRG-ADHGYSLFQGLAGTACIWFDL  418

Query  1297  IAPHNSRFPGYEI  1335
             + P N+RFPGYE+
Sbjct  419   LEPVNARFPGYEL  431



>ref|XP_006426333.1| hypothetical protein CICLE_v10025657mg [Citrus clementina]
 gb|ESR39573.1| hypothetical protein CICLE_v10025657mg [Citrus clementina]
Length=431

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/434 (69%), Positives = 355/434 (82%), Gaps = 15/434 (3%)
 Frame = +1

Query  67    SIVHLASPESNGTNHEDGNDSGFR-------TVLDPTAP-SFILPAETFLQAAVSLKDQV  222
             S V  AS +S+   HED N++G R       +++DPTA  +  LP ETFL+AAVSLKDQV
Sbjct  2     SSVKFASQDSHA--HED-NNNGERHDLLHHDSIVDPTAAINMSLPCETFLKAAVSLKDQV  58

Query  223   VDMTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASA  393
             V++TW+   G        MDPT+YTGLLGTA+ CLRS++ TGN+Q+L L A+I+DTCAS 
Sbjct  59    VEVTWRRGSGGGGEPGRGMDPTLYTGLLGTAFICLRSYELTGNQQELLLSAEIIDTCASV  118

Query  394   APATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFG  573
                + RH+TFLCGRGG+YA+GAV AN  GD+ +RD +L+ F E+AQE+ALP GPEEGGFG
Sbjct  119   VRDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFFLNLFLEIAQERALPAGPEEGGFG  178

Query  574   MSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRW  753
             MSYDLLYGRAGFLWAALF+ +HLG+  +PNE LMP+V+A+L GGRAG++ N+ CPLMYRW
Sbjct  179   MSYDLLYGRAGFLWAALFVNKHLGAGTLPNELLMPIVDAVLAGGRAGATANTACPLMYRW  238

Query  754   HGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDK  933
             HGTRYWGAA+GLAGIL VLLHFPLSE+  EDVKGTLRYMM+NRFP SGNYPVSEGNPRDK
Sbjct  239   HGTRYWGAANGLAGILQVLLHFPLSEEDAEDVKGTLRYMMSNRFPQSGNYPVSEGNPRDK  298

Query  934   LVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYA  1113
             LVQW HGATG+ ITLCKASQVFP+DREFRDAAIEAGEV+WK+GLVKKVGLADG AGNAYA
Sbjct  299   LVQWSHGATGVAITLCKASQVFPSDREFRDAAIEAGEVLWKNGLVKKVGLADGAAGNAYA  358

Query  1114  SLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFD  1293
              LSLYRLTGE+IY ERA AF SFLYHNA +++      G ADH YSLFQGLAG AC+WFD
Sbjct  359   FLSLYRLTGETIYVERANAFSSFLYHNAQNLVTSGHTRG-ADHGYSLFQGLAGTACIWFD  417

Query  1294  LIAPHNSRFPGYEI  1335
             L+ P N+RFPGYE+
Sbjct  418   LLEPVNARFPGYEL  431



>gb|KDO60699.1| hypothetical protein CISIN_1g013959mg [Citrus sinensis]
Length=433

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/435 (69%), Positives = 353/435 (81%), Gaps = 15/435 (3%)
 Frame = +1

Query  67    SIVHLASPESNGTNHEDGNDSGFR------TVLDPTAP-SFILPAETFLQAAVSLKDQVV  225
             S V  AS +S+   HED N+S         +++DPTA  +  LP ETFL+AAVSLKDQVV
Sbjct  2     SSVKFASQDSHA--HEDNNNSERHDLLHHDSIVDPTAAINMSLPCETFLKAAVSLKDQVV  59

Query  226   DMTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             ++TW+   G        MDPT+YTGLLGTA+ CLRS++ TGN+Q+L L A+I+DTCAS  
Sbjct  60    EVTWRRGSGGGGEPGRGMDPTLYTGLLGTAFICLRSYELTGNQQELLLSAEIIDTCASVV  119

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
               + RH+TFLCGRGG+YA+GAV AN  GD+ +RD +L+ F E+AQE+ALP GPEEGGFGM
Sbjct  120   RDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFFLNLFLEIAQERALPAGPEEGGFGM  179

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
             SYDLLYGRAGFLWAALF+ +HLG+  +PNE LMP+V+A+L GGRAG++ N+ CPLMYRWH
Sbjct  180   SYDLLYGRAGFLWAALFVNKHLGAGTLPNELLMPIVDAVLAGGRAGATANTACPLMYRWH  239

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             GTRYWGAA+GLAGIL VLLHFPLSE+  EDVKGTLRYMM+NRFP SGNYPVSEGNPRDKL
Sbjct  240   GTRYWGAANGLAGILQVLLHFPLSEEDAEDVKGTLRYMMSNRFPQSGNYPVSEGNPRDKL  299

Query  937   VQWCHGATGIGITLCKASQ--VFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAY  1110
             VQW HGATG+ ITLCKASQ  VFP+DREFRDAAIEAGEV+WK+GLVKKVGLADG AGNAY
Sbjct  300   VQWSHGATGVAITLCKASQVSVFPSDREFRDAAIEAGEVLWKNGLVKKVGLADGAAGNAY  359

Query  1111  ASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWF  1290
             A LSLYRLTGE+IY ERA AF SFLYHNA +++      G ADH YSLFQGLAG AC+WF
Sbjct  360   AFLSLYRLTGETIYVERANAFSSFLYHNAQNLVTSGHTRG-ADHGYSLFQGLAGTACIWF  418

Query  1291  DLIAPHNSRFPGYEI  1335
             DL+ P N+RFPGYE+
Sbjct  419   DLLEPVNARFPGYEL  433



>ref|XP_008387575.1| PREDICTED: lanC-like protein GCL1 [Malus domestica]
Length=423

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/429 (70%), Positives = 340/429 (79%), Gaps = 9/429 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             MS  +    SPE     H+D N+     V DP AP+    + TFL+AAV+LKDQVV  TW
Sbjct  1     MSFGVEFAPSPEE----HDDANNERLDLV-DPAAPNLSPSSGTFLRAAVTLKDQVVQATW  55

Query  238   KARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  408
             + R  S       +DPTVYTGLLGTA+TCLRS++A GNRQDL LCA+IVD C + A A+ 
Sbjct  56    EGRQDSGTPTGMVLDPTVYTGLLGTAFTCLRSYEAAGNRQDLVLCAEIVDKCRAVASAST  115

Query  409   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  588
             RH+TFLCGRGG+YALGAV AN  GD ++R+ YL+ F EVAQEKAL VGPEEGGFGMSYDL
Sbjct  116   RHVTFLCGRGGVYALGAVVANLIGDHERRNLYLNLFLEVAQEKALSVGPEEGGFGMSYDL  175

Query  589   LYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRY  768
             LYGRAGFLWAALFI ++LG E +PN  LMPVV+A+L GGRAGSS N  CPLM+RWHGTRY
Sbjct  176   LYGRAGFLWAALFINKYLGQEKLPNNJLMPVVDAVLAGGRAGSSHNPSCPLMFRWHGTRY  235

Query  769   WGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWC  948
              GAA+G+AGIL VLLHFPL ++  +DVK TLRYMM NRFPHSGNYP SEGNPRDK VQW 
Sbjct  236   LGAANGVAGILQVLLHFPLCKEDADDVKATLRYMMANRFPHSGNYPSSEGNPRDKFVQWS  295

Query  949   HGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLY  1128
             HGA G+ ITLCKASQVFP DREFRDAAIEAGEVVWK+GL+KKVGLADG AGNAYA LSLY
Sbjct  296   HGAAGMAITLCKASQVFPGDREFRDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLY  355

Query  1129  RLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPH  1308
             RLTGESIY+ERARAF SFLYHNAG+        G A++AYSLFQGLAG ACLWFDL  P 
Sbjct  356   RLTGESIYEERARAFASFLYHNAGEFATAGHTHG-AEYAYSLFQGLAGTACLWFDLYIPE  414

Query  1309  NSRFPGYEI  1335
             NSRFPGYE+
Sbjct  415   NSRFPGYEL  423



>ref|XP_008235076.1| PREDICTED: lanC-like protein GCL1 [Prunus mume]
Length=425

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/431 (69%), Positives = 346/431 (80%), Gaps = 11/431 (3%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             MS  +   +SPE     HED N+     ++DPTAP++ LP+ETFL+AAVSLKDQVV  TW
Sbjct  1     MSFGVELTSSPE----GHEDANNERL-DLIDPTAPNWSLPSETFLRAAVSLKDQVVQGTW  55

Query  238   KARGGSAV-----THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPA  402
             +  G S         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L +++VD C +   A
Sbjct  56    EGGGDSGSGPRTGMVLDPTVYTGLLGTAFTCLRSYEATGNRQDLVLSSEVVDKCVTVERA  115

Query  403   TIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSY  582
             + RH+TFLCGRGG+YA+GAV AN  GD Q+RD YL+ F EVAQEKAL VGPEEGGFGMSY
Sbjct  116   STRHVTFLCGRGGVYAIGAVVANLIGDHQRRDLYLNLFLEVAQEKALSVGPEEGGFGMSY  175

Query  583   DLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGT  762
             DLL+GRAGFLWAALFI ++LG E VP++ LMPVV+A+L GGRAG+SDN  CPLMYRWHGT
Sbjct  176   DLLHGRAGFLWAALFINKYLGQEKVPSDLLMPVVDAVLAGGRAGASDNPSCPLMYRWHGT  235

Query  763   RYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQ  942
             RY GAA+GLAGIL VLLHFPLS++  EDVK TLRYMM NRFPHSGNYP SEGNPRDK V 
Sbjct  236   RYLGAANGLAGILQVLLHFPLSKEDAEDVKATLRYMMANRFPHSGNYPSSEGNPRDKFVH  295

Query  943   WCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLS  1122
             W HGA G+ ITLCKASQVFP DREFRDAAIEAGEVVWK+GL+KKVGLADG AGNAYA LS
Sbjct  296   WSHGAAGMAITLCKASQVFPGDREFRDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLS  355

Query  1123  LYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIA  1302
             LYRLTGE+IY+ RA+AF SFLYHN  +++      G A+HAYSLFQGLAG ACL FDL  
Sbjct  356   LYRLTGETIYEGRAKAFASFLYHNGRELVTVGDTHG-AEHAYSLFQGLAGTACLLFDLHM  414

Query  1303  PHNSRFPGYEI  1335
             P N+RFPGYE+
Sbjct  415   PENARFPGYEL  425



>ref|XP_010267103.1| PREDICTED: lanC-like protein GCL1 [Nelumbo nucifera]
Length=421

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/427 (70%), Positives = 344/427 (81%), Gaps = 7/427 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRT-VLDPTAPSFILPAETFLQAAVSLKDQVVDMT  234
             MSSS+V +AS   +    E+GN+   +  + D    +  L  ETFLQAA+SLKD+V++ T
Sbjct  1     MSSSMVEMASQGGD----EEGNERLDKLHMTDLATTTLYLTRETFLQAAISLKDRVIEAT  56

Query  235   WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  414
             WK RGG  +  MDPTVYTGLLGTA+TCLRS+QATG + DL+LCA+IVDTCA+ A ++ RH
Sbjct  57    WKERGGLQLQSMDPTVYTGLLGTAFTCLRSYQATGCQSDLQLCAEIVDTCAAVARSSKRH  116

Query  415   ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  594
             +TFLCG GG+YALGAV ANY  D Q+RD YLD F EVAQ++ALP GPEEGGFGM Y+L Y
Sbjct  117   LTFLCGSGGVYALGAVVANYKDDCQRRDLYLDLFLEVAQDRALPSGPEEGGFGMPYELHY  176

Query  595   GRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWG  774
             GRAGFLWAALFI +HLG E VP   LMPVVEA+L GGRAG+SDN+ CPLMYRWHGT YWG
Sbjct  177   GRAGFLWAALFINRHLG-EVVPKNLLMPVVEAVLAGGRAGASDNTACPLMYRWHGTGYWG  235

Query  775   AAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHG  954
             AAHGLAGIL+V+LHFPLS    EDVK T RYMM NRFP SGNYP SEGNPRD LVQW HG
Sbjct  236   AAHGLAGILHVVLHFPLSRQDAEDVKDTFRYMMKNRFPRSGNYPSSEGNPRDNLVQWSHG  295

Query  955   ATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRL  1134
             ATG+ ITLC A+QVF  DREFRDAAIEAGEVVWK+GLV+KVGL+DG +GNAYA LSLYRL
Sbjct  296   ATGMAITLCNAAQVFSCDREFRDAAIEAGEVVWKNGLVRKVGLSDGVSGNAYAFLSLYRL  355

Query  1135  TGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNS  1314
             TG++IYQ+RA AF SFLYHNAG ++         DHAYSLFQGLAGVACLWFDL++P NS
Sbjct  356   TGKTIYQKRAEAFASFLYHNAGRLVTAGHVR-RNDHAYSLFQGLAGVACLWFDLVSPENS  414

Query  1315  RFPGYEI  1335
             RFPGYE+
Sbjct  415   RFPGYEL  421



>gb|KHG19988.1| LanC-like protein 2 [Gossypium arboreum]
Length=432

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/436 (69%), Positives = 349/436 (80%), Gaps = 14/436 (3%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRT--VLDPT-APSFILPAETFLQAAVSLKDQVVD  228
             MSS +   ASPES    H++G +       V+DPT + S  L A+TFL+AA++LK+QVV+
Sbjct  1     MSSVMELTASPES----HDEGKNELLDNFLVMDPTLSNSLSLSADTFLKAAMTLKNQVVE  56

Query  229   MTWKARGGSAVTH------MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCAS  390
             +TWK RG            +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S
Sbjct  57    VTWKGRGSGGGGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLVLSAEIVDTCLS  116

Query  391   AAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGF  570
              A A+ RH+TFLCGRGG+Y+LGAV ANY GD Q+ + +L+ F EVAQEKALPVGPEEGGF
Sbjct  117   VARASPRHVTFLCGRGGVYSLGAVVANYMGDHQRLEFFLNLFIEVAQEKALPVGPEEGGF  176

Query  571   GMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYR  750
             GMSYDLLYGRAGFLWAALF+ +HL  E VPN+ LMP+V+A+L  GR G+SD   CPLMYR
Sbjct  177   GMSYDLLYGRAGFLWAALFLNKHLQGEVVPNDVLMPIVDAVLAAGRTGASDLPACPLMYR  236

Query  751   WHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRD  930
             WHGTRYWGAA+GLAGIL+VLLHFPLSE    DVKGTLR+MM NRFPHSGNYP SEGNPRD
Sbjct  237   WHGTRYWGAANGLAGILHVLLHFPLSEGYAGDVKGTLRHMMCNRFPHSGNYPSSEGNPRD  296

Query  931   KLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAY  1110
             KLVQW HGAT + ITL KASQV+PNDREFRDAAIEAGEVVWK+GLVKKVGLADG AGN Y
Sbjct  297   KLVQWSHGATSMAITLAKASQVYPNDREFRDAAIEAGEVVWKNGLVKKVGLADGIAGNTY  356

Query  1111  ASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG-AADHAYSLFQGLAGVACLW  1287
             A LSLYRLTGE+IY++RA+AF SFLYHN   +     G G  AD  YSLFQGLAG ACLW
Sbjct  357   AFLSLYRLTGETIYKDRAKAFASFLYHNKRKLAGIEHGGGFRADDEYSLFQGLAGTACLW  416

Query  1288  FDLIAPHNSRFPGYEI  1335
             FD++APH S+FPGYE+
Sbjct  417   FDMLAPHKSKFPGYEL  432



>ref|XP_012081620.1| PREDICTED: lanC-like protein GCL1 [Jatropha curcas]
 gb|KDP29724.1| hypothetical protein JCGZ_18659 [Jatropha curcas]
Length=422

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/432 (69%), Positives = 346/432 (80%), Gaps = 19/432 (4%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGN----DSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDM  231
             SS +   S +S+  +HED N    D      + P+A +  LP ETFL+AA+SLK++VV+M
Sbjct  2     SSAIEYTSQDSH--SHEDNNNERLDLNLILQMKPSASNLWLPKETFLRAAISLKNKVVEM  59

Query  232   TWKARGGSAVTH----MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  399
             TW    GS  T     +D TVY+GLLGTA+TCLRS++ TGN+QDL  C++IVDTCA+AA 
Sbjct  60    TWN---GSCSTDRSAVVDSTVYSGLLGTAFTCLRSYEFTGNQQDLLSCSEIVDTCAAAAR  116

Query  400   ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMS  579
             A+ RH+TFLCGRGG+YALGAV ANY GDQ  RDSYLD F EVA E+ALP+GPEEGGFGMS
Sbjct  117   ASSRHVTFLCGRGGIYALGAVVANYKGDQHGRDSYLDLFLEVAHERALPIGPEEGGFGMS  176

Query  580   YDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHG  759
             Y+L+YGRAGFLWAALFI ++LG + +P+E L+P+V+A+L GGRAG+SDN  CPLMYRWHG
Sbjct  177   YELMYGRAGFLWAALFINKYLGEQTLPSEILLPIVDAVLAGGRAGASDNPECPLMYRWHG  236

Query  760   TRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLV  939
             TRYWGAA+GLAGIL VLLHF LS +  EDVK TLRYMM+ RFP SGNYP SEGNPRDKLV
Sbjct  237   TRYWGAANGLAGILQVLLHFQLSNEDAEDVKATLRYMMSKRFPRSGNYPSSEGNPRDKLV  296

Query  940   QWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASL  1119
             QW HGAT + I+LCKASQVF NDREFR AAIEAGEVVWKSGLVKKVGL DG AGNAYA L
Sbjct  297   QWSHGATAMAISLCKASQVFSNDREFRSAAIEAGEVVWKSGLVKKVGLFDGIAGNAYAFL  356

Query  1120  SLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLI  1299
             SLYRLTGESIY+ERA+AF SFLYHNA     G      ADH YSLFQGLAGVACLWFD++
Sbjct  357   SLYRLTGESIYEERAKAFASFLYHNASKFSTG------ADHVYSLFQGLAGVACLWFDIL  410

Query  1300  APHNSRFPGYEI  1335
             AP  SRFPGYE+
Sbjct  411   APERSRFPGYEL  422



>emb|CBI33140.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/472 (64%), Positives = 349/472 (74%), Gaps = 54/472 (11%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2     SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA-------  396
             K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +       
Sbjct  57    KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHV  116

Query  397   ---------------------------------------PATIRHITFLCGRGGLYALGA  459
                                                    P  I H+TFLCG GG+YALGA
Sbjct  117   TFLCGSGGVYALGAVVANHIRDYQRRDMYLDLFLEGCPYPFGITHVTFLCGSGGVYALGA  176

Query  460   VAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQH  639
             V AN+ GD Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYGRAGFLWAALFI +H
Sbjct  177   VVANHIGDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYGRAGFLWAALFINKH  236

Query  640   LGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHF  819
             LG + +PN+ +MPVV A+L GGRAG+SDN+ CPLMYRWHGTRYWGAAHGLAGIL VLLHF
Sbjct  237   LGEQTLPNDLIMPVVNAVLAGGRAGASDNTTCPLMYRWHGTRYWGAAHGLAGILQVLLHF  296

Query  820   PLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVF  999
             PLSE+  EDVKGTLRYM +NRFPHSGNYP  EGNPRDKLVQW HGATG+ ITLCKASQVF
Sbjct  297   PLSEEDSEDVKGTLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGATGVAITLCKASQVF  356

Query  1000  PNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGS  1179
               DREFRDAAIEAGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLTGE +Y+ERA+AF S
Sbjct  357   SRDREFRDAAIEAGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFAS  416

Query  1180  FLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             FLYHNAG ++      G  +HAYSLFQGLAG ACL FDL++P NSRFPGYE+
Sbjct  417   FLYHNAGKLVTVGHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  467



>gb|KJB48857.1| hypothetical protein B456_008G090400 [Gossypium raimondii]
Length=429

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/433 (69%), Positives = 345/433 (80%), Gaps = 11/433 (3%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVL--DPT-APSFILPAETFLQAAVSLKDQVVD  228
             MSS +   AS ES    HE+G +      L  DPT + +  L A+TFL+AA++LK+QVV+
Sbjct  1     MSSVMELTASQES----HEEGKNERLDNFLNMDPTLSNTLSLSADTFLKAAMALKNQVVE  56

Query  229   MTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  399
             +TWK RG         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S A 
Sbjct  57    VTWKGRGSGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLLLSAEIVDTCLSVAR  116

Query  400   ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMS  579
             A+ RH+TFLCGRGG+Y+LGAV ANY GD Q  + +L+ F EVAQEKALPVGPEEGGFGMS
Sbjct  117   ASPRHVTFLCGRGGVYSLGAVVANYMGDHQSLEFFLNLFIEVAQEKALPVGPEEGGFGMS  176

Query  580   YDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHG  759
             YDLLYGRAGFLWAALF+ +HL  E VPN+ LM +V+A+L  GR G+SD   CPLMYRWHG
Sbjct  177   YDLLYGRAGFLWAALFLNKHLQGEVVPNDVLMLIVDAVLAAGRTGASDLPACPLMYRWHG  236

Query  760   TRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLV  939
             TRYWGAA+GLAGIL+VLLHFPLSE    DVKGTLR+MM NRFPHSGNYP SEGNPRDKLV
Sbjct  237   TRYWGAANGLAGILHVLLHFPLSEGDAGDVKGTLRHMMCNRFPHSGNYPSSEGNPRDKLV  296

Query  940   QWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASL  1119
             QW HGAT + ITL KASQV+PNDREFRDAAIEAGEVVWK+GLVKKVGLADG AGN YA L
Sbjct  297   QWSHGATSMAITLAKASQVYPNDREFRDAAIEAGEVVWKNGLVKKVGLADGIAGNTYAFL  356

Query  1120  SLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG-AADHAYSLFQGLAGVACLWFDL  1296
             SLYRLTGE+IY+ERA+AF SFLYHN   +     G G  AD  YSLFQGLAG ACLWFD+
Sbjct  357   SLYRLTGETIYKERAKAFASFLYHNKRKLAGIEHGGGFGADDGYSLFQGLAGTACLWFDM  416

Query  1297  IAPHNSRFPGYEI  1335
             +APH S+FPGYE+
Sbjct  417   LAPHKSKFPGYEL  429



>ref|XP_002531667.1| catalytic, putative [Ricinus communis]
 gb|EEF30711.1| catalytic, putative [Ricinus communis]
Length=432

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/414 (71%), Positives = 346/414 (84%), Gaps = 7/414 (2%)
 Frame = +1

Query  106   NHEDGNDSGFRTV--LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGS--AVTHMD  273
             +H+D N+     +  +DPT  +  LP ETFL AA+SLKDQVV+MTWK  G +   +T +D
Sbjct  22    SHDDTNNERLDLIRQIDPTVKTLSLPNETFLGAAISLKDQVVEMTWKVCGSTDTGITVVD  81

Query  274   PTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYAL  453
             PTVY+G LGTA+ CLRS++ TG+ QD+ LC+ IVD+CASAA A+ RH+TFLCGRGG+YAL
Sbjct  82    PTVYSGSLGTAFVCLRSYEVTGDDQDILLCSKIVDSCASAARASSRHVTFLCGRGGVYAL  141

Query  454   GAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIK  633
             GAV AN  GDQ++RD +L+ F EVAQE+ALPVGPEEGGFGMSY+L+YGRAGFLWAALFI 
Sbjct  142   GAVVANCQGDQRRRDFFLNLFLEVAQERALPVGPEEGGFGMSYELMYGRAGFLWAALFIN  201

Query  634   QHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLL  813
             +HLG   + ++ LMP+V+A+L GGRAG+S+N  CPLMYRWHGTRYWGAA+GLAGIL+VLL
Sbjct  202   KHLGEGTLSSDVLMPIVDAVLAGGRAGASNNPACPLMYRWHGTRYWGAANGLAGILHVLL  261

Query  814   HFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQ  993
             HFPLSE+  EDVKGTLRYMM+NRF HSGNYP SEGNPRDKLVQW HGATG+ ITL KAS+
Sbjct  262   HFPLSEEDSEDVKGTLRYMMSNRFLHSGNYPSSEGNPRDKLVQWSHGATGMAITLSKASE  321

Query  994   VFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAF  1173
             VFPNDREFRDAAIEAGEVVWKSGLVKKVGLADG AGNAYA LSL+RLTG+ IY+ERA+AF
Sbjct  322   VFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLFRLTGDIIYEERAKAF  381

Query  1174  GSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              SFLYHNA +I+    G    D AYSLF+GLAG ACLWFDL+AP  SRFPGYE+
Sbjct  382   ASFLYHNASEII---NGHVPGDDAYSLFKGLAGAACLWFDLLAPEKSRFPGYEL  432



>ref|XP_010025417.1| PREDICTED: lanC-like protein GCL1 [Eucalyptus grandis]
Length=430

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/397 (73%), Positives = 333/397 (84%), Gaps = 6/397 (2%)
 Frame = +1

Query  145   LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRS  324
             +DP AP   LP ETFL+AA+SLKDQVV  TW+  GG+A    DPT YTGLLGTA+ CLRS
Sbjct  40    VDPGAPDLSLPRETFLRAALSLKDQVVQATWR-EGGAA----DPTAYTGLLGTAFLCLRS  94

Query  325   FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  504
             + ATG+R DL L A+IVD CASAA A+ RH+TFLCG+GG++A+GAV AN  GD  KRD +
Sbjct  95    YAATGDRGDLLLSAEIVDACASAARASTRHVTFLCGKGGVFAVGAVVANLLGDHHKRDFF  154

Query  505   LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVV  684
             L+ F EVAQE+ALPVGPEEGGFGMSYDLLYGRAGFLWAALF+ ++LG E VPN  LMP+V
Sbjct  155   LNLFLEVAQERALPVGPEEGGFGMSYDLLYGRAGFLWAALFLNKNLGEETVPNNVLMPIV  214

Query  685   EAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLR  864
             +A+L GGRAG+SD + CPLMYRWHGTRY GAA+GLAGIL VLLHFPL E+ +EDVKGTLR
Sbjct  215   DAVLAGGRAGASDIATCPLMYRWHGTRYLGAANGLAGILQVLLHFPLCEEYLEDVKGTLR  274

Query  865   YMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGE  1044
             Y+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITLCKASQVFP+DR+FRDAAIEAGE
Sbjct  275   YIMSKRFPHSGNYPSSEGNPRDKLVQWSHGATGMAITLCKASQVFPHDRDFRDAAIEAGE  334

Query  1045  VVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQG  1224
             VVWK+GLVKKVGLADG +GNAYA LSLYRLTGE IY++RARAF SFLYH+A   +    G
Sbjct  335   VVWKNGLVKKVGLADGISGNAYAFLSLYRLTGERIYEDRARAFASFLYHDANKPVGTGHG  394

Query  1225  DGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                AD+A+SL+QGLAG ACLWFDL+   NSRFPGYE+
Sbjct  395   H-VADYAFSLYQGLAGAACLWFDLVDAENSRFPGYEL  430



>gb|ADU04150.1| hypothetical protein [Gossypium hirsutum]
Length=432

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/436 (68%), Positives = 346/436 (79%), Gaps = 14/436 (3%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVL--DPT-APSFILPAETFLQAAVSLKDQVVD  228
             MSS +   AS ES    H++G +      L  DPT + S  L A+TFL+AA++LK+QVV+
Sbjct  1     MSSVMELTASQES----HDEGKNERLDNFLNMDPTLSNSLSLSADTFLKAAMTLKNQVVE  56

Query  229   MTWKARGGSAVTH------MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCAS  390
             +TWK RG            +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S
Sbjct  57    VTWKGRGSGGGGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLVLSAEIVDTCLS  116

Query  391   AAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGF  570
              A A+ RH+TFLCGRGG+Y+LGAV ANY GD Q+ + +L+ F EVAQEKALPVGPEEGGF
Sbjct  117   VARASPRHVTFLCGRGGVYSLGAVVANYMGDHQRLEFFLNLFIEVAQEKALPVGPEEGGF  176

Query  571   GMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYR  750
             GMSYDLLYGRAGFLWAALF+ +HL  E VPN+ LMP+V+A+L  GR G+SD   CPLMYR
Sbjct  177   GMSYDLLYGRAGFLWAALFLNKHLQGEVVPNDVLMPIVDAVLAAGRTGASDLPACPLMYR  236

Query  751   WHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRD  930
             WHGTRYWGAA+GLAGIL+VLLHFPLSE    +VKGTLR+MM NRFPHSGNYP SEGNPRD
Sbjct  237   WHGTRYWGAANGLAGILHVLLHFPLSEGYAGEVKGTLRHMMCNRFPHSGNYPSSEGNPRD  296

Query  931   KLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAY  1110
             KLVQW HGAT + ITL KASQV+PNDREFRDAAIEAGEVVWK+GLVKKVGLADG AGN Y
Sbjct  297   KLVQWSHGATSMAITLAKASQVYPNDREFRDAAIEAGEVVWKNGLVKKVGLADGIAGNTY  356

Query  1111  ASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG-AADHAYSLFQGLAGVACLW  1287
             A LSLYRLTGE+IY+ RA+AF SFLYHN   +     G G  A+  YSLFQGLAG ACLW
Sbjct  357   AFLSLYRLTGETIYKYRAKAFASFLYHNKRKLAGIEHGGGFRANDEYSLFQGLAGTACLW  416

Query  1288  FDLIAPHNSRFPGYEI  1335
             FD++APH S+FPGYE+
Sbjct  417   FDMLAPHKSKFPGYEL  432



>ref|XP_009339587.1| PREDICTED: lanC-like protein GCL1 [Pyrus x bretschneideri]
Length=423

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/429 (69%), Positives = 336/429 (78%), Gaps = 9/429 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             MS  +     PE    +HED N      V DPTAP+  LP+ TFL AAV+LKDQVV  TW
Sbjct  1     MSFGVEFALPPE----DHEDANKERVDLV-DPTAPNLSLPSGTFLIAAVALKDQVVQATW  55

Query  238   KARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  408
             +   GS       +DPTVYTGLLGTA+TCLRS++ATGNRQDL LCADIV  C + APA+ 
Sbjct  56    EGGHGSGTPTGMVLDPTVYTGLLGTAFTCLRSYEATGNRQDLLLCADIVHKCGAVAPASS  115

Query  409   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  588
             RH+TFLCGRGG+YALGAV A+  GD ++   YL+ F E+AQEKAL VGPEEGGFGMSYDL
Sbjct  116   RHVTFLCGRGGVYALGAVVASLIGDHERCGLYLNLFLEMAQEKALSVGPEEGGFGMSYDL  175

Query  589   LYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRY  768
             LYGRAGFLWAALFI ++LG + +P++ LMPVV A+L GGRAG+S    CPLMYRWHGTRY
Sbjct  176   LYGRAGFLWAALFINKYLGHDKLPSDLLMPVVVAVLAGGRAGASHIPSCPLMYRWHGTRY  235

Query  769   WGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWC  948
              GAA+G+AGIL VLLHFPL  +  EDVK TLRYMM NRFPHSGNYP SEGNPRDK VQW 
Sbjct  236   LGAANGMAGILQVLLHFPLCNEDAEDVKATLRYMMANRFPHSGNYPSSEGNPRDKFVQWS  295

Query  949   HGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLY  1128
             HGA G+ ITLCKASQVFP DREFRDAAIEAGEVVWK+GL+KKVGLADG AGNAYA LSLY
Sbjct  296   HGAAGMAITLCKASQVFPGDREFRDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLY  355

Query  1129  RLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPH  1308
             RLTGESIY+ERA+AF SFLYH AG+     +  G  ++ YSLFQGLAG ACLWFDL  P 
Sbjct  356   RLTGESIYKERAKAFASFLYHKAGEFSTAGRTHG-VEYGYSLFQGLAGTACLWFDLHVPE  414

Query  1309  NSRFPGYEI  1335
             NSRFPGYE+
Sbjct  415   NSRFPGYEL  423



>ref|XP_004146876.1| PREDICTED: lanC-like protein GCL1 [Cucumis sativus]
 gb|KGN53211.1| hypothetical protein Csa_4G026880 [Cucumis sativus]
Length=419

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/426 (68%), Positives = 345/426 (81%), Gaps = 10/426 (2%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGNDSGFRTVLDPTAP--SFILPAETFLQAAVSLKDQVVDMTW  237
             SS++HLAS +      ED  + G    +    P  + +LP++TFL AAVS K+QVV++TW
Sbjct  2     SSLLHLASSQ------EDREEGGGGGGIIQIIPPNTILLPSQTFLSAAVSFKNQVVELTW  55

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  417
             K RG + +  +DPTVY GLLGTA TCLRS++ATGN QDL LC+DIVD C   A A+ RH+
Sbjct  56    KQRGNADIG-VDPTVYNGLLGTAVTCLRSYEATGNHQDLVLCSDIVDKCTVLARASHRHL  114

Query  418   TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  597
             TFLCGRGG+YALGAV ++Y  D QK D + + F + A+EKALP+GPEEGGFGMSYDLLYG
Sbjct  115   TFLCGRGGVYALGAVVSHYMRDPQKLDFFFNLFLKAAEEKALPIGPEEGGFGMSYDLLYG  174

Query  598   RAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGA  777
             RAGFLWAALFI +HLG + +P++ LM VV+A+L GGRAG+SDN  CPLM+RWHGTRY+GA
Sbjct  175   RAGFLWAALFINKHLGEQRIPHDLLMSVVDAVLAGGRAGASDNPDCPLMFRWHGTRYYGA  234

Query  778   AHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGA  957
             A+GLAGIL VLLHFPLS++  +DVKGTLRY+M+ RFPHSGNYP SEG+PRDKLVQW HGA
Sbjct  235   ANGLAGILQVLLHFPLSKEDTDDVKGTLRYLMSKRFPHSGNYPSSEGSPRDKLVQWSHGA  294

Query  958   TGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLT  1137
             TGIGITLCKASQVF  DREFRDAAIEAGEVVWK+GLVK+VGLADG AGNAYA LSLYRLT
Sbjct  295   TGIGITLCKASQVFHEDREFRDAAIEAGEVVWKNGLVKEVGLADGVAGNAYAFLSLYRLT  354

Query  1138  GESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSR  1317
             GES+Y+ERARAFG++LYHNA  ++A +Q     D  +SLF GLAG ACLWFDL+ P  SR
Sbjct  355   GESVYEERARAFGTYLYHNASKLVA-TQNQVGGDRLFSLFHGLAGTACLWFDLLEPEKSR  413

Query  1318  FPGYEI  1335
             FPGYE+
Sbjct  414   FPGYEL  419



>gb|ADU04157.1| hypothetical protein [Gossypium hirsutum]
Length=429

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/433 (69%), Positives = 343/433 (79%), Gaps = 11/433 (3%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVL--DPT-APSFILPAETFLQAAVSLKDQVVD  228
             MSS +   AS ES    HE+G +      L  DPT + +  L A+TFL+AA++LK+QVV 
Sbjct  1     MSSVMELTASQES----HEEGKNERLDNFLNMDPTLSNTLSLSADTFLKAAMALKNQVVQ  56

Query  229   MTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  399
             +TWK RG         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S A 
Sbjct  57    VTWKGRGSGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLLLSAEIVDTCLSVAR  116

Query  400   ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMS  579
             A+ RH+TFLCGRGG+Y+LGAV ANY GD Q+ + +L+ F EVAQEKALPVGPEEGGFGMS
Sbjct  117   ASPRHVTFLCGRGGVYSLGAVVANYMGDHQRLEFFLNLFIEVAQEKALPVGPEEGGFGMS  176

Query  580   YDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHG  759
             YDLLYGRAGFLWAALF+ +HL  E VPN+ LM +V+A+L  GR G+SD   CPLMYRWHG
Sbjct  177   YDLLYGRAGFLWAALFLNKHLQGEVVPNDVLMLIVDAVLAAGRTGASDLPGCPLMYRWHG  236

Query  760   TRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLV  939
             TRYWGAA+GLAGIL+VLLHFPLSE    DVKGTLR+MM NRFPHSGNYP SEGNPRDKLV
Sbjct  237   TRYWGAANGLAGILHVLLHFPLSEGDAGDVKGTLRHMMCNRFPHSGNYPSSEGNPRDKLV  296

Query  940   QWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASL  1119
             QW HGAT + ITL KASQV+PNDREFRDAAIEAGEVVWK+GLVKKVGLADG AGN YA L
Sbjct  297   QWSHGATSMAITLAKASQVYPNDREFRDAAIEAGEVVWKNGLVKKVGLADGIAGNTYAFL  356

Query  1120  SLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG-AADHAYSLFQGLAGVACLWFDL  1296
             SLYRLTGE+IY+ERA+AF SFLYHN   +     G G  AD  YSLFQGLAG ACLWFD+
Sbjct  357   SLYRLTGETIYKERAKAFASFLYHNKRKLAGIEHGGGFGADDGYSLFQGLAGTACLWFDM  416

Query  1297  IAPHNSRFPGYEI  1335
             + P  S+FPGYE+
Sbjct  417   LVPLKSKFPGYEL  429



>ref|XP_008453808.1| PREDICTED: lanC-like protein GCL1 [Cucumis melo]
Length=419

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/424 (67%), Positives = 344/424 (81%), Gaps = 6/424 (1%)
 Frame = +1

Query  64    SSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKA  243
             SS++ LAS + +     +G   G    + P   + +LP++TFL AAVSLK+QVV++TWK 
Sbjct  2     SSLLELASSQED----REGGGGGGGIQIPPNCNTILLPSQTFLSAAVSLKNQVVELTWKK  57

Query  244   RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  423
             RG + +  +DPTVY GLLGTA TCLRS++ TGN QDL LC+DIVD C  AA A+ RH+TF
Sbjct  58    RGNADIG-VDPTVYNGLLGTAVTCLRSYEVTGNHQDLVLCSDIVDKCTVAARASHRHLTF  116

Query  424   LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  603
             LCGRGG+YALGAV ++Y  D QK D + + F + A+EKALP GPEEGGFGMSYDLLYGRA
Sbjct  117   LCGRGGVYALGAVVSHYMRDPQKLDFFFNLFLQAAEEKALPSGPEEGGFGMSYDLLYGRA  176

Query  604   GFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAH  783
             GFLWAALFI +HLG + +P++ LM V++A+L GGRAG+SDN  CPLM+RWHGTRY+GAA+
Sbjct  177   GFLWAALFINKHLGEQRLPHDLLMSVIDAVLAGGRAGASDNPDCPLMFRWHGTRYYGAAN  236

Query  784   GLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATG  963
             GLAGIL VLLHFPLS++  +DVKGTLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATG
Sbjct  237   GLAGILQVLLHFPLSKEDADDVKGTLRYLMSKRFPHSGNYPSSEGNPRDKLVQWSHGATG  296

Query  964   IGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGE  1143
             IGITLCKASQVF  DREFRDAAIEAGEVVWK+GLVK+VGLADG +GNAYA LSLYRLTGE
Sbjct  297   IGITLCKASQVFHEDREFRDAAIEAGEVVWKNGLVKEVGLADGVSGNAYAFLSLYRLTGE  356

Query  1144  SIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFP  1323
             S+Y+ERARAFG++LYHNA  ++A +Q     D  +SLF GLAG ACLWFDL+ P  SRFP
Sbjct  357   SVYEERARAFGTYLYHNASKLVA-NQNQVGGDRLFSLFHGLAGTACLWFDLLEPEKSRFP  415

Query  1324  GYEI  1335
             GYE+
Sbjct  416   GYEL  419



>ref|XP_009365826.1| PREDICTED: lanC-like protein GCL1 [Pyrus x bretschneideri]
Length=423

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/429 (69%), Positives = 335/429 (78%), Gaps = 9/429 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             MS  +     PE    +HED N      V DPTAP+  LP+ TFL AAV+LKDQVV  TW
Sbjct  1     MSFGVEFALPPE----DHEDANKERVDLV-DPTAPNLSLPSGTFLIAAVALKDQVVQATW  55

Query  238   KARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  408
             +   GS       +DPTVYTGLLGTA+TCLRS++ATGNRQDL LCADIV  C + APA+ 
Sbjct  56    EGGHGSGTPTGMVLDPTVYTGLLGTAFTCLRSYEATGNRQDLLLCADIVHKCGAVAPASS  115

Query  409   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  588
             RH+TFLCGRGG+YALGAV A+  GD ++   YL+ F E+AQEKAL VGPEEGGFGMSYDL
Sbjct  116   RHVTFLCGRGGVYALGAVVASLIGDHERCGLYLNLFLEMAQEKALSVGPEEGGFGMSYDL  175

Query  589   LYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRY  768
             LYGRAGFLWAALFI ++LG + +P++ LMPVV A+L GGRAG+S    CPLMYRWHGTRY
Sbjct  176   LYGRAGFLWAALFINKYLGHDKLPSDLLMPVVVAVLAGGRAGASHIPSCPLMYRWHGTRY  235

Query  769   WGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWC  948
              GAA+G+AGIL VLLHFPL  +  EDVK TLRYMM NRFP SGNYP SEGNPRDK VQW 
Sbjct  236   LGAANGMAGILQVLLHFPLCNEDAEDVKATLRYMMANRFPRSGNYPSSEGNPRDKFVQWS  295

Query  949   HGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLY  1128
             HGA G+ ITLCKASQVFP DREFRDAAIEAGEVVWK+GL+KKVGLADG AGNAYA LSLY
Sbjct  296   HGAAGMAITLCKASQVFPGDREFRDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLY  355

Query  1129  RLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPH  1308
             RLTGESIY+ERA+AF SFLYH AG+     +  G  ++ YSLFQGLAG ACLWFDL  P 
Sbjct  356   RLTGESIYEERAKAFASFLYHKAGEFSTAGRTHG-VEYGYSLFQGLAGTACLWFDLHVPE  414

Query  1309  NSRFPGYEI  1335
             NSRFPGYE+
Sbjct  415   NSRFPGYEL  423



>gb|KHN44353.1| LanC-like protein 2 [Glycine soja]
Length=411

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/429 (67%), Positives = 338/429 (79%), Gaps = 21/429 (5%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRT-VLDPTAPSFILPAET--FLQAAVSLKDQVVD  228
             M+SS+V        G +      S F T  ++  +P+  LP+ET  FL AA+SLKD+VV+
Sbjct  1     MTSSVVE------GGRDEGKHEPSDFITETMNLPSPNLSLPSETETFLSAAISLKDKVVE  54

Query  229   MTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  408
              TW  R       +DPTVYTGLLGTA+TCLRS+Q TG R DL LC+DI+DTC +AA A++
Sbjct  55    ETWNRRD----QVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILCSDIIDTCVTAARASL  110

Query  409   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  588
             RH+TFLCGRGG+YALGAV ANY  D  KRD +L  FFEVA+E+ALPVGPEEGGFGMSYDL
Sbjct  111   RHVTFLCGRGGVYALGAVVANYMEDLPKRDLFLGLFFEVAKERALPVGPEEGGFGMSYDL  170

Query  589   LYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRY  768
             LYGRAGFLW ALF+ +HLG +AVP + LMP+++A+L GGRAG+SD   CPLMYRWHGTRY
Sbjct  171   LYGRAGFLWGALFVNKHLGDDAVPKDILMPIIDAVLAGGRAGASDVEDCPLMYRWHGTRY  230

Query  769   WGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWC  948
              GAA+GLAGIL+VLLHFPL  +  EDVKGTLRY+M+ RFPHSGNYP SEGNPRDKLVQW 
Sbjct  231   LGAANGLAGILHVLLHFPLPREDAEDVKGTLRYLMSKRFPHSGNYPSSEGNPRDKLVQWG  290

Query  949   HGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLY  1128
             HGATG+ ITL KA+QVFPNDRE RDAAIEAGEVVWKSGLVKKVGLADG +GNAYA LSLY
Sbjct  291   HGATGMAITLSKAAQVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLY  350

Query  1129  RLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPH  1308
             RLT ESIY+ERA++F SF+Y NA  +        A+ + YSL QGLAG  CLWFDL+AP 
Sbjct  351   RLTKESIYEERAKSFASFMYDNAKSL--------ASANGYSLSQGLAGTVCLWFDLLAPD  402

Query  1309  NSRFPGYEI  1335
             +SRFPGYE+
Sbjct  403   SSRFPGYEL  411



>ref|XP_003538606.1| PREDICTED: lanC-like protein 2-like isoform X1 [Glycine max]
Length=412

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/430 (67%), Positives = 340/430 (79%), Gaps = 22/430 (5%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRT-VLDPTAPSF-ILPAET--FLQAAVSLKDQVV  225
             M+SS+V        G +      S F T  ++ T+P+  +LP+ET  FL AA+SLKD+VV
Sbjct  1     MTSSVVE------GGRDEGKHEPSDFITETMNLTSPNLSLLPSETETFLSAAISLKDKVV  54

Query  226   DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  405
             + TW  R       +DPTVYTGLLGTA+TCLRS+Q TG R DL LC+DI+DTC +AA A+
Sbjct  55    EETWNRRD----QVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILCSDIIDTCVTAARAS  110

Query  406   IRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYD  585
             +RH+TFLCGRGG+YALGAV ANY  D  KRD +L  FFEVA+E+ALPVGPEEGGFGMSYD
Sbjct  111   LRHVTFLCGRGGVYALGAVVANYMEDLPKRDLFLGLFFEVAKERALPVGPEEGGFGMSYD  170

Query  586   LLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTR  765
             LLYGRAGFLW ALF+ +HLG +AVP + LMP+++A+L GGRAG+SD   CPLMYRWHGTR
Sbjct  171   LLYGRAGFLWGALFVNKHLGDDAVPKDILMPIIDAVLAGGRAGASDVEDCPLMYRWHGTR  230

Query  766   YWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQW  945
             Y GAA+GLAGIL+VLLHFPL  +  EDVKGTLRY+M+ RFPHSGNYP SEGNPRDKLVQW
Sbjct  231   YLGAANGLAGILHVLLHFPLPREDAEDVKGTLRYLMSKRFPHSGNYPSSEGNPRDKLVQW  290

Query  946   CHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSL  1125
              HGATG+ ITL KA+QVFPNDRE RDAAIEAGEVVWKSGLVKKVGLADG +GNAYA LSL
Sbjct  291   GHGATGMAITLSKAAQVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSL  350

Query  1126  YRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAP  1305
             YRLT ESIY+ERA++F SF+Y NA  +        A+ + YSL QGLAG  CLWFDL+AP
Sbjct  351   YRLTKESIYEERAKSFASFMYDNAKSL--------ASANGYSLSQGLAGTVCLWFDLLAP  402

Query  1306  HNSRFPGYEI  1335
              +SRFPGYE+
Sbjct  403   DSSRFPGYEL  412



>ref|XP_004502406.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=412

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/409 (67%), Positives = 334/409 (82%), Gaps = 6/409 (1%)
 Frame = +1

Query  109   HEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYT  288
             H++G       +++PTA +  +P+ETFL+AA+SLKD+VV+++W  R       +DPTVYT
Sbjct  10    HDEGKHESSDLIINPTAVNLSVPSETFLKAAISLKDEVVEVSWNRR-----EVVDPTVYT  64

Query  289   GLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAA  468
             GLLGTA+TCLRS++ TG  +DL LC++IVDTCA+ A A++RH+TFLCGRGG+YALGAV A
Sbjct  65    GLLGTAFTCLRSYEVTGCHKDLLLCSEIVDTCATLARASLRHVTFLCGRGGVYALGAVVA  124

Query  469   NYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  648
             NY GD  KRD +L  F EVA+E+ALP+GPEEGGFGMSYDLLYGRAGFLWAALF+ +HLG 
Sbjct  125   NYMGDLNKRDLFLGLFVEVAKERALPIGPEEGGFGMSYDLLYGRAGFLWAALFVNKHLGE  184

Query  649   EAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS  828
             + VP + LM +++A+L GGRAG+SD   CPLMYRWHGTRY GAA+G+AGIL+VLLHFPL 
Sbjct  185   DTVPKDILMSIIDAVLAGGRAGASDIKDCPLMYRWHGTRYLGAANGVAGILHVLLHFPLP  244

Query  829   EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPND  1008
              +  EDVKGTLRY+++ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFP+D
Sbjct  245   SEDAEDVKGTLRYLISKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAQVFPSD  304

Query  1009  REFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLY  1188
             RE RDAAIEAGEVVWK+GLVKKVGLADG +GNAYA LSLY+LT ++IY ERA++F  FLY
Sbjct  305   RELRDAAIEAGEVVWKNGLVKKVGLADGVSGNAYAFLSLYKLTKDAIYVERAKSFSCFLY  364

Query  1189  HNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              NA  ++A    D    + YSLF GLAG ACLWFDL+AP NSRFPGYE+
Sbjct  365   DNA-RVLAAEGQDVMGANGYSLFHGLAGTACLWFDLLAPANSRFPGYEL  412



>ref|XP_008358138.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL1 [Malus 
domestica]
Length=423

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/429 (68%), Positives = 333/429 (78%), Gaps = 9/429 (2%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             MS  +     PE    +HED N      V DP A +  LP+ TFL+AAV+LKDQVV  TW
Sbjct  1     MSFGVEFALPPE----DHEDANKERLDLV-DPAAKNLSLPSGTFLRAAVALKDQVVQDTW  55

Query  238   KARGGSAV-THM--DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  408
             +   GS   T M  DPTVYTGLLGTA+TCLRS++ATGNRQDL LCADIVD C +  PA+ 
Sbjct  56    EGGXGSGTPTXMVXDPTVYTGLLGTAFTCLRSYEATGNRQDLLLCADIVDKCGAVXPASS  115

Query  409   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  588
             RH+TFLCGRGG+YALGAV A   GD ++   Y + F EVAQEKAL VGPEEGGFGMSYDL
Sbjct  116   RHVTFLCGRGGVYALGAVVACLMGDHERCGLYFNLFLEVAQEKALSVGPEEGGFGMSYDL  175

Query  589   LYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRY  768
             LYGRAG LWAALFI ++LG + +P++ L PVV+A+L GGRAG+S +  CPLMYRWHGTRY
Sbjct  176   LYGRAGXLWAALFINKYLGQDKLPSDLLXPVVDAVLAGGRAGASHDLSCPLMYRWHGTRY  235

Query  769   WGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWC  948
              GAA+G+AGIL VLLHFPL  +  EDVK TLRYMM NRFPHSGNYP SEGNPRDK VQW 
Sbjct  236   LGAANGVAGILQVLLHFPLCNEDAEDVKATLRYMMANRFPHSGNYPSSEGNPRDKFVQWS  295

Query  949   HGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLY  1128
             HGA G+ ITLCKASQV P DREFRDAAIEAGEVVWK+GL+KKVGLADG AGNAYA LSLY
Sbjct  296   HGAAGMAITLCKASQVXPGDREFRDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLY  355

Query  1129  RLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPH  1308
             RLTGESIY+ERA+AF SFLYH AG+     +  G  ++ YSLFQGLAG ACLWFDL  P 
Sbjct  356   RLTGESIYEERAKAFASFLYHXAGEFSIAGRTHG-VEYVYSLFQGLAGTACLWFDLHVPE  414

Query  1309  NSRFPGYEI  1335
             NSRFPGYE+
Sbjct  415   NSRFPGYEL  423



>ref|XP_003552029.2| PREDICTED: lanC-like protein GCL1-like [Glycine max]
Length=452

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/428 (68%), Positives = 338/428 (79%), Gaps = 19/428 (4%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAET--FLQAAVSLKDQVVDM  231
             M+SS+V     E     HE  +       ++ TAP+  LP+ET  FL AA+SLKD+VV+ 
Sbjct  42    MTSSVVEGGRDEGK---HEPSDL--ITETMNLTAPNLSLPSETETFLSAAISLKDKVVEE  96

Query  232   TWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIR  411
             TW  R       +DPTVYTGLLGTA+TCLRS+Q TG R DL L ++I+DTC +AA A++R
Sbjct  97    TWNRRD----QVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILSSEIIDTCVTAARASLR  152

Query  412   HITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLL  591
             H+TFLCGRGG+YALGAV ANY GD QKRD +L  F EVA+E+ALPVGPEEGGFGMSYDLL
Sbjct  153   HVTFLCGRGGVYALGAVVANYMGDLQKRDLFLGLFIEVAKERALPVGPEEGGFGMSYDLL  212

Query  592   YGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYW  771
             YGRAGFLW ALF+ +HLG +AVP + LM +++A+L GGRAG+SD   CPLMYRWHGTRY 
Sbjct  213   YGRAGFLWGALFVNKHLGEDAVPKDILMLIIDAVLAGGRAGASDIKDCPLMYRWHGTRYL  272

Query  772   GAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCH  951
             GAA+GLAGIL+VLLHFPL  +  EDVKGTL Y+M+ RFPHSGNYP SEGNPRDKLVQW H
Sbjct  273   GAANGLAGILHVLLHFPLPSEDAEDVKGTLWYLMSKRFPHSGNYPSSEGNPRDKLVQWGH  332

Query  952   GATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYR  1131
             GATG+ ITL KA++VFPNDRE RDAAIEAGEVVWKSGLVKKVGLADG +GNAYA LSLYR
Sbjct  333   GATGMAITLSKAAEVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLYR  392

Query  1132  LTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHN  1311
             LT ESIY+ERA++F SFLY NA  +        AA + YSLFQGLAG ACLWFDL+AP N
Sbjct  393   LTKESIYEERAKSFASFLYDNAKSL--------AAANGYSLFQGLAGTACLWFDLLAPDN  444

Query  1312  SRFPGYEI  1335
             SRFPGYE+
Sbjct  445   SRFPGYEL  452



>ref|XP_007163665.1| hypothetical protein PHAVU_001G253500g [Phaseolus vulgaris]
 gb|ESW35659.1| hypothetical protein PHAVU_001G253500g [Phaseolus vulgaris]
Length=409

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/427 (67%), Positives = 331/427 (78%), Gaps = 19/427 (4%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGF-RTVLDPTAPSFILPAETFLQAAVSLKDQVVDMT  234
             M+SS+V        G+       S F    ++ TA +  L  ETF +AA SLKD+VV+ T
Sbjct  1     MTSSVVE------GGSEKPKRQPSDFIAETMNLTAENLSLTTETFFRAASSLKDKVVEET  54

Query  235   WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  414
             W  R       +DPTVY+GLLGTA+TCLRS+Q TG R DL LC DIVDTC +AA A++RH
Sbjct  55    WNRRD----QVVDPTVYSGLLGTAFTCLRSYQVTGCRNDLLLCRDIVDTCVTAARASLRH  110

Query  415   ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  594
             +TFLCG GG+Y+LGAV ANY GD  KRD +L  F EVA+EKALPVGPEEGGFGMSYDLLY
Sbjct  111   VTFLCGSGGVYSLGAVVANYMGDLGKRDLFLALFIEVAKEKALPVGPEEGGFGMSYDLLY  170

Query  595   GRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWG  774
             GRAGFLW ALF+ +HLG E+VP + L+P+++A+L GGRAG+SD   CPLMYRWHGTRY G
Sbjct  171   GRAGFLWGALFLNKHLGEESVPKDILIPIIDAVLAGGRAGASDIKNCPLMYRWHGTRYLG  230

Query  775   AAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHG  954
             AA+GLAGIL+VLLHFPL  +  EDVKGTLRY+M+ RFPHSGNYP SEGNPRDKLVQW HG
Sbjct  231   AANGLAGILHVLLHFPLPTEDAEDVKGTLRYLMSKRFPHSGNYPSSEGNPRDKLVQWGHG  290

Query  955   ATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRL  1134
             ATG+ ITL KA+QVFPNDRE RDAAIEAGEVVWKSGLVKKVGLADG +GNAYA LSLY+L
Sbjct  291   ATGMAITLSKAAQVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLYQL  350

Query  1135  TGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNS  1314
             T ESIY ERA++F SFLY NA  +        A  + YSLFQGLAG ACLWFDL AP NS
Sbjct  351   TKESIYLERAKSFASFLYDNAKSL--------APSNGYSLFQGLAGTACLWFDLHAPQNS  402

Query  1315  RFPGYEI  1335
             RFPGYE+
Sbjct  403   RFPGYEL  409



>ref|XP_006591491.1| PREDICTED: lanC-like protein 2-like isoform X2 [Glycine max]
 ref|XP_006591492.1| PREDICTED: lanC-like protein 2-like isoform X3 [Glycine max]
Length=413

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/431 (67%), Positives = 340/431 (79%), Gaps = 23/431 (5%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRT-VLDPTAPSF-ILPAET--FLQAAVSLKDQVV  225
             M+SS+V        G +      S F T  ++ T+P+  +LP+ET  FL AA+SLKD+VV
Sbjct  1     MTSSVVE------GGRDEGKHEPSDFITETMNLTSPNLSLLPSETETFLSAAISLKDKVV  54

Query  226   DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  405
             + TW  R       +DPTVYTGLLGTA+TCLRS+Q TG R DL LC+DI+DTC +AA A+
Sbjct  55    EETWNRRD----QVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILCSDIIDTCVTAARAS  110

Query  406   I-RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSY  582
             + RH+TFLCGRGG+YALGAV ANY  D  KRD +L  FFEVA+E+ALPVGPEEGGFGMSY
Sbjct  111   LSRHVTFLCGRGGVYALGAVVANYMEDLPKRDLFLGLFFEVAKERALPVGPEEGGFGMSY  170

Query  583   DLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGT  762
             DLLYGRAGFLW ALF+ +HLG +AVP + LMP+++A+L GGRAG+SD   CPLMYRWHGT
Sbjct  171   DLLYGRAGFLWGALFVNKHLGDDAVPKDILMPIIDAVLAGGRAGASDVEDCPLMYRWHGT  230

Query  763   RYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQ  942
             RY GAA+GLAGIL+VLLHFPL  +  EDVKGTLRY+M+ RFPHSGNYP SEGNPRDKLVQ
Sbjct  231   RYLGAANGLAGILHVLLHFPLPREDAEDVKGTLRYLMSKRFPHSGNYPSSEGNPRDKLVQ  290

Query  943   WCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLS  1122
             W HGATG+ ITL KA+QVFPNDRE RDAAIEAGEVVWKSGLVKKVGLADG +GNAYA LS
Sbjct  291   WGHGATGMAITLSKAAQVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLS  350

Query  1123  LYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIA  1302
             LYRLT ESIY+ERA++F SF+Y NA  +        A+ + YSL QGLAG  CLWFDL+A
Sbjct  351   LYRLTKESIYEERAKSFASFMYDNAKSL--------ASANGYSLSQGLAGTVCLWFDLLA  402

Query  1303  PHNSRFPGYEI  1335
             P +SRFPGYE+
Sbjct  403   PDSSRFPGYEL  413



>ref|XP_010519354.1| PREDICTED: lanC-like protein GCL1 [Tarenaya hassleriana]
Length=428

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/397 (70%), Positives = 323/397 (81%), Gaps = 7/397 (2%)
 Frame = +1

Query  148   DPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSA-VTHMDPTVYTGLLGTAYTCLRS  324
             DPTA +   P ETFL+AA+ LKDQVV+ TWK  G  +    +DPT YTGLLGTA+TCLRS
Sbjct  38    DPTAQTISFPTETFLRAALLLKDQVVEATWKGGGSGSGAVVLDPTAYTGLLGTAFTCLRS  97

Query  325   FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  504
             ++ T NRQDL  CA+IVDTCA+ A A+ RH+TFLCGRGG+YALGAV  N+ GD  KRD +
Sbjct  98    YEVTRNRQDLLTCAEIVDTCATVARASTRHVTFLCGRGGVYALGAVVYNHIGDHHKRDFF  157

Query  505   LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVV  684
             L  F E+A+E+ALP GPEEGGFGMSYDLLYGRAGFLWAALF+  HLG  +VP++ L P+V
Sbjct  158   LGLFLELAEERALPAGPEEGGFGMSYDLLYGRAGFLWAALFLNHHLGHGSVPDDLLSPIV  217

Query  685   EAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLR  864
              A++ GGR G++DN  CPL+YR+HGTRYWGAA+GLAGIL+V LHF LSE+   DVKGTLR
Sbjct  218   AAVVAGGRVGAADNEACPLLYRFHGTRYWGAANGLAGILHVFLHFRLSEEDANDVKGTLR  277

Query  865   YMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGE  1044
             YMM+NRFP SGNYP SEGNPRDKLVQW HGAT + ITL KASQVFPN+REFRDAAIEAGE
Sbjct  278   YMMSNRFPQSGNYPCSEGNPRDKLVQWAHGATCMAITLSKASQVFPNEREFRDAAIEAGE  337

Query  1045  VVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQG  1224
             VVW +GLVKKVGLADG AGNAYA LSL+RLTG+ IY+ERA AF S+L HNA D++  S+ 
Sbjct  338   VVWNNGLVKKVGLADGVAGNAYAFLSLFRLTGDRIYEERAIAFASYLCHNARDLVENSE-  396

Query  1225  DGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                  HAYSLF+GLAG ACLWFDL+ P +SRFPGYEI
Sbjct  397   -----HAYSLFRGLAGAACLWFDLVRPESSRFPGYEI  428



>ref|XP_010463250.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=435

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/437 (64%), Positives = 346/437 (79%), Gaps = 13/437 (3%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVL-----DPTAPSFILPAETFLQAAVSLKDQV  222
             MSSS V   + +    +  +G ++  +  L     +P+AP+  +P E+FL+AA  LK+QV
Sbjct  1     MSSSAVEFMAEQRRCNDDGNGGETVKKDELGHFLSEPSAPTISIPTESFLRAATLLKNQV  60

Query  223   VDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTC  384
             V+ TWK      A GGS    +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+D C
Sbjct  61    VEATWKGGVEALAPGGSGPV-LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEIIDRC  119

Query  385   ASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEG  564
             A+ A AT RH+TFLCGRGG+YALGA+ ANY GDQ KRD YL  F E+A+E+ LP GPEEG
Sbjct  120   ANVARATTRHVTFLCGRGGVYALGAIVANYRGDQSKRDHYLGLFLELAEERELPAGPEEG  179

Query  565   GFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLM  744
             GFGMSYDLLYGRAGFLW ALF+ ++LG   VP+  L P+V AIL GGR G++D+  CPL+
Sbjct  180   GFGMSYDLLYGRAGFLWGALFLNRYLGEGTVPDHLLSPIVAAILAGGRVGAADHEACPLL  239

Query  745   YRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNP  924
             YR+HGTR+WGAA+GLAGIL VLLHFPLSE+ V+DV+GTLRYMM+NRFP+SGNYP SEGNP
Sbjct  240   YRFHGTRFWGAANGLAGILYVLLHFPLSEEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNP  299

Query  925   RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGN  1104
             RDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIEAGEVVWKSGLVKKVGLADG AGN
Sbjct  300   RDKLVQWAHGATGMAITLAKASQVFPRERDFREAAIEAGEVVWKSGLVKKVGLADGVAGN  359

Query  1105  AYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACL  1284
             AYA LSLYRLTG+ +Y+ERA+AF S+L H+A D++  S+ +  A+H YSLF+GLAG  CL
Sbjct  360   AYAFLSLYRLTGDVVYEERAKAFASYLCHDARDLLDMSRQE-EAEHDYSLFRGLAGPVCL  418

Query  1285  WFDLIAPHNSRFPGYEI  1335
             WFDL++P +S+FPGYEI
Sbjct  419   WFDLVSPVDSKFPGYEI  435



>ref|XP_002866662.1| hypothetical protein ARALYDRAFT_358729 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42921.1| hypothetical protein ARALYDRAFT_358729 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/438 (64%), Positives = 344/438 (79%), Gaps = 16/438 (4%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDG------NDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQ  219
             MSSS V   + +   +N  DG      N      + +P+AP+  LP E+FL+AA  LK+Q
Sbjct  1     MSSSAVESVAEQRIRSNDGDGAGEKIENGELHHLLSEPSAPTIYLPTESFLRAATLLKNQ  60

Query  220   VVDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDT  381
             VV+  WK      A G S V  +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+DT
Sbjct  61    VVEAMWKGVVDVLAPGSSPV--LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEIIDT  118

Query  382   CASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEE  561
             CA+ A AT RH+TFLCGRGG+Y LGA+ ANY GDQ KRD +L  F E+A+ + LP GPEE
Sbjct  119   CANVARATTRHVTFLCGRGGVYTLGAIVANYRGDQSKRDFFLGLFLELAEARELPAGPEE  178

Query  562   GGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPL  741
             GGFGMSYDLLYGRAGFLWAALF+ ++LG   VP+  L P+V AIL GGR G++D+  CPL
Sbjct  179   GGFGMSYDLLYGRAGFLWAALFLNRYLGQGTVPDHLLSPIVAAILAGGRVGAADHEACPL  238

Query  742   MYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN  921
             +YR+HGTR+WGAA+GLAGIL VLLHFPLSE+ V+DV+GTLRYMM+NRFP+SGNYP SEGN
Sbjct  239   LYRFHGTRFWGAANGLAGILYVLLHFPLSEEDVKDVQGTLRYMMSNRFPNSGNYPCSEGN  298

Query  922   PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAG  1101
             PRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIEAGEVVWKSGLVKKVGLADG AG
Sbjct  299   PRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGVAG  358

Query  1102  NAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVAC  1281
             NAYA LSLYRLTG+ +Y+ERA+AF S+L H+A D+M  ++ +  A+H YSLF+GLAG  C
Sbjct  359   NAYAFLSLYRLTGDVLYEERAKAFASYLCHDARDLMNMTRQE--AEHDYSLFRGLAGPVC  416

Query  1282  LWFDLIAPHNSRFPGYEI  1335
             LWFDL++P +SRFPGYEI
Sbjct  417   LWFDLVSPVDSRFPGYEI  434



>ref|XP_003601926.1| G protein-coupled receptor-like protein [Medicago truncatula]
 gb|AES72177.1| G protein coupled receptor [Medicago truncatula]
Length=415

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/398 (69%), Positives = 326/398 (82%), Gaps = 8/398 (2%)
 Frame = +1

Query  145   LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRS  324
             ++PT  +  LP ETFL+AA+SLKD+VV++ W  R       +DPTVYTGLLGTA+TCLRS
Sbjct  25    MNPTVGNLSLPNETFLKAAISLKDEVVEVNWNRR-----EVIDPTVYTGLLGTAFTCLRS  79

Query  325   FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  504
             ++ TG  +DL L ++I+DTCA+ A  ++RH+TFLCGRGGLYALGAV ANY GD QKRD +
Sbjct  80    YEVTGCHKDLVLSSEIIDTCATVARDSLRHVTFLCGRGGLYALGAVVANYMGDLQKRDLF  139

Query  505   LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVV  684
             L  F EVA E+ALPVGPEEGGFGMSYDLLYGRAGFLWAALF+ +HLG + V  + LMP++
Sbjct  140   LGLFMEVANERALPVGPEEGGFGMSYDLLYGRAGFLWAALFLNKHLGEDTVSKDILMPII  199

Query  685   EAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLR  864
             +A+L GGRAG+SD   CPLMYRWHGTRY GAA+GLAGIL+VL+HFPL  +  EDVKGTLR
Sbjct  200   DAVLAGGRAGASDIKDCPLMYRWHGTRYLGAANGLAGILHVLIHFPLPSEYAEDVKGTLR  259

Query  865   YMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGE  1044
             Y+++ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFPNDRE RDAAIEAGE
Sbjct  260   YLISKRFPHSGNYPSSEGNPRDKLVQWSHGATGMAITLSKAAQVFPNDRELRDAAIEAGE  319

Query  1045  VVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQG  1224
             VVWK+GLVKKVGLADG +GNAYA LSLY+LT +SIY+ERA++F  FLY NA  +    +G
Sbjct  320   VVWKNGLVKKVGLADGVSGNAYAFLSLYKLTKDSIYEERAKSFSCFLYDNARALAV--EG  377

Query  1225  DGAAD-HAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                AD + YSLF GLAG ACLWFDLIAP NSRFPGYE+
Sbjct  378   QVVADGNGYSLFHGLAGTACLWFDLIAPDNSRFPGYEL  415



>ref|XP_009150615.1| PREDICTED: lanC-like protein GCL1 [Brassica rapa]
Length=433

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/435 (63%), Positives = 344/435 (79%), Gaps = 6/435 (1%)
 Frame = +1

Query  40    ISKERKMSSSIVHLASPESNGTNHEDGNDSGF--RTVLDPTAPSF-ILPAETFLQAAVSL  210
             +S   + S+         + G  +++G+   F  RT  +P  P+   L  +TFL+AA  L
Sbjct  2     LSSALEFSAEQARCGEDGNGGETNKNGDLDHFILRTSSEPKVPTTSFLSTDTFLRAATLL  61

Query  211   KDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCAS  390
             KDQVV+ TWK  G      +DPTVYTGLLGTA+TCL+S++ T N QDL  CADI+DTCA 
Sbjct  62    KDQVVEATWKG-GPDPGLVLDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCADIIDTCAD  120

Query  391   AAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGF  570
              A AT RH+TFLCGRGG+YALGA+ A+Y GDQ K D +L  F E+A+E+ LP GPEEGGF
Sbjct  121   VARATTRHVTFLCGRGGVYALGAIVASYSGDQSKLDLFLGLFLELAEERELPAGPEEGGF  180

Query  571   GMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYR  750
             GMSYDLLYGRAGFLWAALF+ ++LG   VP+  L P+V AIL GGR G++D+  CPL+YR
Sbjct  181   GMSYDLLYGRAGFLWAALFLNRYLGEGTVPDHLLSPIVAAILSGGRVGAADHQACPLLYR  240

Query  751   WHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRD  930
             +HGTR+WGAA+GLAGIL+VLLHFPLSE+ V+DV+GTLRYMM+NRFP+SGNYP SEGNPRD
Sbjct  241   FHGTRFWGAANGLAGILHVLLHFPLSEEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNPRD  300

Query  931   KLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAY  1110
             KLVQW HGATG+ ITL KASQVFP +R+FR+AAIEAGEVVWKSGLVKKVGLADG AGNAY
Sbjct  301   KLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAY  360

Query  1111  ASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWF  1290
             A LSLYRLTG+ +Y+ERA+AF S+L H+A ++++ + G+  A++ YSLF+GLAG ACLWF
Sbjct  361   AFLSLYRLTGDVVYEERAKAFASYLCHDARELVSATMGE--AEYDYSLFRGLAGPACLWF  418

Query  1291  DLIAPHNSRFPGYEI  1335
             DL++P +S+FPGYEI
Sbjct  419   DLVSPVDSKFPGYEI  433



>ref|XP_010484384.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=434

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/437 (63%), Positives = 345/437 (79%), Gaps = 14/437 (3%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLD-----PTAPSFILPAETFLQAAVSLKDQV  222
             MSSS V   + +    +  +G ++  +  LD     P+AP+  +P E+FL+AA  LK+QV
Sbjct  1     MSSSAVEFVAEQRRCNDDGNGGETVKKDELDHLLSKPSAPTISIPTESFLRAATLLKNQV  60

Query  223   VDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTC  384
             V+ TWK      A  GS    +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+D C
Sbjct  61    VEATWKGGVEALAPAGSGPV-LDPTVYTGLLGTAFTCLKSYEVTMNHQDLLTCAEIIDRC  119

Query  385   ASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEG  564
             A+ A AT RH+TFLCGRGG+YALGA+ ANY G+Q KRD +L  F E+A+E+ALP GPEEG
Sbjct  120   ANVARATTRHVTFLCGRGGVYALGAIVANYRGNQSKRDYFLGLFLELAEERALPAGPEEG  179

Query  565   GFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLM  744
             GFGMSYDLLYGRAGFLW ALF+ ++LG   VP+  L P+V AIL GGR G++D+  CPL+
Sbjct  180   GFGMSYDLLYGRAGFLWGALFLNRYLGEGTVPDPLLSPIVAAILAGGRVGAADHEACPLL  239

Query  745   YRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNP  924
             YR+HGTR+WGAA+GLAGIL VLLHFPL E+ V+DV+GTLRYMM+NRFP+SGNYP SEGNP
Sbjct  240   YRFHGTRFWGAANGLAGILYVLLHFPLWEEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNP  299

Query  925   RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGN  1104
             R+KLVQW HGATG+ ITL KASQVFP +R+FR+AAIEAGEVVWKSGLVKKVGLADG AGN
Sbjct  300   RNKLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGVAGN  359

Query  1105  AYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACL  1284
             AYA LSLYRLTG+ +Y+ERA+AF S+L H+A D++  S+ +  A+H YSLF+GLAG  CL
Sbjct  360   AYAFLSLYRLTGDVVYEERAKAFASYLCHDARDLLDMSRQE--AEHDYSLFRGLAGPVCL  417

Query  1285  WFDLIAPHNSRFPGYEI  1335
             WFDL++P +S+FPGYEI
Sbjct  418   WFDLVSPVDSKFPGYEI  434



>ref|XP_010444546.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=433

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/437 (63%), Positives = 342/437 (78%), Gaps = 15/437 (3%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLD-----PTAPSFILPAETFLQAAVSLKDQV  222
             M SS V   + +    +  +G ++  +  LD     P+AP+  +P E+FL+AA  LK+QV
Sbjct  1     MLSSAVEFVAEQRRCNDDGNGGETVKKDELDHLLSEPSAPTISIPTESFLRAATLLKNQV  60

Query  223   VDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTC  384
             V+ TWK      A G   V  +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+D C
Sbjct  61    VEATWKGGVEALAPGSGLV--LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEIIDRC  118

Query  385   ASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEG  564
             A+ A AT RH+TFLCGRGG+YALGA+ ANY G+Q KRD +L  F E+A+E+ LP GPEEG
Sbjct  119   ANVARATTRHVTFLCGRGGVYALGAIVANYRGNQSKRDHFLGLFLELAEERELPAGPEEG  178

Query  565   GFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLM  744
             GFGMSYDLLYGRAGFLW ALF+ ++LG   VP+  L P+V AIL GGR G++D+  CPL+
Sbjct  179   GFGMSYDLLYGRAGFLWGALFLNRYLGEGTVPDHLLSPIVAAILAGGRVGAADHEACPLL  238

Query  745   YRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNP  924
             YR+HGTR+WGAA+GLAGIL VLLHFPL E+ V+DV+GTLRYMM+NRFP+SGNYP SEGNP
Sbjct  239   YRFHGTRFWGAANGLAGILYVLLHFPLLEEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNP  298

Query  925   RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGN  1104
             RDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIEAGEVVWKSGLVKKVGLADG AGN
Sbjct  299   RDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGVAGN  358

Query  1105  AYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACL  1284
             AYA LSLYRLTG+ +Y+ERA+AF S+L H+A D++  S+ +  A+H YSLF+GLAG  CL
Sbjct  359   AYAFLSLYRLTGDVVYEERAKAFASYLCHDARDLLDMSRQE--AEHDYSLFRGLAGPVCL  416

Query  1285  WFDLIAPHNSRFPGYEI  1335
             WFDL++P +S+FPGY I
Sbjct  417   WFDLVSPVDSKFPGYMI  433



>ref|XP_006280490.1| hypothetical protein CARUB_v10026430mg [Capsella rubella]
 gb|EOA13388.1| hypothetical protein CARUB_v10026430mg [Capsella rubella]
Length=435

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/441 (63%), Positives = 347/441 (79%), Gaps = 21/441 (5%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTV---------LDPTAPSFILPAETFLQAAVSL  210
             MSSS V   + +   ++  DG++ G  TV         ++P+APS  LP E+FL+AA  L
Sbjct  1     MSSSAVEFVAEQRRCSD--DGSNVG-ETVKTGELDHLHMEPSAPSISLPTESFLRAATLL  57

Query  211   KDQVVDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  372
             K+QVV+ TWK      + GGS    +DP+VYTGLLGTA+TCL+S+  T N QDL  CA+I
Sbjct  58    KNQVVEATWKGGVESLSPGGSGAV-LDPSVYTGLLGTAFTCLKSYGVTRNHQDLLTCAEI  116

Query  373   VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  552
             +DTC + A AT RH+TFLCGRGG+YALGA+ ANY GD  KRD +L  F E+A+E+ LP G
Sbjct  117   IDTCVNVARATTRHVTFLCGRGGVYALGAIVANYRGDLSKRDHFLGLFLELAEERELPAG  176

Query  553   PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM  732
             PEEGGFGMSYDLLYGRAGFLWAALF+ ++LG  +VP+  L P+V AIL GGR G++D+  
Sbjct  177   PEEGGFGMSYDLLYGRAGFLWAALFLNRYLGEGSVPDHLLSPIVAAILAGGRVGAADHEA  236

Query  733   CPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVS  912
             CPL+YR+HGTR+WGAA+GLAGIL VLLHF LSE+  +DV+GTLRYMM+NRFP+SGNYP S
Sbjct  237   CPLLYRFHGTRFWGAANGLAGILYVLLHFSLSEEDAKDVQGTLRYMMSNRFPNSGNYPCS  296

Query  913   EGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADG  1092
             EGNPRDKLVQW HGATG+ +TL KASQVFPN+R+FR+AAIEAGEVVWKSGLVKKVGLADG
Sbjct  297   EGNPRDKLVQWAHGATGMAVTLAKASQVFPNERDFREAAIEAGEVVWKSGLVKKVGLADG  356

Query  1093  TAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAG  1272
              AGNAYA LSLYRLTG+ +Y+ERA+AF S+L H+A ++++ ++ +   +H YSLF+GLAG
Sbjct  357   VAGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDAVELVSMTRQE--TEHDYSLFRGLAG  414

Query  1273  VACLWFDLIAPHNSRFPGYEI  1335
               CLW DL++P +S+FPGYEI
Sbjct  415   PVCLWLDLVSPVDSKFPGYEI  435



>ref|XP_010680997.1| PREDICTED: lanC-like protein GCL1 [Beta vulgaris subsp. vulgaris]
Length=433

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/433 (66%), Positives = 334/433 (77%), Gaps = 10/433 (2%)
 Frame = +1

Query  61    SSSIVHLASPESNG--TNHEDGND--SGFRTV---LDPTAPSFILP-AETFLQAAVSLKD  216
             SSSIV +     +G    HE+ N   + F  V      T  S ++P  +TFLQAAV+LK+
Sbjct  3     SSSIVGVGRTSDDGDRNQHEERNQRLNSFVAVDQTQTATNLSQLVPDHQTFLQAAVTLKN  62

Query  217   QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             QVV+MTWK +       +DPTVYTGL+GTA+TC  S+Q T   QDL +CADIV TCA+ A
Sbjct  63    QVVEMTWKEKDKERQA-IDPTVYTGLMGTAFTCFNSYQLTRCHQDLLMCADIVRTCAALA  121

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
               T R++TFL GRGG+YALGAV  N+  D Q    +LD F +VAQE+ALPVGPE+GGFGM
Sbjct  122   -HTSRYVTFLSGRGGIYALGAVIMNHMEDHQSCSHFLDMFMKVAQEEALPVGPEDGGFGM  180

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
             SYDLL GRAGFLWAALFIK+HLG EA+ ++ L PVVEA+L GGRAG+SDN  CPLMYRWH
Sbjct  181   SYDLLCGRAGFLWAALFIKRHLGEEALSSDLLTPVVEAMLAGGRAGASDNPSCPLMYRWH  240

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             GTRY G+AHGLAGIL+VLLHFPLS D  EDVK TLRY+M+ RFP SGNYP S+GNPRD L
Sbjct  241   GTRYLGSAHGLAGILHVLLHFPLSGDDSEDVKKTLRYLMSKRFPESGNYPSSDGNPRDNL  300

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             +QW HGATG+ ITLCKASQVFPN+REFRD AIEAGEVVWKSGLVKK GLADG AGNAYA 
Sbjct  301   IQWSHGATGVAITLCKASQVFPNEREFRDGAIEAGEVVWKSGLVKKAGLADGVAGNAYAF  360

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSLY+LTGE +Y ERA+AF SFLYH   +++   +  G  DHAYSLF GLAGVACL+FDL
Sbjct  361   LSLYKLTGEVVYVERAKAFASFLYHKGSEVVNAEEYPGGTDHAYSLFLGLAGVACLFFDL  420

Query  1297  IAPHNSRFPGYEI  1335
             + P NS+FPGYE+
Sbjct  421   LHPENSKFPGYEL  433



>ref|NP_201331.1| protein GCR2-like 1 [Arabidopsis thaliana]
 sp|Q9FJN7.1|GCL1_ARATH RecName: Full=LanC-like protein GCL1; AltName: Full=G protein-coupled 
receptor 2-like protein 1; Short=Protein GCR2-like 
1 [Arabidopsis thaliana]
 dbj|BAB11664.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
 gb|AAL24184.1| AT5g65280/MQN23_23 [Arabidopsis thaliana]
 gb|AED98033.1| protein GCR2-like 1 [Arabidopsis thaliana]
Length=433

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/440 (63%), Positives = 342/440 (78%), Gaps = 21/440 (5%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRT--------VLDPTAPSFILPAETFLQAAVSLK  213
             MSSS+  +      G   +DGN +G           + +P+AP+  LP E+FL+AA  LK
Sbjct  1     MSSSVDFVTE---QGRCGDDGNGAGETVKNGEIDHLLSEPSAPTISLPTESFLRAATLLK  57

Query  214   DQVVDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  375
             +QVV+ TWK      A G   V  +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+
Sbjct  58    NQVVEATWKGGVEALASGSGPV--LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEII  115

Query  376   DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  555
             DTCA+ A AT RH+TFLCGRGG+  LGA+ ANY GDQ KRD +L  F E+A+E+ LP GP
Sbjct  116   DTCANVARATTRHVTFLCGRGGVCTLGAIVANYRGDQSKRDFFLGLFLELAEERELPAGP  175

Query  556   EEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMC  735
             EEGGFGMSYDLLYGRAGFLWAALF+ ++LG   VP+  L P+V AIL GGR G++D+  C
Sbjct  176   EEGGFGMSYDLLYGRAGFLWAALFLNRYLGQGTVPDHLLSPIVAAILAGGRVGAADHEAC  235

Query  736   PLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSE  915
             PL+YR+HGTR+WGAA+GLAGIL VLLHFPLSE+ V+DV+GTLRYMM+NRFP+SGNYP SE
Sbjct  236   PLLYRFHGTRFWGAANGLAGILYVLLHFPLSEEDVKDVQGTLRYMMSNRFPNSGNYPCSE  295

Query  916   GNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGT  1095
             GNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIEAGEVVWKSGLVKKVGLADG 
Sbjct  296   GNPRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGV  355

Query  1096  AGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGV  1275
             AGNAYA LSLYRLTG+ +Y+ERA+AF S+L  +A +++  +  +   +H YSLF+GLAG 
Sbjct  356   AGNAYAFLSLYRLTGDVVYEERAKAFASYLCRDAIELVNMTSQE--TEHDYSLFRGLAGP  413

Query  1276  ACLWFDLIAPHNSRFPGYEI  1335
              CLWFDL++P +S+FPGYEI
Sbjct  414   VCLWFDLVSPVDSKFPGYEI  433



>ref|XP_006394052.1| hypothetical protein EUTSA_v10004256mg [Eutrema salsugineum]
 gb|ESQ31338.1| hypothetical protein EUTSA_v10004256mg [Eutrema salsugineum]
Length=433

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/435 (64%), Positives = 343/435 (79%), Gaps = 11/435 (3%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSG---------FRTVLDPTAPSFILPAETFLQAAVSL  210
             MSSS V     +    + ++G ++           RT  +PTAP+  L  ETFL+AA  L
Sbjct  1     MSSSAVEFVGEQRRCGDDDNGGETVENGALDHFLLRTSSEPTAPTISLSTETFLRAATLL  60

Query  211   KDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCAS  390
             KD+VV+ TWK         +DPTVYTGLLGTA+TCL+S++ T NRQDL  CA+I++TCA+
Sbjct  61    KDKVVEATWKGGVPGPSLVLDPTVYTGLLGTAFTCLKSYEVTRNRQDLLTCAEIIETCAN  120

Query  391   AAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGF  570
              A AT RH+TFLCGRGG+YALGA+ ANY GDQ KRD +L  F E+A+E+ LP GPEEGGF
Sbjct  121   VARATTRHVTFLCGRGGVYALGAIVANYRGDQSKRDLFLALFLELAEERELPAGPEEGGF  180

Query  571   GMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYR  750
             GMSYDLLYGRAGFLWAALF+ ++LG   VP+  L P++ AIL GGRAG++D+  CPL+YR
Sbjct  181   GMSYDLLYGRAGFLWAALFLNRYLGEGTVPDHLLSPIIAAILSGGRAGAADHQACPLLYR  240

Query  751   WHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRD  930
             +HGTR+WGAA+GLAGIL+VLLHFPLSED VEDV+GTLRYMM+NRFP+SGNYP SEGNPRD
Sbjct  241   FHGTRFWGAANGLAGILHVLLHFPLSEDDVEDVQGTLRYMMSNRFPNSGNYPCSEGNPRD  300

Query  931   KLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAY  1110
             KLVQW HGATG+ ITL KASQVFP + +FR+AAIEAGEVVWKSGLVKKVGLADG AGNAY
Sbjct  301   KLVQWAHGATGMAITLAKASQVFPKEGDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAY  360

Query  1111  ASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWF  1290
             A LSLYRLTG+ +Y+ERA+AF S+L  +A D++  +  +  A+H YSLF+GLAG  CLWF
Sbjct  361   AFLSLYRLTGDVVYEERAKAFASYLCCDARDLVNATMEE--AEHDYSLFRGLAGPVCLWF  418

Query  1291  DLIAPHNSRFPGYEI  1335
             DL++P +S+FPGYEI
Sbjct  419   DLVSPVDSKFPGYEI  433



>gb|AAK96841.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
 gb|AAM91135.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
Length=433

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/440 (63%), Positives = 342/440 (78%), Gaps = 21/440 (5%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRT--------VLDPTAPSFILPAETFLQAAVSLK  213
             MSSS+  +      G   +DGN +G           + +P+AP+  LP E+FL+AA  LK
Sbjct  1     MSSSVDFV---REQGRCGDDGNGAGETVKNGEIDHLLSEPSAPTISLPTESFLRAATLLK  57

Query  214   DQVVDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  375
             +QVV+ TWK      A G   V  +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+
Sbjct  58    NQVVEATWKGGVEALASGSGPV--LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEII  115

Query  376   DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  555
             DTCA+ A AT RH+TFLCGRGG+  LGA+ ANY GDQ KRD +L  F E+A+E+ LP GP
Sbjct  116   DTCANVARATTRHVTFLCGRGGVCTLGAIVANYRGDQSKRDFFLGLFLELAEERELPAGP  175

Query  556   EEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMC  735
             EEGGFGMSYDLLYGRAGFLWAALF+ ++LG   VP+  L P+V AIL GGR G++D+  C
Sbjct  176   EEGGFGMSYDLLYGRAGFLWAALFLNRYLGQGTVPDHLLSPIVAAILAGGRVGAADHEAC  235

Query  736   PLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSE  915
             PL+YR+HGTR+WGAA+GLAGIL VLLHFPLSE+ V+DV+GTLRYMM+NRFP+SGNYP SE
Sbjct  236   PLLYRFHGTRFWGAANGLAGILYVLLHFPLSEEDVKDVQGTLRYMMSNRFPNSGNYPCSE  295

Query  916   GNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGT  1095
             GNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIEAGEVVWKSGLVKKVGLADG 
Sbjct  296   GNPRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGV  355

Query  1096  AGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGV  1275
             AGNAYA LSLYRLTG+ +Y+ERA+AF S+L  +A +++  +  +   +H YSLF+GLAG 
Sbjct  356   AGNAYAFLSLYRLTGDVVYEERAKAFASYLCRDAIELVNMTSQE--TEHDYSLFRGLAGP  413

Query  1276  ACLWFDLIAPHNSRFPGYEI  1335
              CLWFDL++P +S+FPGYEI
Sbjct  414   VCLWFDLVSPVDSKFPGYEI  433



>emb|CDY08803.1| BnaA06g24210D [Brassica napus]
Length=430

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/435 (63%), Positives = 342/435 (79%), Gaps = 9/435 (2%)
 Frame = +1

Query  40    ISKERKMSSSIVHLASPESNGTNHEDGNDSGF--RTVLDPTAPSF-ILPAETFLQAAVSL  210
             +S   + S+         ++G  +++G+   F  RT  +P  P+   L  +TFL+AA  L
Sbjct  2     LSSAVEFSAEQARCGEDGNSGETNKNGDLDHFILRTSSEPKVPTTSFLSTDTFLRAATLL  61

Query  211   KDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCAS  390
             KDQVV+ TWK  G      +DPTVYTGLLGTA+TCL+S++ T N QDL  CADI+DTCA 
Sbjct  62    KDQVVEATWKG-GPDPGLVLDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCADIIDTCAD  120

Query  391   AAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGF  570
              A AT RH+TFLCGRGG+YALGA+ A+Y GDQ K D +L  F E+A+E+ LP GPEEGGF
Sbjct  121   VARATTRHVTFLCGRGGVYALGAIVASYSGDQSKLDLFLGLFLELAEERELPAGPEEGGF  180

Query  571   GMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYR  750
             GMSYDLLYGRAGFLWAALF+ ++LG   VP+  L P+V AIL GGR G++D+  CPL   
Sbjct  181   GMSYDLLYGRAGFLWAALFLNRYLGEGTVPDHLLSPIVAAILSGGRVGAADHQACPL---  237

Query  751   WHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRD  930
             +HGTR+WGAA+GLAGIL+VLLHFPLSE+ V+DV+GTLRYMM+NRFP+SGNYP SEGNPRD
Sbjct  238   FHGTRFWGAANGLAGILHVLLHFPLSEEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNPRD  297

Query  931   KLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAY  1110
             KLVQW HGATG+ ITL KASQVFP +R+FR+AAIEAGEVVWKSGLVKKVGLADG AGNAY
Sbjct  298   KLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAY  357

Query  1111  ASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWF  1290
             A LSLYRLTG+ +Y+ERA+AF S+L H+A ++++ + G+  A+H YSLF+GLAG ACLWF
Sbjct  358   AFLSLYRLTGDVVYEERAKAFASYLCHDARELVSATMGE--AEHDYSLFRGLAGPACLWF  415

Query  1291  DLIAPHNSRFPGYEI  1335
             DL++P +S+FPGYEI
Sbjct  416   DLVSPVDSKFPGYEI  430



>gb|KFK28210.1| hypothetical protein AALP_AA8G486800 [Arabis alpina]
Length=425

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/412 (66%), Positives = 334/412 (81%), Gaps = 8/412 (2%)
 Frame = +1

Query  112   EDGNDSGFRTVL---DPTAPSFI-LPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPT  279
             +DGND    TV+   +P+AP+   L  ETFL+AA  LKDQVV+ TWKAR   +   +DPT
Sbjct  18    DDGNDG--ETVVNGTEPSAPTISSLTTETFLKAATLLKDQVVEATWKARVPDSGLVLDPT  75

Query  280   VYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGA  459
             VYTGLLGTA+TCL+S++ T N QDL  CA+I+DTCA+ A AT RH+TFLCGRGG+YALGA
Sbjct  76    VYTGLLGTAFTCLKSYEITKNHQDLLTCAEIIDTCANVARATTRHVTFLCGRGGVYALGA  135

Query  460   VAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQH  639
             + ANY  DQ K D +L  F E+A+E+ LP G EEGGFGMSYDLLYGRAGFLWAALF+ ++
Sbjct  136   IVANYTRDQPKLDFFLGLFLELAEERELPAGAEEGGFGMSYDLLYGRAGFLWAALFLNRY  195

Query  640   LGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHF  819
             LG   VP+  L P+V AIL GGR G++D++ CPL+YR+HGTR+WGAA+GLAGIL+VLLHF
Sbjct  196   LGEGTVPDHLLSPIVAAILSGGRVGAADHAACPLLYRFHGTRFWGAANGLAGILHVLLHF  255

Query  820   PLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVF  999
              LSE+ V+DV+GTLRYMM+NRFP SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVF
Sbjct  256   KLSEEDVKDVQGTLRYMMSNRFPKSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVF  315

Query  1000  PNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGS  1179
             P +R+FR+AAIEAGEVVWK+GLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF  
Sbjct  316   PKERDFREAAIEAGEVVWKNGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFAG  375

Query  1180  FLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +L  +A D++  ++ +  A H YSLF+GLAG  CLWFDL++P +S+FPGYEI
Sbjct  376   YLCRDARDLVNATRVE--AGHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  425



>gb|KHN31391.1| LanC-like protein 2 [Glycine soja]
Length=419

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/426 (65%), Positives = 326/426 (77%), Gaps = 31/426 (7%)
 Frame = +1

Query  112   EDGNDSG-------FRTVLDPTAPSFILPAET--FLQAAVSLKDQVVDMTWKARGGSAVT  264
             E G D G           ++ TAP+  LP+ET  FL AA+SLKD+VV+ TW  R      
Sbjct  7     EGGRDEGKHEPSDLITETMNLTAPNLSLPSETETFLSAAISLKDKVVEETWNRRD----Q  62

Query  265   HMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI---------RHI  417
              +DPTVYTGLLGTA+TCLRS+Q TG R DL L ++I+DTC +AA A++         +H+
Sbjct  63    VVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILSSEIIDTCVTAARASLSRKVSLKTKKHL  122

Query  418   TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  597
                  RG +YALGAV ANY GD QKRD +L  F EVA+E+ALPVGPEEGGFGMSYDLLYG
Sbjct  123   IHSSSRG-VYALGAVVANYMGDLQKRDLFLGLFIEVAKERALPVGPEEGGFGMSYDLLYG  181

Query  598   RAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGA  777
             RAGFLW ALF+ +HLG +AVP + LM +++A+L GGRAG+SD   CPLMYRWHGTRY GA
Sbjct  182   RAGFLWGALFVNKHLGEDAVPKDILMLIIDAVLAGGRAGASDIKDCPLMYRWHGTRYLGA  241

Query  778   AHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGA  957
             A+GLAGIL+VLLHFPL  +  EDVKGTL Y+M+ RFPHSGNYP SEGNPRDKLVQW HGA
Sbjct  242   ANGLAGILHVLLHFPLPREDAEDVKGTLWYLMSKRFPHSGNYPSSEGNPRDKLVQWGHGA  301

Query  958   TGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLT  1137
             TG+ ITL KA++VFPNDRE RDAAIEAGEVVWKSGLVKKVGLADG +GNAYA LSLYRLT
Sbjct  302   TGMAITLSKAAEVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLT  361

Query  1138  GESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSR  1317
              ESIY+ERA++F SFLY NA  +        AA + YSLFQGLAG ACLWFDL+AP NSR
Sbjct  362   KESIYEERAKSFASFLYDNAKSL--------AAANGYSLFQGLAGTACLWFDLLAPDNSR  413

Query  1318  FPGYEI  1335
             FPGYE+
Sbjct  414   FPGYEL  419



>ref|XP_010937380.1| PREDICTED: lanC-like protein GCL1 [Elaeis guineensis]
Length=414

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/390 (67%), Positives = 312/390 (80%), Gaps = 4/390 (1%)
 Frame = +1

Query  169   ILPA-ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNR  345
             +LP+ E FL+AA+SLKDQV++ TWK  GG     +DPT Y GLLGTA TCLR+++ TG+ 
Sbjct  28    LLPSSEAFLKAAISLKDQVLEATWKGSGGGRC--IDPTAYVGLLGTAITCLRAYEVTGSP  85

Query  346   QDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEV  525
              DLRL A+IVDTC +AA +  R +TFLCGR G+Y LGAVAANY  D Q+R  +LD F EV
Sbjct  86    ADLRLAAEIVDTCTAAARSYRRRVTFLCGRAGVYVLGAVAANYGEDTQRRKLFLDLFLEV  145

Query  526   AQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGG  705
             AQE+ALP+GPEEGG GM Y+LL+GRAGFL+AALFI +HLG  ++P E L PVVEA+L GG
Sbjct  146   AQERALPIGPEEGGLGMPYELLHGRAGFLYAALFINKHLGPGSIPAELLDPVVEAVLAGG  205

Query  706   RAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRF  885
             RAG+SDN  CPLMYRWHGTR+WGAAHGLAGIL+VLLHF L+    EDV+ T+RYM+ NRF
Sbjct  206   RAGASDNPDCPLMYRWHGTRFWGAAHGLAGILHVLLHFRLNGSDREDVRKTVRYMVQNRF  265

Query  886   PHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGL  1065
              HSGNYP SEGNPRDKLVQW HGA G+ I LCKA+QVFP++REFRDAAIEAGEVVWK G 
Sbjct  266   GHSGNYPSSEGNPRDKLVQWSHGAGGVAIMLCKAAQVFPDEREFRDAAIEAGEVVWKRGS  325

Query  1066  VKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHA  1245
              +KVGLADG AGNAYA LSLY+LT E +Y ERA AF   LYHNA  ++A  Q +G  ++ 
Sbjct  326   NQKVGLADGIAGNAYAFLSLYQLTKEKVYLERAEAFAGSLYHNAFKLVARDQVNG-GENT  384

Query  1246  YSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             YSLFQGLAGVACLWFDL+ P ++ FPG+E+
Sbjct  385   YSLFQGLAGVACLWFDLMTPESASFPGFEL  414



>gb|KJB48858.1| hypothetical protein B456_008G090400 [Gossypium raimondii]
Length=391

 Score =   508 bits (1308),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 265/433 (61%), Positives = 308/433 (71%), Gaps = 49/433 (11%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVL--DPT-APSFILPAETFLQAAVSLKDQVVD  228
             MSS +   AS ES    HE+G +      L  DPT + +  L A+TFL+AA++LK+QVV+
Sbjct  1     MSSVMELTASQES----HEEGKNERLDNFLNMDPTLSNTLSLSADTFLKAAMALKNQVVE  56

Query  229   MTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  399
             +TWK RG         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S A 
Sbjct  57    VTWKGRGSGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLLLSAEIVDTCLSVAR  116

Query  400   ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMS  579
             A+ RH+TFLCGRGG+Y+LGAV ANY GD Q  + +L+ F E                   
Sbjct  117   ASPRHVTFLCGRGGVYSLGAVVANYMGDHQSLEFFLNLFIE-------------------  157

Query  580   YDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHG  759
                                HL  E VPN+ LM +V+A+L  GR G+SD   CPLMYRWHG
Sbjct  158   -------------------HLQGEVVPNDVLMLIVDAVLAAGRTGASDLPACPLMYRWHG  198

Query  760   TRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLV  939
             TRYWGAA+GLAGIL+VLLHFPLSE    DVKGTLR+MM NRFPHSGNYP SEGNPRDKLV
Sbjct  199   TRYWGAANGLAGILHVLLHFPLSEGDAGDVKGTLRHMMCNRFPHSGNYPSSEGNPRDKLV  258

Query  940   QWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASL  1119
             QW HGAT + ITL KASQV+PNDREFRDAAIEAGEVVWK+GLVKKVGLADG AGN YA L
Sbjct  259   QWSHGATSMAITLAKASQVYPNDREFRDAAIEAGEVVWKNGLVKKVGLADGIAGNTYAFL  318

Query  1120  SLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG-AADHAYSLFQGLAGVACLWFDL  1296
             SLYRLTGE+IY+ERA+AF SFLYHN   +     G G  AD  YSLFQGLAG ACLWFD+
Sbjct  319   SLYRLTGETIYKERAKAFASFLYHNKRKLAGIEHGGGFGADDGYSLFQGLAGTACLWFDM  378

Query  1297  IAPHNSRFPGYEI  1335
             +APH S+FPGYE+
Sbjct  379   LAPHKSKFPGYEL  391



>gb|ABK24484.1| unknown [Picea sitchensis]
 gb|ACN40165.1| unknown [Picea sitchensis]
Length=427

 Score =   508 bits (1307),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 239/418 (57%), Positives = 310/418 (74%), Gaps = 5/418 (1%)
 Frame = +1

Query  82    ASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAV  261
             A  E+     E  + SG   + +P    +    + FL+ A++LKD+VV  TW  RG    
Sbjct  15    AEAETEKGQSERKDYSGTAILAEPFRELYFPAGDVFLKTALNLKDEVVQSTWTQRGFRC-  73

Query  262   THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGG  441
                DPTVY GL GTA+ C RS Q TGN +DL LC++I+D+CA+ A +   H+TFLCG  G
Sbjct  74    --RDPTVYKGLSGTAFMCFRSHQITGNNEDLALCSEIIDSCAAVARSLRHHVTFLCGEAG  131

Query  442   LYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAA  621
             +YALGAV A Y GD Q++D +L+ F EVAQE+AL VGPE+GGFGM Y+L+YGRAGFLWAA
Sbjct  132   IYALGAVVAKYKGDNQRKDFFLNLFCEVAQERALSVGPEDGGFGMPYELMYGRAGFLWAA  191

Query  622   LFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGIL  801
             LF+ +HLG E +P   L P+V+A+L GGR G+S +++CPLMY+W+GTRYWGAAHGLAGI+
Sbjct  192   LFVNKHLGGETIPWRVLSPIVDAVLAGGRTGAS-HTLCPLMYQWNGTRYWGAAHGLAGIM  250

Query  802   NVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLC  981
             +VLLHFPL+++  +DVKGTL YM+ NRFP SGNYP SEGN RDKLVQWCHGA G+ ++LC
Sbjct  251   HVLLHFPLNKEDADDVKGTLHYMIRNRFPESGNYPSSEGNKRDKLVQWCHGAPGVAMSLC  310

Query  982   KASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQER  1161
             KA+QV P +  FR AA+EAGE+VWK GL++KVGL  G +GNAY  L+LYRLT E +Y  R
Sbjct  311   KAAQVLPGEPVFRQAAVEAGELVWKKGLLRKVGLCHGISGNAYTFLALYRLTKEELYLNR  370

Query  1162  ARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             A+AF  FLY+N   ++A  Q  G  DH YSLF+GLAG ACL+FD++ P ++RFPG+E+
Sbjct  371   AKAFTGFLYNNGRRLIASGQMHG-GDHPYSLFEGLAGTACLYFDMVKPEHARFPGFEL  427



>gb|KCW62074.1| hypothetical protein EUGRSUZ_H04744 [Eucalyptus grandis]
Length=472

 Score =   444 bits (1143),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 211/274 (77%), Positives = 239/274 (87%), Gaps = 1/274 (0%)
 Frame = +1

Query  514   FFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAI  693
             F EVAQE+ALPVGPEEGGFGMSYDLLYGRAGFLWAALF+ ++LG E VPN  LMP+V+A+
Sbjct  200   FHEVAQERALPVGPEEGGFGMSYDLLYGRAGFLWAALFLNKNLGEETVPNNVLMPIVDAV  259

Query  694   LEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMM  873
             L GGRAG+SD + CPLMYRWHGTRY GAA+GLAGIL VLLHFPL E+ +EDVKGTLRY+M
Sbjct  260   LAGGRAGASDIATCPLMYRWHGTRYLGAANGLAGILQVLLHFPLCEEYLEDVKGTLRYIM  319

Query  874   NNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVW  1053
             + RFPHSGNYP SEGNPRDKLVQW HGATG+ ITLCKASQVFP+DR+FRDAAIEAGEVVW
Sbjct  320   SKRFPHSGNYPSSEGNPRDKLVQWSHGATGMAITLCKASQVFPHDRDFRDAAIEAGEVVW  379

Query  1054  KSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGA  1233
             K+GLVKKVGLADG +GNAYA LSLYRLTGE IY++RARAF SFLYH+A   +    G   
Sbjct  380   KNGLVKKVGLADGISGNAYAFLSLYRLTGERIYEDRARAFASFLYHDANKPVGTGHGH-V  438

Query  1234  ADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             AD+A+SL+QGLAG ACLWFDL+   NSRFPGYE+
Sbjct  439   ADYAFSLYQGLAGAACLWFDLVDAENSRFPGYEL  472



>emb|CDY55165.1| BnaCnng28300D [Brassica napus]
Length=303

 Score =   429 bits (1104),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 204/296 (69%), Positives = 251/296 (85%), Gaps = 5/296 (2%)
 Frame = +1

Query  448   ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  627
             ALGA+ A+Y GDQ K D +L  F E+A+E+ LP GPEEGGFGMSYDLLYGRAGFLWAAL 
Sbjct  13    ALGAIVASYSGDQSKLDLFLGLFLELAEERELPAGPEEGGFGMSYDLLYGRAGFLWAALL  72

Query  628   IKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNV  807
             + ++LG   VP+  L+P+VEAIL GGR G++D+  CPL   +HGTR+WGAA+GLAGIL+V
Sbjct  73    LNRYLGEGTVPDHLLLPIVEAILSGGRVGAADHQACPL---FHGTRFWGAANGLAGILHV  129

Query  808   LLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKA  987
             LLHFPLS++ V+DV+GTLRYMM+NRFP+SGNYP SEGN RDKLVQW HGATG+ ITL KA
Sbjct  130   LLHFPLSDEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNRRDKLVQWAHGATGMAITLAKA  189

Query  988   SQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERAR  1167
             SQVFP +R+FR+AAIEAGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+
Sbjct  190   SQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAK  249

Query  1168  AFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             AF S+L H+  ++++ + G+  A+H YSLF+GLAG ACLWFDL++P +S+FPGYEI
Sbjct  250   AFASYLCHDGRELVSATMGE--AEHDYSLFRGLAGPACLWFDLVSPVDSKFPGYEI  303



>ref|XP_001776967.1| predicted protein [Physcomitrella patens]
 gb|EDQ58216.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   429 bits (1102),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 207/389 (53%), Positives = 278/389 (71%), Gaps = 19/389 (5%)
 Frame = +1

Query  169   ILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQ  348
             ++  +T L+ A+S+KD+V+  TW  R G  V+  DP +YTG+LGTA+ C +++Q TG+++
Sbjct  26    VMDPDTLLEVAMSIKDEVIQATW-IRKGRRVS--DPILYTGVLGTAFLCFKAYQITGSKE  82

Query  349   DLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVA  528
             DL LC++IVD+C  AA +  +++TFLCG+ G+YALGA AA   GD+Q    YL  F    
Sbjct  83    DLTLCSEIVDSCTVAAKSLHKYVTFLCGQPGIYALGAAAAKSSGDEQSLHRYLQLF----  138

Query  529   QEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGR  708
                       +GG GM Y+LLYGRAGFLWAALF+ +H+G   +P+ T  P+V+AIL GGR
Sbjct  139   ---------HKGGMGMPYELLYGRAGFLWAALFVNKHVGEGTIPSSTTGPIVDAILAGGR  189

Query  709   AGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFP  888
             AG+S  +  PLMY+WHG+RYWG AHGLAGI++ L+HFPL++   EDVKGTLRYM+  RFP
Sbjct  190   AGAS-QTQSPLMYQWHGSRYWGGAHGLAGIMHTLMHFPLNKKDEEDVKGTLRYMIARRFP  248

Query  889   HSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLV  1068
              SGNYP SEGN  D+LV WCHGA GI +TLCKAS+VFP++ EF+ AA+EAG+VVW  GL+
Sbjct  249   -SGNYPSSEGNATDRLVHWCHGAPGIAMTLCKASKVFPDEMEFQHAAVEAGDVVWSRGLL  307

Query  1069  KKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAY  1248
             +K+GL  G +GN Y  LSLY+ TG   +  RA+ F +FL+ NA  ++   +  G  DH Y
Sbjct  308   RKLGLCHGISGNTYVFLSLYQSTGGKQHLFRAQQFATFLHKNARTLIESGEMHG-GDHPY  366

Query  1249  SLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             SLF+GLAG ACL+FDL  P  +RFP YE+
Sbjct  367   SLFEGLAGTACLFFDLTKPEMARFPAYEL  395



>ref|XP_006829929.2| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL1 [Amborella 
trichopoda]
Length=409

 Score =   427 bits (1098),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 212/384 (55%), Positives = 272/384 (71%), Gaps = 12/384 (3%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTW-KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCAD  369
             +AAV +K++VV+ TW K+ GG+     DPT+YTGLLGTA+TCL S +ATGN +DL++ +D
Sbjct  35    KAAVGMKEEVVENTWRKSEGGTE----DPTLYTGLLGTAFTCLLSHRATGNGEDLQIASD  90

Query  370   IVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPV  549
             IVDTC      T R + FLCGR G+Y LGA+ ANY  DQ +R+ +L+ F EV +E+ALP 
Sbjct  91    IVDTCTVVVRTTKRRVAFLCGRAGVYVLGAMVANYRDDQYRRELFLNLFCEVVEERALPA  150

Query  550   GPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNS  729
             GP EG  GM Y+LL+G AGFLW+ALFI +HLG   +P   LMP+VEA++ GGR G++ ++
Sbjct  151   GPGEGVLGMPYELLFGWAGFLWSALFINKHLGDGTIPQSLLMPIVEAVISGGRIGAT-HT  209

Query  730   MCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPV  909
              CPLMY+WHGT YWGAA  LAGI++VLLHFPLS   + DV GTL YM+ NR PHS NYP 
Sbjct  210   TCPLMYQWHGTHYWGAAQDLAGIMHVLLHFPLSXQDLSDVNGTLTYMIKNRLPHSKNYPS  269

Query  910   SEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK--VGL  1083
             S+GN RD LVQW  G  G+ + LCKA+ VF ND  FR   I+A EVV K G+ +   + L
Sbjct  270   SQGNGRDSLVQWSRGVGGVCLALCKAAXVFGNDARFRATPIDASEVVLKKGVGQNCLLSL  329

Query  1084  ADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQG  1263
              D  +GNAYA LS++RLTGE ++ ERA+AFG ++      +M G+Q  G  D  YSLFQG
Sbjct  330   GDSESGNAYAFLSVHRLTGEEVHLERAKAFGGWVSQK---LMIGAQSQG-GDKPYSLFQG  385

Query  1264  LAGVACLWFDLIAPHNSRFPGYEI  1335
             L G ACL FDL  P  SRFPG+E+
Sbjct  386   LTGAACLCFDLSTPMASRFPGFEL  409



>ref|XP_006591493.1| PREDICTED: lanC-like protein 2-like isoform X4 [Glycine max]
Length=350

 Score =   423 bits (1087),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/271 (74%), Positives = 230/271 (85%), Gaps = 8/271 (3%)
 Frame = +1

Query  523   VAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEG  702
             VA+E+ALPVGPEEGGFGMSYDLLYGRAGFLW ALF+ +HLG +AVP + LMP+++A+L G
Sbjct  88    VAKERALPVGPEEGGFGMSYDLLYGRAGFLWGALFVNKHLGDDAVPKDILMPIIDAVLAG  147

Query  703   GRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNR  882
             GRAG+SD   CPLMYRWHGTRY GAA+GLAGIL+VLLHFPL  +  EDVKGTLRY+M+ R
Sbjct  148   GRAGASDVEDCPLMYRWHGTRYLGAANGLAGILHVLLHFPLPREDAEDVKGTLRYLMSKR  207

Query  883   FPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSG  1062
             FPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFPNDRE RDAAIEAGEVVWKSG
Sbjct  208   FPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAQVFPNDRELRDAAIEAGEVVWKSG  267

Query  1063  LVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADH  1242
             LVKKVGLADG +GNAYA LSLYRLT ESIY+ERA++F SF+Y NA  +        A+ +
Sbjct  268   LVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASFMYDNAKSL--------ASAN  319

Query  1243  AYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              YSL QGLAG  CLWFDL+AP +SRFPGYE+
Sbjct  320   GYSLSQGLAGTVCLWFDLLAPDSSRFPGYEL  350



>ref|XP_002966453.1| hypothetical protein SELMODRAFT_86123 [Selaginella moellendorffii]
 gb|EFJ32480.1| hypothetical protein SELMODRAFT_86123 [Selaginella moellendorffii]
Length=421

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 212/385 (55%), Positives = 278/385 (72%), Gaps = 18/385 (5%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  360
             E  L++A++LKD++V +TW  RGG+ V   DP  YTG+LGTAY CL+SF+ T  ++DL L
Sbjct  55    EKLLKSALALKDEIVQVTW-GRGGTRVK--DPIFYTGVLGTAYLCLKSFEVTQKKEDLAL  111

Query  361   CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  540
             C++I+D CA+AA +  +++TF+CG+ G+YALG VAA   GDQQ+ D YL+ F EV     
Sbjct  112   CSEIIDHCAAAAQSMKQYVTFICGQPGIYALGMVAAKSRGDQQRVDFYLNLFEEVY----  167

Query  541   LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSS  720
                    GG GM Y+LLYGRAGFLWA+LF+  H+G+E +P  T  P+V+AIL  GRAG+S
Sbjct  168   -------GGLGMPYELLYGRAGFLWASLFVNMHIGNETIPWTTTGPIVDAILAAGRAGAS  220

Query  721   DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGN  900
              +S CPLMY+WHGTRYWGAAHGLAGI+ VL+HF LS     DVK TL YM+ NRF  SGN
Sbjct  221   QSS-CPLMYQWHGTRYWGAAHGLAGIMYVLMHFALSARDAADVKETLLYMIANRF-QSGN  278

Query  901   YPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVG  1080
             YP S+GN RDKL+ WCHGA GI +TLCKA++VFP +  FR+AA+ AGE++WK GL+++VG
Sbjct  279   YPSSDGNQRDKLIHWCHGAPGICLTLCKAAKVFP-EPVFREAAVAAGELIWKKGLLRRVG  337

Query  1081  LADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQ  1260
             L  G +GN Y  L+LYRLTG+  +  RAR+F +FL +   +++      G  DH YSLF+
Sbjct  338   LCHGVSGNTYPFLALYRLTGDRKHLFRARSFATFLCNQGRELIDSGDMHG-GDHPYSLFE  396

Query  1261  GLAGVACLWFDLIAPHNSRFPGYEI  1335
             GLAG A LW DL  P  +RFPGYE+
Sbjct  397   GLAGTAFLWLDLQRPEEARFPGYEL  421



>ref|XP_003601927.1| G protein-coupled receptor-like protein [Medicago truncatula]
 gb|AES72178.1| G protein coupled receptor [Medicago truncatula]
Length=318

 Score =   415 bits (1067),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 193/285 (68%), Positives = 233/285 (82%), Gaps = 5/285 (2%)
 Frame = +1

Query  145  LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRS  324
            ++PT  +  LP ETFL+AA+SLKD+VV++ W  R       +DPTVYTGLLGTA+TCLRS
Sbjct  25   MNPTVGNLSLPNETFLKAAISLKDEVVEVNWNRR-----EVIDPTVYTGLLGTAFTCLRS  79

Query  325  FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  504
            ++ TG  +DL L ++I+DTCA+ A  ++RH+TFLCGRGGLYALGAV ANY GD QKRD +
Sbjct  80   YEVTGCHKDLVLSSEIIDTCATVARDSLRHVTFLCGRGGLYALGAVVANYMGDLQKRDLF  139

Query  505  LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVV  684
            L  F EVA E+ALPVGPEEGGFGMSYDLLYGRAGFLWAALF+ +HLG + V  + LMP++
Sbjct  140  LGLFMEVANERALPVGPEEGGFGMSYDLLYGRAGFLWAALFLNKHLGEDTVSKDILMPII  199

Query  685  EAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLR  864
            +A+L GGRAG+SD   CPLMYRWHGTRY GAA+GLAGIL+VL+HFPL  +  EDVKGTLR
Sbjct  200  DAVLAGGRAGASDIKDCPLMYRWHGTRYLGAANGLAGILHVLIHFPLPSEYAEDVKGTLR  259

Query  865  YMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVF  999
            Y+++ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QV 
Sbjct  260  YLISKRFPHSGNYPSSEGNPRDKLVQWSHGATGMAITLSKAAQVI  304



>ref|XP_001758715.1| predicted protein [Physcomitrella patens]
 gb|EDQ76693.1| predicted protein [Physcomitrella patens]
Length=407

 Score =   418 bits (1074),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 207/391 (53%), Positives = 278/391 (71%), Gaps = 20/391 (5%)
 Frame = +1

Query  163   SFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGN  342
             SF  P+   L+AA++L+D+V++ TW  R G  V+  DPT+Y G+LGTA+ C +  Q TG+
Sbjct  37    SFSEPS-VVLKAAIALRDEVLEATW-IRHGPRVS--DPTMYVGMLGTAFLCFKVHQTTGS  92

Query  343   RQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFE  522
              +DL +C +IVD+CA AA +  +++TFLCG+ G+YALGA AA   GDQ++ D YL  F  
Sbjct  93    IEDLDICCNIVDSCAVAAESMKQYVTFLCGQSGIYALGAAAAKCKGDQKRLDWYLSLF--  150

Query  523   VAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEG  702
                          GG GM Y+L+YGRAGFLWAALF+ +++G E +P     PVV+A++  
Sbjct  151   -----------NAGGLGMPYELMYGRAGFLWAALFVNKYVGEETIPWSVTGPVVDAVMAA  199

Query  703   GRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNR  882
             GRAG+S ++ CPLMY+W GTRYWGAAHGLAGI++VL+HFPL+ + ++DVKGTLRYM+  R
Sbjct  200   GRAGAS-HTQCPLMYQWQGTRYWGAAHGLAGIMHVLMHFPLNHEDMKDVKGTLRYMIKGR  258

Query  883   FPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSG  1062
             F  SGNYP SEG+ RD+LV WC+GA G+ +TLCKA+QV+P  ++F+ AAIEAGEVVWK G
Sbjct  259   FS-SGNYPSSEGSTRDRLVHWCYGAPGMALTLCKAAQVYPECKDFKLAAIEAGEVVWKRG  317

Query  1063  LVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADH  1242
             L++++GL  G +GNAY  L+LYRL GE  +  RA  FG FL+ NA  ++   +  G  DH
Sbjct  318   LLRRLGLCHGISGNAYVFLALYRLCGEKKHLFRAHQFGKFLHKNAKQLIRNGEMHG-GDH  376

Query  1243  AYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              YSL++G AG ACLW DL     SRFPGYE 
Sbjct  377   GYSLYEGWAGTACLWLDLAGADASRFPGYEF  407



>ref|XP_004141231.1| PREDICTED: lanC-like protein GCR2 [Cucumis sativus]
 gb|KGN55144.1| hypothetical protein Csa_4G638330 [Cucumis sativus]
Length=412

 Score =   370 bits (949),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 189/381 (50%), Positives = 253/381 (66%), Gaps = 19/381 (5%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  372
             QAA++LK+ VV  TW   G       D T+YTG LGTA+  L+SF  + N  DL+LC++I
Sbjct  51    QAALNLKETVVRETWTLSGRHP---QDNTLYTGALGTAFLALKSFFVSKNENDLKLCSEI  107

Query  373   VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  552
             V  C S +  T RH+TF+CGR G+ ALGAVAA +  D +  D YL  F ++     LP  
Sbjct  108   VTACESLS-KTSRHVTFICGRAGVCALGAVAAKFANDGRLVDHYLAKFKDIKLPSDLP--  164

Query  553   PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM  732
                       +LLYGRAGFLWA LF+ +H+G   + N  +  VV+ ++E GR    + S 
Sbjct  165   ---------NELLYGRAGFLWACLFLNKHIGQNTISNNFMRSVVDEVIEAGRT-LGEKSK  214

Query  733   CPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVS  912
              PLMY WHG +YWGAAHGLAGI++VL+   L  D VEDVK TLRYM+ NRFP SGNYP S
Sbjct  215   SPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEDVKNTLRYMIKNRFP-SGNYPSS  273

Query  913   EGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADG  1092
             EG+  D+LV WCHGA G+ +TL KA++VF +D EF  AAI+AGEVVW  GL+K+VG+  G
Sbjct  274   EGSESDRLVHWCHGAPGVALTLGKAAEVFGDD-EFLQAAIDAGEVVWNRGLLKRVGICHG  332

Query  1093  TAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAG  1272
              +GN Y  LSLYRLTG+ +Y  RA+AF  FL+ NA  +++  +   + D  YSLF+G+ G
Sbjct  333   ISGNTYVFLSLYRLTGDLMYLHRAKAFACFLHQNAEKLISEGKMH-SGDRPYSLFEGIGG  391

Query  1273  VACLWFDLIAPHNSRFPGYEI  1335
             +A L+FD++ P+ ++FP YE+
Sbjct  392   MAYLFFDMVEPNAAKFPSYEL  412



>ref|XP_010462143.1| PREDICTED: lanC-like protein GCR2 [Camelina sativa]
Length=412

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 254/386 (66%), Gaps = 18/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++   + A+SLKD VV  TW+ R G  V   D ++YTG+LGTA+   +S+Q T N  DL+
Sbjct  45    SKKLQRLALSLKDTVVSETWE-RSGKRVR--DYSLYTGVLGTAHLLFKSYQVTRNEDDLK  101

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC +IVD C  A+  + R +TF+CG  G+ ALGAVAA + GD Q RD YL  F E+    
Sbjct  102   LCLEIVDACYVASRDSERVVTFICGHVGVCALGAVAAKHLGDDQLRDRYLARFNEIRLPC  161

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP           Y+LLYGRAG+LW+ LF+ +H+G E+V +  +  VVE I  GGR   
Sbjct  162   DLP-----------YELLYGRAGYLWSCLFLNKHIGQESVSSARMRSVVEEIFRGGRQLG  210

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                S CPLMY WHG RYWGAAHG AGI+NVL+H  L  D V+DVK TL YM+ NRFP SG
Sbjct  211   KRGS-CPLMYEWHGKRYWGAAHGSAGIMNVLMHMELEPDEVQDVKCTLSYMIQNRFP-SG  268

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA+QVF   +EF +AA+EAGEVVW  GL+K+V
Sbjct  269   NYPSSEGSESDRLVHWCHGAPGVALTLVKAAQVFKT-KEFVEAAMEAGEVVWNRGLLKRV  327

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GN Y  LSLYRLTG+  Y  RA+AF SFL   +  +++  +  G  D  +SLF
Sbjct  328   GICHGISGNTYVFLSLYRLTGKPEYLFRAKAFASFLLDRSEKLISEGKMHG-GDGPFSLF  386

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G+ G+A ++ D+  P  + FPGYE+
Sbjct  387   EGIGGMAYMFLDMNDPRQAVFPGYEL  412



>ref|XP_002894411.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70670.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 198/410 (48%), Positives = 263/410 (64%), Gaps = 23/410 (6%)
 Frame = +1

Query  118   GNDSGFRTVLDPTAPSFILPAETF---LQA-AVSLKDQVVDMTWKARGGSAVTHMDPTVY  285
             G D       D       LP ++F   LQ+ A+SLKD+VV  TW+ R G  V   D  +Y
Sbjct  20    GEDETVTAGKDSLTKLLSLPYKSFSEKLQSYALSLKDKVVWETWE-RSGKRVR--DYKLY  76

Query  286   TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  465
             TG+LGTAY   +S+Q T N  DL+LC +IV+ C  A+  + R +TF+CG  G+ ALGAVA
Sbjct  77    TGVLGTAYLLFKSYQVTRNEDDLKLCLEIVEACDVASRDSER-VTFICGHAGVCALGAVA  135

Query  466   ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  645
             A + GD Q  D YL  F  +     LP           Y+LLYGRAG+LWA LF+ +H+G
Sbjct  136   AKHLGDNQLLDRYLARFRGIRLPSYLP-----------YELLYGRAGYLWACLFLNKHIG  184

Query  646   SEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPL  825
              ++V +E +  VVE I   GR    +   CPLMY WHG RYWGAAHGLAGI+NVL+H  L
Sbjct  185   KDSVSSERMRSVVEEIFRAGRQ-LGNRGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHMEL  243

Query  826   SEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPN  1005
              +D ++DVKGTL YM+ NRFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QVF  
Sbjct  244   EQDEIKDVKGTLSYMIQNRFP-SGNYLSSEGSESDRLVHWCHGAPGVALTLVKAAQVFKT  302

Query  1006  DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFL  1185
              +EF +AA+EAGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG++ Y  RA+AF SFL
Sbjct  303   -KEFVEAAMEAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKAEYLYRAKAFASFL  361

Query  1186  YHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                +  +++  +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  362   LDKSEKLISEGKMHG-GDRPFSLFEGIGGMAYMFLDMNDPTQALFPGYEL  410



>ref|XP_010500915.1| PREDICTED: lanC-like protein GCR2 [Camelina sativa]
Length=411

 Score =   367 bits (943),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 198/419 (47%), Positives = 265/419 (63%), Gaps = 25/419 (6%)
 Frame = +1

Query  88    PESNGTNHED---GNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSA  258
             PE +  + E    G DS  R +  P   SF   ++   + A+SLKD VV  TW+ R G  
Sbjct  15    PEESAGDEETVAGGKDSLTRLLSLPYK-SF---SKKLQRLALSLKDTVVLETWE-RSGKR  69

Query  259   VTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRG  438
             V   D ++YTG+LGTA+   +S+Q T N  DL+LC +IV+ C  A+  + R +TF+CG  
Sbjct  70    VR--DYSLYTGVLGTAHLLFKSYQVTKNEDDLKLCLEIVEACYVASIDSKRVVTFICGHA  127

Query  439   GLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWA  618
             G+ ALGAVAA + GD+Q  D YL  F E+     LP           Y+LLYGRAG+LW+
Sbjct  128   GVCALGAVAAKHLGDEQLCDRYLARFSEIRIPSDLP-----------YELLYGRAGYLWS  176

Query  619   ALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGI  798
              LF+ +H+G E V +  +  VVE I   GR      S CPLMY WHG RYWGAAHGLAGI
Sbjct  177   CLFMNKHIGQECVSSAKMRSVVEEIFRAGRQLGKRGS-CPLMYEWHGKRYWGAAHGLAGI  235

Query  799   LNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITL  978
             +NVL+H  L  D ++DVKGTL YM+ NRFP SGNYP SEG+  D+L  WCHGA G+ +TL
Sbjct  236   MNVLMHMELEPDEIQDVKGTLSYMIQNRFP-SGNYPSSEGSESDRLFHWCHGAPGVALTL  294

Query  979   CKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQE  1158
              KA+QVF   +EF +AA+EAGEVVW  GL+K++G+  G +GN Y  LSLYRLT +  Y  
Sbjct  295   VKAAQVFKT-KEFIEAAMEAGEVVWNRGLLKRLGICHGISGNTYVFLSLYRLTEKPEYLY  353

Query  1159  RARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             RA+AF SFL   +  +++  +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  354   RAKAFASFLLEKSEKLISEGKMHG-GDRPFSLFEGIGGMAYMFLDMNDPRQAVFPGYEL  411



>gb|KDO74125.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=407

 Score =   365 bits (937),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 251/386 (65%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++T   +A++LK  VV+ TW   G       D T+YTG LGTAY   +++Q T N  +L+
Sbjct  41    SDTLKNSALALKQTVVNETWGVSGKRV---QDYTLYTGALGTAYLLFKAYQVTKNDNELK  97

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC DIV+ C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F E+    
Sbjct  98    LCCDIVEACDSASRDSGR-VTFICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPS  156

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGR GFLWA  F+ +H+G + +    +  VV+ I++ GR   
Sbjct  157   DLP-----------NELLYGRVGFLWACSFLNKHMGKDTISTAQMRAVVDEIIKAGRR-L  204

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             ++   CPLMY WHG +YWGAAHGLAGI++VL+   L  D VEDVKGTLRYM+ NRFP SG
Sbjct  205   ANRGRCPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEDVKGTLRYMIKNRFP-SG  263

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA++VF  ++EF  AA++AGEVVWK GL+K+V
Sbjct  264   NYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVF-GEKEFLQAAVDAGEVVWKRGLLKRV  322

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GN Y  LSLYRLTG   Y  RA+AF  FLY  A  ++A  +  G  D  YSLF
Sbjct  323   GICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLYDRAQKLIAEGKMHG-GDRPYSLF  381

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G+ G+  L+ D+I P  +RFP YE+
Sbjct  382   EGIGGMTHLFLDMIEPSEARFPAYEL  407



>ref|XP_006464716.1| PREDICTED: lanC-like protein GCR2-like [Citrus sinensis]
Length=407

 Score =   365 bits (937),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 251/386 (65%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++T   +A++LK  VV+ TW   G       D T+YTG LGTAY   +++Q T N  +L+
Sbjct  41    SDTLKNSALALKQTVVNETWGVSGKRV---QDYTLYTGALGTAYLLFKAYQVTKNDNELK  97

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC DIV+ C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F E+    
Sbjct  98    LCCDIVEACDSASRDSGR-VTFICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPS  156

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGR GFLWA  F+ +H+G + +    +  VV+ I++ GR   
Sbjct  157   DLP-----------NELLYGRVGFLWACSFLNKHMGKDTISTAQMRAVVDEIIKAGRR-L  204

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             ++   CPLMY WHG +YWGAAHGLAGI++VL+   L  D VEDVKGTLRYM+ NRFP SG
Sbjct  205   ANRGRCPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEDVKGTLRYMIKNRFP-SG  263

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA++VF  ++EF  AA++AGEVVWK GL+K+V
Sbjct  264   NYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVF-GEKEFLQAAVDAGEVVWKRGLLKQV  322

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GN Y  LSLYRLTG   Y  RA+AF  FLY  A  ++A  +  G  D  YSLF
Sbjct  323   GICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLYDRAQKLIAEGKMHG-GDRPYSLF  381

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G+ G+  L+ D+I P  +RFP YE+
Sbjct  382   EGIGGMTHLFLDMIEPSEARFPAYEL  407



>ref|XP_002284781.1| PREDICTED: lanC-like protein GCR2 [Vitis vinifera]
 emb|CBI20338.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   365 bits (936),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 189/415 (46%), Positives = 263/415 (63%), Gaps = 23/415 (6%)
 Frame = +1

Query  91    ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHM  270
             E+  T+ ++  DS  + +  P    +   ++ F +AA+ +KD VV  TW   G       
Sbjct  16    EAEETSAQNSGDSLIKLLSFP----YETLSQQFERAALDVKDAVVRETWALAGKRV---Q  68

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D  +YTG LGTA+   +++Q T NR DL +C++IV  C SA+ AT   +TF+CG+ G+YA
Sbjct  69    DYALYTGALGTAFLLFKAYQITNNRDDLNVCSEIVKACDSAS-ATSGRVTFICGQAGVYA  127

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAVAA + GD++    YL  F E+   K LP            +LLYGR GFLWA  F+
Sbjct  128   IGAVAAKHAGDERLLGRYLTQFKEIKLPKDLP-----------NELLYGRGGFLWACSFL  176

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVL  810
              +H+G + + +  +   V+ I++ GR   +    CPLMY WHG +YWGAAHGLAG+++VL
Sbjct  177   NKHIGKDTISSARMRASVKEIIKSGRE-MAKRERCPLMYEWHGKKYWGAAHGLAGVMHVL  235

Query  811   LHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKAS  990
             +H  L  D VEDVKGTLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA+
Sbjct  236   MHMELKPDEVEDVKGTLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLLKAA  294

Query  991   QVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARA  1170
             +VF  D+EF  AA++AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG   +  RA+A
Sbjct  295   EVF-GDKEFLQAAVDAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGNVEFLYRAKA  353

Query  1171  FGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F  FL   A  +++  +  G  D  YSLF+G+ G+  L+ D+I P  +RFPGYE+
Sbjct  354   FACFLLDRAQRLISEGKMHG-GDRPYSLFEGIGGMTYLFLDMIEPSEARFPGYEL  407



>ref|XP_006303704.1| hypothetical protein CARUB_v10011802mg [Capsella rubella]
 gb|EOA36602.1| hypothetical protein CARUB_v10011802mg [Capsella rubella]
Length=410

 Score =   364 bits (935),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 197/430 (46%), Positives = 263/430 (61%), Gaps = 23/430 (5%)
 Frame = +1

Query  49    ERKMSSSIVHLASPESNGTNHE-DGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVV  225
             ER   + +      ES G      G       +L     SF   ++   + A+SLKD  V
Sbjct  3     ERFFRNEMPEFVPEESTGDEEAVSGGKDSLTKLLSLPYKSF---SKKLHRLALSLKDTAV  59

Query  226   DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  405
               TW+ R G  V   D ++YTG+LGTAY   +S+Q T N+ DL+LC +IV+ C  A+  +
Sbjct  60    LETWE-RSGKRVR--DYSLYTGVLGTAYLMFKSYQVTRNKDDLKLCLEIVEACDVASRDS  116

Query  406   IRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYD  585
              R +TF+CG  G+ ALGAVAA + GD Q RD YL  F E+     LP           Y+
Sbjct  117   ER-VTFICGHAGVCALGAVAAKHLGDDQLRDRYLACFSEIRLPSDLP-----------YE  164

Query  586   LLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTR  765
             LLYGR+G+LW+ LF+ +H+G E+VP+  +  V E I   GR      S CPLMY WHG +
Sbjct  165   LLYGRSGYLWSCLFLNKHIGQESVPSTRMRSVGEEIFRAGRQLGKRGS-CPLMYEWHGKK  223

Query  766   YWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQW  945
             YWGAAHGLAGI+NVL+H  L  D ++DVKGTL YM+ NRF  SGNYP SEG+  D+LV W
Sbjct  224   YWGAAHGLAGIMNVLMHMELEPDEIQDVKGTLTYMIQNRFS-SGNYPSSEGSESDRLVHW  282

Query  946   CHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSL  1125
             CHGA G+ +TL KA+QVF   +EF +AA+EAGEVVW  GL+K+ G+  G  GN Y  LSL
Sbjct  283   CHGAPGVALTLVKAAQVFKT-KEFVEAAMEAGEVVWNRGLLKRAGICHGITGNTYVFLSL  341

Query  1126  YRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAP  1305
             YRLTG+  Y  RA+AF SFL   +   ++  +  G  D  +SLF+G+ G+A ++ D+  P
Sbjct  342   YRLTGKPEYLYRAKAFASFLMDKSEKFISEGKMHG-GDRPFSLFEGIGGMAYMFLDMNDP  400

Query  1306  HNSRFPGYEI  1335
               + FPGYE+
Sbjct  401   RQAVFPGYEL  410



>gb|ACU17850.1| unknown [Glycine max]
Length=231

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 195/233 (84%), Gaps = 8/233 (3%)
 Frame = +1

Query  574   MSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRW  753
             MSYDLLYGRAGFLW ALF+ +HLG +AVP + LMP+++A+L GGRAG+SD   CPLMYRW
Sbjct  1     MSYDLLYGRAGFLWGALFVNKHLGDDAVPKDILMPIIDAVLAGGRAGASDVEDCPLMYRW  60

Query  754   HGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDK  933
             HGTRY GAA+GLAGIL+VLLHFPL  +  EDVKGTLRY+M+ RFPHSGNYP SEGNPRDK
Sbjct  61    HGTRYLGAANGLAGILHVLLHFPLPREDAEDVKGTLRYLMSKRFPHSGNYPSSEGNPRDK  120

Query  934   LVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYA  1113
             LVQW HGATG+ ITL KA+QVFPNDRE RDAAIEAGEVVWKSGLVKKVGLADG +GNAYA
Sbjct  121   LVQWGHGATGMAITLSKAAQVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYA  180

Query  1114  SLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAG  1272
              LSLYRLT ESIY+ERA++F SF+Y NA  +        A+ + YSL QGLAG
Sbjct  181   FLSLYRLTKESIYEERAKSFASFMYDNAKSL--------ASANGYSLSQGLAG  225



>ref|XP_007021343.1| G protein coupled receptor [Theobroma cacao]
 gb|EOY12868.1| G protein coupled receptor [Theobroma cacao]
Length=406

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/403 (48%), Positives = 257/403 (64%), Gaps = 23/403 (6%)
 Frame = +1

Query  139   TVLDPTAPSFILPAETF----LQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTA  306
             T  D       LP +TF      +A+ LK+ VV  TW+  G       D T+YTG LGTA
Sbjct  23    TTRDSLTKLLSLPYKTFSDKLKTSALDLKETVVRETWRLSGKRV---QDYTLYTGALGTA  79

Query  307   YTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQ  486
             Y    ++Q T N  DL+LC+DIV  C SA+  + R +TF+CGR G+ ALGAV A + GD+
Sbjct  80    YLVFNAYQVTKNENDLKLCSDIVKACDSASKDSGR-VTFICGRAGVCALGAVIAKHSGDE  138

Query  487   QKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNE  666
             + +D YL  F E+     LP            +LLYGRAGFLWA  F+ +H+G + +   
Sbjct  139   RLQDRYLRKFKEIRFPSDLP-----------NELLYGRAGFLWACSFLNKHIGKDTISTI  187

Query  667   TLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVED  846
              +  VV+ I++ G+   +    CPLMY WHG +YWGAAHGLAGI++VL+   L  D VED
Sbjct  188   RMRAVVDEIIKSGKQ-LAGKGRCPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVED  246

Query  847   VKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDA  1026
             VKGTLRYM+ +R+P +GNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D+EF  A
Sbjct  247   VKGTLRYMIKSRYP-TGNYPSSEGSESDRLVHWCHGAPGVTLTLVKAAEVF-GDKEFLQA  304

Query  1027  AIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDI  1206
             A++AGEVVWK GL+K+VG+  G +GNAY  LSLYRLTG+  Y  RA+AF SFL   A  +
Sbjct  305   AVDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKVEYLYRAKAFASFLSDRAQKL  364

Query  1207  MAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             ++  +  G  D  YSLF+G+ G+A L+ D+  P  +RFP YEI
Sbjct  365   ISERKMHG-GDRPYSLFEGIGGMAYLFLDMGEPSEARFPAYEI  406



>gb|KFK35758.1| hypothetical protein AALP_AA4G032600 [Arabis alpina]
Length=403

 Score =   363 bits (931),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 199/426 (47%), Positives = 259/426 (61%), Gaps = 23/426 (5%)
 Frame = +1

Query  58    MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
             M         PES    +  G DS    +L     SF   +E   + A+SLKD VV  TW
Sbjct  1     MGERFFRYELPESVPEKYA-GEDS-MTKLLSLPYKSF---SEKLQKYALSLKDTVVLETW  55

Query  238   KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  417
             + R G  V   D  +YTG+LGTAY   +S+  T N  DL+LC +IV  C   A      +
Sbjct  56    E-RCGKRVR--DYNMYTGVLGTAYLLFKSYLVTSNEDDLKLCLEIVQACDVVASRDSERV  112

Query  418   TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  597
             TFLCG  G+ +LGAV A   GD Q +D YL  F E+     LP           Y+LLYG
Sbjct  113   TFLCGYAGVCSLGAVVAKCIGDDQLQDRYLTRFREIRLPSDLP-----------YELLYG  161

Query  598   RAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGA  777
             R G+LWA LF+ +++G ++V +  +  +VE I  GGR        CPLMY WHG +YWGA
Sbjct  162   RVGYLWACLFLNKYIGKDSVSSARMRFLVEEIFRGGRQLGKRGE-CPLMYEWHGKKYWGA  220

Query  778   AHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGA  957
             AHGLAGI+ VL+H  L  D +EDVKGTLRYM+ NRFP SGNYP SEGN  D+LV WCHGA
Sbjct  221   AHGLAGIMYVLMHMELELDEIEDVKGTLRYMIQNRFP-SGNYPSSEGNESDRLVHWCHGA  279

Query  958   TGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLT  1137
              G+ +TL KA+QVF   +EF +AA+EAGEVVW  GL+K+VG+  G +GN Y  LSLYRLT
Sbjct  280   PGVALTLIKAAQVF-GTQEFVEAAMEAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLT  338

Query  1138  GESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSR  1317
             G+  Y  RA+AF SFL   +  ++A  +  G  D  +SLF+G+ G++ ++ D+I P  + 
Sbjct  339   GKPEYLYRAKAFASFLLDKSEKLIAEGKMHG-GDRPFSLFEGIGGMSYMFLDMIDPTQAL  397

Query  1318  FPGYEI  1335
             FPGYE+
Sbjct  398   FPGYEL  403



>ref|XP_010099009.1| hypothetical protein L484_025669 [Morus notabilis]
 gb|EXB76311.1| hypothetical protein L484_025669 [Morus notabilis]
Length=409

 Score =   362 bits (928),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 254/401 (63%), Gaps = 23/401 (6%)
 Frame = +1

Query  145   LDPTAPSFILPAETF----LQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYT  312
             +DP      LP +TF      +A+ LKD VV  TW   G       D TVYTG LGTAY 
Sbjct  28    VDPLTKLLSLPYKTFSDSLRSSALELKDTVVRETWVLSGKRV---QDYTVYTGALGTAYL  84

Query  313   CLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQK  492
               +++Q T N  DL+LC +IV  C SA+  + R +TFLCGR  + ALGAVAA + GD++ 
Sbjct  85    AFKAYQVTKNANDLKLCLEIVKACDSASRDSSR-VTFLCGRASVCALGAVAAKHAGDERL  143

Query  493   RDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETL  672
                Y+  F E+     LP            +LLYGRAGFLWA+ FI  H+G+  + N   
Sbjct  144   LGHYITQFKEIKLSSDLP-----------NELLYGRAGFLWASSFINHHIGNGTISNTLR  192

Query  673   MPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVK  852
               VV+ I++ GR  +     CPLMY WHG +YWGAAHGLAGI++VL+   L  D  EDVK
Sbjct  193   RSVVDEIIKAGRKLAKKGK-CPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKSDEAEDVK  251

Query  853   GTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  1032
             GTLRYM+ N FP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D++F  AA+
Sbjct  252   GTLRYMIKNCFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLVKAAEVF-EDKQFLQAAM  309

Query  1033  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  1212
             +AG+VVW+ GL+K+VG+  G +GNAY  L+LYRLTG+  Y  +A+AF  FL+  A  +++
Sbjct  310   DAGDVVWERGLLKRVGICHGISGNAYVFLALYRLTGKVEYLYKAKAFACFLHDRARKLIS  369

Query  1213  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               +  G  DH YSLF+G+ G+A L+ D+  P  +RFP YE+
Sbjct  370   EGRMHG-GDHPYSLFEGIGGMAHLFLDMTEPSEARFPAYEL  409



>gb|EYU26400.1| hypothetical protein MIMGU_mgv1a007259mg [Erythranthe guttata]
Length=413

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/386 (48%), Positives = 262/386 (68%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             +E   ++A+ LKD VV  TW  +G       D ++YTG LGTA+   +S+Q TG++ +L 
Sbjct  47    SERLKKSALDLKDTVVKETWVCKGKRVGG--DYSLYTGALGTAFLLFKSYQITGDKNNLS  104

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC+DI+  C SA+ ++ R +TF+CG+GG+YALGAVAA++ GD+Q R+ Y+  F E+   K
Sbjct  105   LCSDIIKACDSASQSSQR-VTFVCGQGGVYALGAVAAHHNGDEQLRNRYITRFKEIKLSK  163

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGRAGFLWA+ F+ +++G+  + +  +  VV+ I++ GR  +
Sbjct  164   DLPD-----------ELLYGRAGFLWASSFMNKNIGANTISSIRMRAVVDEIIKSGRNLA  212

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
               N  CPLM+ WHG +YWG AHGLAGI+NVL+   L+ D V+ VKGTL YM+ NRF  SG
Sbjct  213   KGN--CPLMFEWHGKKYWGGAHGLAGIMNVLMDMELNRDEVDYVKGTLHYMIKNRF-ESG  269

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA++VF ++ EF  AAIEAGEVVWK GL+K+V
Sbjct  270   NYPSSEGSENDRLVHWCHGAPGVALTLAKAAKVFGSE-EFMQAAIEAGEVVWKRGLLKRV  328

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAY  LSLY+LTG+S +  +A+AF  FLY  A  +++     G  D  YSLF
Sbjct  329   GICHGISGNAYVFLSLYQLTGKSEFLYKAKAFACFLYDRAQKLVSEGVMHG-GDRPYSLF  387

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G+ G+A L+ D+I P  +RFP +E+
Sbjct  388   EGIGGMAYLFLDIIEPSQARFPVFEL  413



>ref|XP_006451926.1| hypothetical protein CICLE_v10008488mg [Citrus clementina]
 gb|ESR65166.1| hypothetical protein CICLE_v10008488mg [Citrus clementina]
Length=407

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 249/386 (65%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++T   +A++LK  VV+ TW   G       D T+YTG LGTAY   +++Q T N  +L+
Sbjct  41    SDTLKNSALALKQTVVNETWGVSGKRV---QDYTLYTGALGTAYLLFKAYQVTKNDNELK  97

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC DIV  C SA+  +   +TF+CGR G+ ALGAV A + GD++  D YL  F E+    
Sbjct  98    LCCDIVKACDSASRDS-GCVTFICGRAGVCALGAVLAKHAGDERLLDLYLTKFKEIKLPS  156

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGR GFLWA  F+ +H+G + +    +  VV+ I++ GR   
Sbjct  157   DLP-----------NELLYGRVGFLWACSFLNKHIGKDTISTAQMRAVVDEIIKAGRR-L  204

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             ++   CPLMY WHG +YWGAAHGLAGI++VL+   L  D VEDVKGTLRYM+ NRFP SG
Sbjct  205   ANRGRCPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDQVEDVKGTLRYMIKNRFP-SG  263

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA++VF  ++EF  AA++AGEVVWK GL+K+V
Sbjct  264   NYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVF-GEKEFLQAAVDAGEVVWKRGLLKRV  322

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GN Y  LSLYRLTG   Y  RA+AF  FLY  A  ++A  +  G  D  YSLF
Sbjct  323   GICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLYDRAQKLIAEGKMHG-GDRPYSLF  381

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G+ G+  L+ D+I P  +RFP YE+
Sbjct  382   EGIGGMTHLFLDMIEPSEARFPAYEL  407



>ref|XP_012084921.1| PREDICTED: lanC-like protein GCR2 [Jatropha curcas]
 gb|KDP27026.1| hypothetical protein JCGZ_20961 [Jatropha curcas]
Length=408

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 248/385 (64%), Gaps = 19/385 (5%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  360
             E   ++A+ +KD VV  TW   G S     D T+YTG+LGTAY   +++Q T N  DL+L
Sbjct  43    ERLKRSALDIKDTVVRETW---GLSGKRVQDYTIYTGMLGTAYLLFKAYQVTKNYNDLKL  99

Query  361   CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  540
             C+DIV  C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F E+     
Sbjct  100   CSDIVMACDSASRGSGR-VTFICGRAGVCALGAVTAKHAGDERLLDLYLTQFKEIKLPSD  158

Query  541   LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSS  720
             LP           Y+LLYGRAGFLW+  F+ +H+G E + +      V+ I+E G+   S
Sbjct  159   LP-----------YELLYGRAGFLWSCSFLNKHIGKETISSSCRRAAVDEIIEAGKK-LS  206

Query  721   DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGN  900
                 CPLMY WHG +Y GAAHG+AGI++VL+   L +D +E VK TLRYM+  RFP SGN
Sbjct  207   HKGKCPLMYEWHGKKYLGAAHGMAGIMHVLMDMELKQDEIEAVKSTLRYMIETRFP-SGN  265

Query  901   YPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVG  1080
             YP SEGN  D+LV WCHGA G+ +TL KA++VF  D+EF  AAI+AGEVVW  GL+++VG
Sbjct  266   YPSSEGNESDRLVHWCHGAPGVALTLVKAAEVF-GDKEFLQAAIDAGEVVWNRGLLRRVG  324

Query  1081  LADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQ  1260
             +  G +GN Y   SLYRLTG + Y  RA+AF  FL+  A  ++   +  G  D  YSLF+
Sbjct  325   ICHGISGNTYVFFSLYRLTGRAEYLYRAKAFACFLHDKAQKLILEGKMHG-GDRPYSLFE  383

Query  1261  GLAGVACLWFDLIAPHNSRFPGYEI  1335
             G+ G+A L+FD+I P  +RFP YE+
Sbjct  384   GIGGMAYLFFDMIEPSEARFPAYEL  408



>ref|XP_010234867.1| PREDICTED: lanC-like protein GCR2 isoform X1 [Brachypodium distachyon]
Length=477

 Score =   363 bits (931),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 189/388 (49%), Positives = 248/388 (64%), Gaps = 19/388 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++  L+AA+ LKD+VV+ TW   GG      D T+YTG LGTA    +SFQ  G+R+DL 
Sbjct  107   SDRLLRAALRLKDKVVEETWTKAGGHVT---DYTLYTGALGTALLLFKSFQVNGDRRDLT  163

Query  358   LCADIVDTCASAAPATIRH-ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQE  534
             L  +IV  C  A+    R  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   
Sbjct  164   LAGEIVQACDLASNGLPRRFLTFICGRAGVCALGAVIAKHCNDQLMVTHYLSSFDEITVT  223

Query  535   KALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAG  714
               +P            +LLYGRAG+LWA LF+ +HL  + +P E +  V + I++ GR  
Sbjct  224   DKVP-----------NELLYGRAGYLWACLFLNEHLSEKTIPAEHISSVAKDIIKEGRKL  272

Query  715   SS-DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPH  891
             S+ D   CPLMY WHG +YWGAAHGL GI++VL+H  L  D  +DVK TLRYM++ R+P 
Sbjct  273   SNKDKGSCPLMYEWHGKKYWGAAHGLTGIMHVLMHTELKLDEQDDVKNTLRYMISKRYP-  331

Query  892   SGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVK  1071
             SGNYP SEG+  D+LV WCHGA G+ +TLCKA QVF +D  F+ +A EAGEVVW  GL+K
Sbjct  332   SGNYPSSEGSGSDRLVHWCHGAPGVALTLCKAYQVFHDD-HFKQSAAEAGEVVWNRGLLK  390

Query  1072  KVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYS  1251
             +VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL  +A  ++A     G  DH +S
Sbjct  391   RVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEDADRLIAEEAMHG-GDHPFS  449

Query  1252  LFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             LF+G AG+A    D++ P+ SRFP YE+
Sbjct  450   LFEGKAGMAYFLLDMVNPYESRFPAYEL  477



>ref|XP_002517941.1| catalytic, putative [Ricinus communis]
 gb|EEF44459.1| catalytic, putative [Ricinus communis]
Length=410

 Score =   360 bits (925),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/387 (49%), Positives = 252/387 (65%), Gaps = 20/387 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++ F +A + LK+ +V  TW   G S     D T+Y+G LG+A+   +S+Q T N+ DL 
Sbjct  43    SQRFQRAGLDLKETIVMETWGLSGQSV---QDFTLYSGTLGSAFLIFKSYQVTNNKNDLF  99

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC  IV  C SA+PA+ R +TFLCGR G+ ALGAVAA Y  DQ  ++ YL+ F EV   K
Sbjct  100   LCLQIVKACDSASPAS-RDVTFLCGRAGVCALGAVAAKYANDQDLQNYYLNQFGEVKLSK  158

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
               P            +LLYGR+G+LWA LFI +H+G   +P+ T+  V   I++ GRA +
Sbjct  159   NHPD-----------ELLYGRSGYLWACLFINKHIGEGTIPHTTIRAVTVEIIKNGRALA  207

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                  CPLMY W+G RYWGAAHGLAGI++VL+   L  D VEDVKGTL+YM+NNRFP SG
Sbjct  208   KKGG-CPLMYEWYGERYWGAAHGLAGIMHVLMDAELKLDEVEDVKGTLKYMINNRFP-SG  265

Query  898   NYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             NYP SE +  RD LV WCHGA GI +TL KA QVF  D+EF  AA++A E+VW  GL+K+
Sbjct  266   NYPASEEDWKRDVLVHWCHGAPGIALTLVKAVQVF-GDKEFLQAAVDAAEIVWNRGLLKR  324

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+  G +GN Y  L+LYR+TG   +  RA+AF SFL   A  +++  +  G  D  YSL
Sbjct  325   VGICHGISGNTYVFLALYRMTGSIEFLYRAKAFASFLLDRAHKLISAGEMHG-GDSPYSL  383

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F+G+ G+A L+ D+I P  +RFP YE+
Sbjct  384   FEGIGGMAYLFLDMIDPSKARFPAYEL  410



>gb|KJB84324.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=407

 Score =   360 bits (924),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 189/380 (50%), Positives = 249/380 (66%), Gaps = 19/380 (5%)
 Frame = +1

Query  196   AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  375
             AA++LK+ VV  TW   G S     D T+YTG LGTAY   +++Q T N  DL+LC+DIV
Sbjct  47    AALALKETVVRETW---GLSGKRVQDYTLYTGALGTAYLVFKAYQVTKNDNDLKLCSDIV  103

Query  376   DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  555
               C SA+  + R +TF+CGR G+YALGAV A + GD   +  YL+ F E+     LP   
Sbjct  104   KACDSASKDSGR-VTFICGRAGVYALGAVIAKHSGDTSLQQRYLEKFKEIRFPSDLP---  159

Query  556   EEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMC  735
                     ++LLYGRAGFLWA  F+ +H+G + +    +  VV+ I+E G+   +    C
Sbjct  160   --------HELLYGRAGFLWACSFLNKHIGKDTISTARIRAVVDEIIESGKR-LAGKGRC  210

Query  736   PLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSE  915
             PLMY WHG +YWGAAHGLAGI++VL+   L  D  E VKGTLRY++ NRFP SGNYP SE
Sbjct  211   PLMYEWHGKKYWGAAHGLAGIIHVLMDTELKPDEAEYVKGTLRYIIKNRFP-SGNYPSSE  269

Query  916   GNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGT  1095
             G+  D+LV WCHGA GI +TL KA++VF  D+EF  AA++AGEVVWK GL+K+VG+  G 
Sbjct  270   GSESDRLVHWCHGAPGITLTLVKAAEVF-GDKEFLQAALDAGEVVWKRGLLKRVGICHGI  328

Query  1096  AGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGV  1275
             +GNAY  LSLYRLTG   Y  RA+AF SFL   A  +++  +  G  D  YSLF+G+ G+
Sbjct  329   SGNAYVFLSLYRLTGNVEYLYRAKAFTSFLSDRAEKLISQGKMHG-GDRPYSLFEGIGGM  387

Query  1276  ACLWFDLIAPHNSRFPGYEI  1335
             A L+ D++    +RFP YEI
Sbjct  388   AHLFLDMVKASEARFPAYEI  407



>ref|XP_010245303.1| PREDICTED: lanC-like protein GCL2 [Nelumbo nucifera]
Length=420

 Score =   360 bits (923),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 197/437 (45%), Positives = 266/437 (61%), Gaps = 26/437 (6%)
 Frame = +1

Query  37    NISKERKMSSSIVHLASP----ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAV  204
             NI ++R+M+        P    E+      +G     R +L    P+    AE F + A+
Sbjct  6     NIKRKREMADRFFPNEMPDFVAETTEETAPEGVGDSLRKLLSLPYPTV---AEKFKRTAL  62

Query  205   SLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTC  384
              LK+ +V  TW   G S     D T+YTG LGTA+   +++Q T N+ DL LC++IV  C
Sbjct  63    DLKETIVTNTW---GFSRRRLSDFTLYTGALGTAFLLFKAYQVTKNKNDLNLCSEIVKAC  119

Query  385   ASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEG  564
              SA+  + +++TF+CGR G+ ALGAV A + GD++    YL  F E+     +P      
Sbjct  120   DSASSGS-KYVTFICGRAGVCALGAVIAKHAGDERLLSYYLTQFKEIKLPNDVP------  172

Query  565   GFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLM  744
                   +LLYGRAGFLWA  F+ +H+G   +P+    PVV  I++ GR  S+  S CPLM
Sbjct  173   -----NELLYGRAGFLWACSFLNKHIGEGTIPSTRTGPVVNEIIKDGRRLSNKGS-CPLM  226

Query  745   YRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNP  924
             + WHG +YWGAAHGLAGI++VL+   L  D  EDVKGTLRYM+ NRF  SGNYP SEG+ 
Sbjct  227   FEWHGKKYWGAAHGLAGIMHVLMGMELKPDEQEDVKGTLRYMIKNRF-SSGNYPSSEGSD  285

Query  925   RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGN  1104
              D+LV WCHGA G+ +TL KA++VF  D EF  AA  AGEV+WK GL+K+VG+  G +GN
Sbjct  286   NDRLVHWCHGAPGVTLTLVKAAEVFGGD-EFLKAAEAAGEVIWKRGLLKRVGICHGISGN  344

Query  1105  AYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACL  1284
             AY  LSLYR TG   Y  RARAF  FL   A  +++  +  G  D  YSLF+G+ G+A L
Sbjct  345   AYTFLSLYRQTGNVEYLYRARAFACFLLDRANRLISEGKMHG-GDRPYSLFEGIGGMAYL  403

Query  1285  WFDLIAPHNSRFPGYEI  1335
             + D+I P  +RFP YE+
Sbjct  404   FLDMIEPAEARFPAYEL  420



>ref|XP_006370294.1| hypothetical protein POPTR_0001s41360g [Populus trichocarpa]
 gb|ERP66863.1| hypothetical protein POPTR_0001s41360g [Populus trichocarpa]
Length=412

 Score =   359 bits (922),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 199/434 (46%), Positives = 262/434 (60%), Gaps = 23/434 (5%)
 Frame = +1

Query  34    GNISKERKMSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLK  213
             G+ S   +M   I    +   + T  E  N      +L  + P  IL ++    +A+ +K
Sbjct  2     GDRSFPNEMPDYIPETTTTAVDETVTERNNKDSLTNLL--SLPYNIL-SQRLKASALDVK  58

Query  214   DQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASA  393
             D VV  TW   G S     D ++YTG LGTAY   +++Q T N+ DL LC+DI+  C S 
Sbjct  59    DTVVRETW---GMSGKRVKDYSLYTGALGTAYLLFKAYQVTKNQNDLNLCSDIIKACDSV  115

Query  394   APATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFG  573
             +  + R +TF+CGR G+ ALGAVAA + GD +  D YL  F E+     LP         
Sbjct  116   SRDSGR-VTFICGRAGVCALGAVAAKHAGDGRLLDHYLAQFKEIKLPSDLP---------  165

Query  574   MSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRW  753
               Y+LLYGRAGFLWA  F+ +H+G E +       VV+ I++ GR   +    CPL+Y W
Sbjct  166   --YELLYGRAGFLWACSFLNKHIGKETISTSRKRAVVDEIIKAGRL--TRKGKCPLLYEW  221

Query  754   HGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDK  933
             HG RYWGAAHGLAGI+ VL+   L+ D VEDVKGTL YM+ N FP SGNYP SEGN  D 
Sbjct  222   HGKRYWGAAHGLAGIMLVLMDLELTPDEVEDVKGTLHYMIKNHFP-SGNYPSSEGNKSDC  280

Query  934   LVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYA  1113
             LV WCHGA GI +TL KA++VF  D+EF  AA+EAGEVVW  GL+K+VG+  G +GN Y 
Sbjct  281   LVHWCHGAPGIALTLAKAAEVF-GDKEFLQAAMEAGEVVWNRGLLKRVGICHGISGNTYV  339

Query  1114  SLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFD  1293
              LSLYRLTG   Y  RA+AF  FL+  A  +++  +  G  D  YSLF+G  G+A L+ D
Sbjct  340   FLSLYRLTGNVEYLYRAKAFACFLHDRAQKLVSEGKMHG-GDRPYSLFEGFGGMAYLFLD  398

Query  1294  LIAPHNSRFPGYEI  1335
             ++ P  +RFP YE+
Sbjct  399   ILEPSEARFPAYEL  412



>gb|ERM95223.1| hypothetical protein AMTR_s00009p00267750 [Amborella trichopoda]
Length=374

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 250/389 (64%), Gaps = 16/389 (4%)
 Frame = +1

Query  169   ILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQ  348
             +L    + +  +  + ++V  TW   GG      D T+YTG LGTAY   +++Q T N+ 
Sbjct  1     MLSLLVYQELPIDSEKEIVKETWVNCGGRV---KDTTLYTGALGTAYLLFKAYQVTNNKD  57

Query  349   DLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVA  528
             DL LC +I+ +C  ++      +TF+CG+ G+YALGAVAA   GDQ   D YL  F    
Sbjct  58    DLSLCTEIIASCDVSSRGMREDVTFICGQAGIYALGAVAAKCIGDQSLLDRYLSLF----  113

Query  529   QEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGR  708
               + +P   E   + + Y+LLYGR+GFLWA  F+ QH+G   + ++   P+V+ I + GR
Sbjct  114   --RKIPKRIES--YDIPYELLYGRSGFLWACAFLNQHIGPGTISSDVTAPIVKDIFKEGR  169

Query  709   AGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFP  888
               S     CPL+Y WHG +YWGAAHGLAGI++VL+HF LS    EDVKGTLRYMM NRFP
Sbjct  170   RLSHGG--CPLVYVWHGKKYWGAAHGLAGIMHVLMHFELSAREEEDVKGTLRYMMQNRFP  227

Query  889   HSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLV  1068
              SGNYP SEG+  D+LV WCHGA G+ +T+C+A Q F  D+EF DAA++A +VVWK GL+
Sbjct  228   -SGNYPSSEGSTTDRLVHWCHGAPGVALTMCRAVQAF-GDKEFMDAAVDATDVVWKRGLL  285

Query  1069  KKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAY  1248
             ++VG+  G +GNAY  L+LYRL G+  Y  +A+AF  FL    G +++  +  G  D + 
Sbjct  286   RRVGICHGVSGNAYVFLALYRLLGKEEYLYKAKAFACFLLDCGGRLISSGEMHG-GDRSL  344

Query  1249  SLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             SLF+G+AG A L+ D+  P +SRFP YE+
Sbjct  345   SLFEGMAGTAHLFLDMTKPSDSRFPAYEL  373



>ref|XP_011042485.1| PREDICTED: lanC-like protein GCR2 [Populus euphratica]
 ref|XP_011013677.1| PREDICTED: lanC-like protein GCR2 [Populus euphratica]
Length=412

 Score =   359 bits (921),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 198/427 (46%), Positives = 259/427 (61%), Gaps = 23/427 (5%)
 Frame = +1

Query  55    KMSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMT  234
             +M   I    +   + T  E  N      +L  + P  IL ++    +A+ +KD VV  T
Sbjct  9     EMPDYIPETTTTAVDETVTERNNKDSLTKLL--SLPYNIL-SQRLKASALDVKDTVVRET  65

Query  235   WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  414
             W   G S     D ++YTG LGTAY  L+++Q T N+ DL LC+DI+  C S +  + R 
Sbjct  66    W---GMSGKRVKDYSLYTGALGTAYLLLKAYQVTKNQNDLNLCSDIIKACDSVSRDSGR-  121

Query  415   ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  594
             +TF+CGR G+ ALGAVAA + GD +  D YL  F E+     LP           Y+LLY
Sbjct  122   VTFICGRAGVCALGAVAAKHAGDGRLLDHYLAQFKEIKLPSDLP-----------YELLY  170

Query  595   GRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWG  774
             GRAGFLWA  F+ +H+G E +       VV+ I++ GR        CPL+Y WHG RYWG
Sbjct  171   GRAGFLWACSFLNKHIGKETISTSRKRAVVDEIIKAGRL--IRKGKCPLLYEWHGKRYWG  228

Query  775   AAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHG  954
             AAHGLAGI+ VL+   L+ D VEDVKGTL YM+ N FP SGNYP SEGN  D LV WCHG
Sbjct  229   AAHGLAGIMLVLMDLELTPDEVEDVKGTLHYMIKNHFP-SGNYPSSEGNKSDCLVHWCHG  287

Query  955   ATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRL  1134
             A GI +TL KA++VF  D+EF  AA+EAGEVVW  GL+K+VG+  G +GN Y  +SLYRL
Sbjct  288   APGIALTLAKAAEVF-GDKEFLQAAMEAGEVVWNRGLLKRVGICHGISGNTYVFVSLYRL  346

Query  1135  TGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNS  1314
             TG   Y  RA+AF  FLY  A  +++  +  G  D  YSLF+G  G+A L+ D++ P  +
Sbjct  347   TGNVEYLYRAKAFACFLYDRAQKLVSEGKMHG-GDRPYSLFEGFGGMAYLFLDILEPSEA  405

Query  1315  RFPGYEI  1335
             RFP YE+
Sbjct  406   RFPAYEL  412



>ref|XP_003574129.2| PREDICTED: lanC-like protein GCR2 isoform X2 [Brachypodium distachyon]
Length=475

 Score =   361 bits (926),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/387 (49%), Positives = 248/387 (64%), Gaps = 19/387 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++  L+AA+ LKD+VV+ TW   GG      D T+YTG LGTA    +SFQ  G+R+DL 
Sbjct  107   SDRLLRAALRLKDKVVEETWTKAGGHVT---DYTLYTGALGTALLLFKSFQVNGDRRDLT  163

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             L  +IV  C  A+   +  +TF+CGR G+ ALGAV A +C DQ     YL  F E+    
Sbjct  164   LAGEIVQACDLASNG-LPFLTFICGRAGVCALGAVIAKHCNDQLMVTHYLSSFDEITVTD  222

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGRAG+LWA LF+ +HL  + +P E +  V + I++ GR  S
Sbjct  223   KVP-----------NELLYGRAGYLWACLFLNEHLSEKTIPAEHISSVAKDIIKEGRKLS  271

Query  718   S-DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHS  894
             + D   CPLMY WHG +YWGAAHGL GI++VL+H  L  D  +DVK TLRYM++ R+P S
Sbjct  272   NKDKGSCPLMYEWHGKKYWGAAHGLTGIMHVLMHTELKLDEQDDVKNTLRYMISKRYP-S  330

Query  895   GNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             GNYP SEG+  D+LV WCHGA G+ +TLCKA QVF +D  F+ +A EAGEVVW  GL+K+
Sbjct  331   GNYPSSEGSGSDRLVHWCHGAPGVALTLCKAYQVFHDD-HFKQSAAEAGEVVWNRGLLKR  389

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL  +A  ++A     G  DH +SL
Sbjct  390   VGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEDADRLIAEEAMHG-GDHPFSL  448

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F+G AG+A    D++ P+ SRFP YE+
Sbjct  449   FEGKAGMAYFLLDMVNPYESRFPAYEL  475



>ref|XP_004487685.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=416

 Score =   359 bits (921),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/392 (48%), Positives = 244/392 (62%), Gaps = 23/392 (6%)
 Frame = +1

Query  172   LPAETF----LQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  339
             LP +T      QAA+  K  VV  TW + G       D T+YTG LGTAY   +++Q T 
Sbjct  44    LPYQTLSTNLQQAALHFKQSVVSETWGSSGNRV---KDYTLYTGALGTAYLLFKAYQVTK  100

Query  340   NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  519
             N  DL LC+ IV  C SA+  + R +TF+CGR G+ ALGAV A + GD +  D YL  F 
Sbjct  101   NVDDLNLCSKIVKACDSASKNSSR-VTFICGRAGVCALGAVIAKHAGDGRLLDYYLRQFK  159

Query  520   EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILE  699
             E+     LP           Y++LYG+AG+LWA  F+ +H+G + +P   + P+VE ++ 
Sbjct  160   EIELPHDLP-----------YEVLYGKAGYLWACSFLNKHIGKDTIPTADMRPIVEEVIT  208

Query  700   GGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNN  879
              GR   +    CPLMY WHG +YWGAAHGLAGI+NVL+   L  D VEDVKGTLRYM+ N
Sbjct  209   AGRK-LAHKGRCPLMYEWHGKKYWGAAHGLAGIMNVLMGMELKPDEVEDVKGTLRYMIKN  267

Query  880   RFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKS  1059
             RF  SGNYP SEG+  D+LV WCHGA G+ +TL KA + F  D+EF  AA++AGEVVW  
Sbjct  268   RFS-SGNYPSSEGSESDRLVHWCHGAPGVTLTLVKAVEAF-EDKEFLQAAVDAGEVVWNR  325

Query  1060  GLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAAD  1239
             GL+K+VGL  G +GN Y  LSLYRLTG   Y  RA+ F  FL   A  ++   +  G  D
Sbjct  326   GLLKRVGLCHGVSGNTYVFLSLYRLTGNKEYLYRAKGFSCFLLDRAQKLIVKGKMHG-GD  384

Query  1240  HAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               YSLF+GL G+A  + D++ P  +RFPGYE+
Sbjct  385   RPYSLFEGLGGMANTFLDMVDPQVARFPGYEL  416



>gb|ABB47830.2| Lanthionine synthetase C-like protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG93541.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/386 (49%), Positives = 247/386 (64%), Gaps = 19/386 (5%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  360
             E  L+AA+ +KD+V++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L
Sbjct  34    ERLLRAALRIKDKVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLAL  90

Query  361   CADIVDTCASAAPATIRH-ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
               DIV  C +A+    R  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   +
Sbjct  91    AGDIVKECDAASRGLPRRFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTE  150

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGRAG+LWA LF+  HLG + +P+E +  V + I++ GR  +
Sbjct  151   KVP-----------NELLYGRAGYLWACLFLNTHLGEKTIPHEHITSVAKDIIDEGRKLA  199

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                + CPLMY WHG +YWGAAHGLAGI++VL+H  L  D  +DVK TL YM+ NR+P +G
Sbjct  200   KKGN-CPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKLDEKDDVKNTLLYMIRNRYP-TG  257

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+  A EA EVVW  GL+K+V
Sbjct  258   NYPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAEAAEVVWNRGLLKRV  316

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  ++A     G  DH +SLF
Sbjct  317   GICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIADGAMHG-GDHPFSLF  375

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G AG+A L  D+++P  S+FP YE+
Sbjct  376   EGRAGMAYLLLDMVSPSESKFPAYEL  401



>gb|KEH38770.1| G protein coupled receptor [Medicago truncatula]
Length=417

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 192/393 (49%), Positives = 249/393 (63%), Gaps = 25/393 (6%)
 Frame = +1

Query  172   LPAETF---LQA-AVSLKDQVVDMTWKARGGSAVTHM-DPTVYTGLLGTAYTCLRSFQAT  336
             LP +T    LQA A+  K  VV  TW    GS V  + D T+YTG+LGTAY   +S+Q +
Sbjct  45    LPYQTLTSKLQATALHFKQSVVSETW----GSGVNRVKDYTLYTGVLGTAYLVFKSYQVS  100

Query  337   GNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYF  516
              N  DL LC  IV  C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F
Sbjct  101   KNVDDLNLCLKIVKACDSASANSSR-VTFICGRAGVCALGAVIAKHAGDERLLDYYLRQF  159

Query  517   FEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAIL  696
              E+     LP           Y+LLYGR G+LWA  F+ +H+G + +P   + P+V+ ++
Sbjct  160   KEIELPCDLP-----------YELLYGRTGYLWACSFLNKHVGKDTIPTTYMRPIVDEVI  208

Query  697   EGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMN  876
               GR   +    CPLMY WHG +YWGAAHGLAGI+NVL+   L  D VED+KGTLRYM+ 
Sbjct  209   TTGRK-LAHKGRCPLMYEWHGKKYWGAAHGLAGIMNVLMDMELKPDEVEDIKGTLRYMIK  267

Query  877   NRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWK  1056
             NRF  SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  DREF  AA +AGEVVWK
Sbjct  268   NRFS-SGNYPSSEGSESDRLVHWCHGAPGVTLTLVKAAEVF-GDREFLQAAEDAGEVVWK  325

Query  1057  SGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAA  1236
              GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+ F  FL   A +++   +  G  
Sbjct  326   RGLLKRVGICHGISGNTYVFLSLYRLTGNKEYLYRAKGFSCFLLDRAQELIGQGKMHG-G  384

Query  1237  DHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             D  YSLF+GL G+   + D+I P  +RFPGYE+
Sbjct  385   DRPYSLFEGLGGMTYTFVDMIDPQVARFPGYEL  417



>gb|ABB47829.2| Lanthionine synthetase C-like protein, expressed [Oryza sativa 
Japonica Group]
Length=399

 Score =   357 bits (916),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 189/385 (49%), Positives = 246/385 (64%), Gaps = 19/385 (5%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  360
             E  L+AA+ +KD+V++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L
Sbjct  34    ERLLRAALRIKDKVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLAL  90

Query  361   CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  540
               DIV  C  AA   +  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   + 
Sbjct  91    AGDIVKEC-DAASRGLPFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEK  149

Query  541   LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSS  720
             +P            +LLYGRAG+LWA LF+  HLG + +P+E +  V + I++ GR  + 
Sbjct  150   VP-----------NELLYGRAGYLWACLFLNTHLGEKTIPHEHITSVAKDIIDEGRKLAK  198

Query  721   DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGN  900
               + CPLMY WHG +YWGAAHGLAGI++VL+H  L  D  +DVK TL YM+ NR+P +GN
Sbjct  199   KGN-CPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKLDEKDDVKNTLLYMIRNRYP-TGN  256

Query  901   YPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVG  1080
             YP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+  A EA EVVW  GL+K+VG
Sbjct  257   YPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAEAAEVVWNRGLLKRVG  315

Query  1081  LADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQ  1260
             +  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  ++A     G  DH +SLF+
Sbjct  316   ICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIADGAMHG-GDHPFSLFE  374

Query  1261  GLAGVACLWFDLIAPHNSRFPGYEI  1335
             G AG+A L  D+++P  S+FP YE+
Sbjct  375   GRAGMAYLLLDMVSPSESKFPAYEL  399



>ref|XP_010062888.1| PREDICTED: lanC-like protein GCR2 [Eucalyptus grandis]
 gb|KCW70029.1| hypothetical protein EUGRSUZ_F03336 [Eucalyptus grandis]
Length=409

 Score =   357 bits (916),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 191/400 (48%), Positives = 255/400 (64%), Gaps = 23/400 (6%)
 Frame = +1

Query  148   DPTAPSFILP----AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  315
             DP +    LP    +E   +AA+ LKD V   TW A GG  +   D T+YTG LGTAY  
Sbjct  29    DPLSKLLYLPHAALSEKLKKAALDLKDTVARETW-AVGGKRLQ--DYTLYTGALGTAYLV  85

Query  316   LRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKR  495
              ++FQ T N  DLRLC++I+  C +A+  + R +TF+CG+ G+ ALGAV A + GD++  
Sbjct  86    FKAFQVTKNESDLRLCSEIIRACDAASRDSGR-VTFICGQAGVCALGAVVAKHSGDERLL  144

Query  496   DSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLM  675
             D YL  F E+   + LP            +LLYGRAGFLWA  F+ +H+G E +    + 
Sbjct  145   DHYLTRFKEIQLPRDLP-----------NELLYGRAGFLWAGSFLNKHIGKETISAARMR  193

Query  676   PVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKG  855
              VV+ +++ GR   +    CPLMY WHG +YWGAAHGLAGI++VL+  PL  D VEDVKG
Sbjct  194   AVVDDVIKYGRR-LAKGGKCPLMYEWHGKKYWGAAHGLAGIMHVLMDMPLKPDEVEDVKG  252

Query  856   TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  1035
             TL YM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF   +EF  AA++
Sbjct  253   TLHYMIKNRFP-SGNYPSSEGSETDRLVHWCHGAPGVALTLVKAAEVF-GSKEFLQAAVD  310

Query  1036  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  1215
             AGEVVW  GL+K+VG+  G +GNAY  LSL RLTG + Y  RA+AF  FL   A  +++ 
Sbjct  311   AGEVVWSRGLLKRVGICHGISGNAYVFLSLSRLTGNAEYLYRAKAFACFLQDRALRLISE  370

Query  1216  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              +  G  D  YSLF+G+ G+A L+ D   P  +RFP YE+
Sbjct  371   GKMHG-GDRPYSLFEGIGGMAGLFMDTTEPSEARFPAYEL  409



>gb|KHG14999.1| LanC-like protein 2 [Gossypium arboreum]
Length=407

 Score =   357 bits (915),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 190/381 (50%), Positives = 246/381 (65%), Gaps = 19/381 (5%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  372
              AA++LK+ VV  TW   G S     D T+YTG LGTAY   +++Q T N  DL+LC+DI
Sbjct  46    SAALALKETVVRETW---GLSGKRVQDYTLYTGALGTAYLVFKAYQVTKNDNDLKLCSDI  102

Query  373   VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  552
             V  C SA+  + R +TF+CGR G+YALGAV A   GD      YL  F E+     LP  
Sbjct  103   VKACDSASKDSGR-VTFICGRAGVYALGAVIAKQSGDTSLEQRYLAKFNEIRFPSDLP--  159

Query  553   PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM  732
                      ++LLYGRAGFLWA  F+ +H+G + +    +  VV+ I+E G+   +    
Sbjct  160   ---------HELLYGRAGFLWACSFLNKHIGKDTISTAHIRAVVDEIIESGKR-LAGKGR  209

Query  733   CPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVS  912
             CPLMY WHG +YWGAAHGLAGI++VL+   L  D VE VKGTLR M+ NRFP SGNYP S
Sbjct  210   CPLMYEWHGKKYWGAAHGLAGIMHVLMDTELKPDEVEYVKGTLRCMIKNRFP-SGNYPSS  268

Query  913   EGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADG  1092
             EG+  D+LV WCHGA GI +TL KA++VF  D+EF  AA++AGEVVWK GL+K+VG+  G
Sbjct  269   EGSESDRLVHWCHGAPGITLTLAKAAEVF-GDKEFLQAALDAGEVVWKRGLLKRVGICHG  327

Query  1093  TAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAG  1272
              +GNAY  LSLYRLTG   Y  RA+AF SFL   A  +++  +  G  D  YSLF+G+ G
Sbjct  328   ISGNAYVFLSLYRLTGNVEYLYRAKAFASFLSDRAEKLISQGKMHG-GDRPYSLFEGIGG  386

Query  1273  VACLWFDLIAPHNSRFPGYEI  1335
             +A L+ D++    +RFP YEI
Sbjct  387   MAHLFLDMVKASEARFPAYEI  407



>ref|NP_001064963.1| Os10g0497900 [Oryza sativa Japonica Group]
 dbj|BAF26877.1| Os10g0497900, partial [Oryza sativa Japonica Group]
Length=447

 Score =   358 bits (919),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 189/386 (49%), Positives = 247/386 (64%), Gaps = 19/386 (5%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  360
             E  L+AA+ +KD+V++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L
Sbjct  80    ERLLRAALRIKDKVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLAL  136

Query  361   CADIVDTCASAAPATIRH-ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
               DIV  C +A+    R  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   +
Sbjct  137   AGDIVKECDAASRGLPRRFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTE  196

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGRAG+LWA LF+  HLG + +P+E +  V + I++ GR  +
Sbjct  197   KVP-----------NELLYGRAGYLWACLFLNTHLGEKTIPHEHITSVAKDIIDEGRKLA  245

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                + CPLMY WHG +YWGAAHGLAGI++VL+H  L  D  +DVK TL YM+ NR+P +G
Sbjct  246   KKGN-CPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKLDEKDDVKNTLLYMIRNRYP-TG  303

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+  A EA EVVW  GL+K+V
Sbjct  304   NYPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAEAAEVVWNRGLLKRV  362

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  ++A     G  DH +SLF
Sbjct  363   GICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIADGAMHG-GDHPFSLF  421

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G AG+A L  D+++P  S+FP YE+
Sbjct  422   EGRAGMAYLLLDMVSPSESKFPAYEL  447



>gb|AAG52264.1|AC019018_1 putative G protein-coupled receptor; 80093-78432 [Arabidopsis 
thaliana]
Length=401

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 193/410 (47%), Positives = 255/410 (62%), Gaps = 23/410 (6%)
 Frame = +1

Query  118   GNDSGFRTVLDPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVY  285
             G +       D       LP ++F +     A+S+KD+VV  TW+ R G  V   D  +Y
Sbjct  11    GEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWE-RSGKRVR--DYNLY  67

Query  286   TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  465
             TG+LGTAY   +S+Q T N  DL+LC + V+ C  A+  + R +TF+CG  G+ ALGAVA
Sbjct  68    TGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSER-VTFICGYAGVCALGAVA  126

Query  466   ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  645
             A   GD Q  D YL  F  +     LP           Y+LLYGRAG+LWA LF+ +H+G
Sbjct  127   AKCLGDDQLYDRYLARFRGIRLPSDLP-----------YELLYGRAGYLWACLFLNKHIG  175

Query  646   SEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPL  825
              E++ +E +  VVE I   GR    +   CPLMY WHG RYWGAAHGLAGI+NVL+H  L
Sbjct  176   QESISSERMRSVVEEIFRAGRQ-LGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTEL  234

Query  826   SEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPN  1005
               D ++DVKGTL YM+ NRFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QV+ N
Sbjct  235   EPDEIKDVKGTLSYMIQNRFP-SGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVY-N  292

Query  1006  DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFL  1185
              +EF +AA+EAGEVVW  GL+K+VG+  G +GN Y  LSLYRLT    Y  RA+AF SFL
Sbjct  293   TKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFL  352

Query  1186  YHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                +  +++  Q  G  D  +SLF+G+ G+A +  D+  P  + FPGYE+
Sbjct  353   LDKSEKLISEGQMHG-GDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  401



>ref|XP_011626219.1| PREDICTED: lanC-like protein GCR2 [Amborella trichopoda]
Length=364

 Score =   354 bits (909),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 243/372 (65%), Gaps = 16/372 (4%)
 Frame = +1

Query  220   VVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  399
             +V  TW   GG      D T+YTG LGTAY   +++Q T N+ DL LC +I+ +C  ++ 
Sbjct  8     IVKETWVNCGGRV---KDTTLYTGALGTAYLLFKAYQVTNNKDDLSLCTEIIASCDVSSR  64

Query  400   ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMS  579
                  +TF+CG+ G+YALGAVAA   GDQ   D YL  F      + +P   E   + + 
Sbjct  65    GMREDVTFICGQAGIYALGAVAAKCIGDQSLLDRYLSLF------RKIPKRIES--YDIP  116

Query  580   YDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHG  759
             Y+LLYGR+GFLWA  F+ QH+G   + ++   P+V+ I + GR  S     CPL+Y WHG
Sbjct  117   YELLYGRSGFLWACAFLNQHIGPGTISSDVTAPIVKDIFKEGRRLSHGG--CPLVYVWHG  174

Query  760   TRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLV  939
              +YWGAAHGLAGI++VL+HF LS    EDVKGTLRYMM NRFP SGNYP SEG+  D+LV
Sbjct  175   KKYWGAAHGLAGIMHVLMHFELSAREEEDVKGTLRYMMQNRFP-SGNYPSSEGSTTDRLV  233

Query  940   QWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASL  1119
              WCHGA G+ +T+C+A Q F  D+EF DAA++A +VVWK GL+++VG+  G +GNAY  L
Sbjct  234   HWCHGAPGVALTMCRAVQAF-GDKEFMDAAVDATDVVWKRGLLRRVGICHGVSGNAYVFL  292

Query  1120  SLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLI  1299
             +LYRL G+  Y  +A+AF  FL    G +++  +  G  D + SLF+G+AG A L+ D+ 
Sbjct  293   ALYRLLGKEEYLYKAKAFACFLLDCGGRLISSGEMHG-GDRSLSLFEGMAGTAHLFLDMT  351

Query  1300  APHNSRFPGYEI  1335
              P +SRFP YE+
Sbjct  352   KPSDSRFPAYEL  363



>ref|NP_175700.2| G-protein coupled receptor 2 [Arabidopsis thaliana]
 sp|F4IEM5.1|GCR2_ARATH RecName: Full=LanC-like protein GCR2; AltName: Full=G-protein 
coupled receptor 2 [Arabidopsis thaliana]
 gb|AEE32868.1| G-protein coupled receptor 2 [Arabidopsis thaliana]
Length=410

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 193/410 (47%), Positives = 255/410 (62%), Gaps = 23/410 (6%)
 Frame = +1

Query  118   GNDSGFRTVLDPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVY  285
             G +       D       LP ++F +     A+S+KD+VV  TW+ R G  V   D  +Y
Sbjct  20    GEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWE-RSGKRVR--DYNLY  76

Query  286   TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  465
             TG+LGTAY   +S+Q T N  DL+LC + V+ C  A+  + R +TF+CG  G+ ALGAVA
Sbjct  77    TGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSER-VTFICGYAGVCALGAVA  135

Query  466   ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  645
             A   GD Q  D YL  F  +     LP           Y+LLYGRAG+LWA LF+ +H+G
Sbjct  136   AKCLGDDQLYDRYLARFRGIRLPSDLP-----------YELLYGRAGYLWACLFLNKHIG  184

Query  646   SEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPL  825
              E++ +E +  VVE I   GR    +   CPLMY WHG RYWGAAHGLAGI+NVL+H  L
Sbjct  185   QESISSERMRSVVEEIFRAGRQ-LGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTEL  243

Query  826   SEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPN  1005
               D ++DVKGTL YM+ NRFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QV+ N
Sbjct  244   EPDEIKDVKGTLSYMIQNRFP-SGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVY-N  301

Query  1006  DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFL  1185
              +EF +AA+EAGEVVW  GL+K+VG+  G +GN Y  LSLYRLT    Y  RA+AF SFL
Sbjct  302   TKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFL  361

Query  1186  YHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                +  +++  Q  G  D  +SLF+G+ G+A +  D+  P  + FPGYE+
Sbjct  362   LDKSEKLISEGQMHG-GDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  410



>pdb|3T33|A Chain A, Crystal Structure Of Arabidopsis Gcr2
Length=415

 Score =   356 bits (914),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 193/410 (47%), Positives = 255/410 (62%), Gaps = 23/410 (6%)
 Frame = +1

Query  118   GNDSGFRTVLDPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVY  285
             G +       D       LP ++F +     A+S+KD+VV  TW+ R G  V   D  +Y
Sbjct  25    GEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWE-RSGKRVR--DYNLY  81

Query  286   TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  465
             TG+LGTAY   +S+Q T N  DL+LC + V+ C  A+  + R +TF+CG  G+ ALGAVA
Sbjct  82    TGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSER-VTFICGYAGVCALGAVA  140

Query  466   ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  645
             A   GD Q  D YL  F  +     LP           Y+LLYGRAG+LWA LF+ +H+G
Sbjct  141   AKCLGDDQLYDRYLARFRGIRLPSDLP-----------YELLYGRAGYLWACLFLNKHIG  189

Query  646   SEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPL  825
              E++ +E +  VVE I   GR    +   CPLMY WHG RYWGAAHGLAGI+NVL+H  L
Sbjct  190   QESISSERMRSVVEEIFRAGRQ-LGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTEL  248

Query  826   SEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPN  1005
               D ++DVKGTL YM+ NRFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QV+ N
Sbjct  249   EPDEIKDVKGTLSYMIQNRFP-SGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVY-N  306

Query  1006  DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFL  1185
              +EF +AA+EAGEVVW  GL+K+VG+  G +GN Y  LSLYRLT    Y  RA+AF SFL
Sbjct  307   TKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFL  366

Query  1186  YHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                +  +++  Q  G  D  +SLF+G+ G+A +  D+  P  + FPGYE+
Sbjct  367   LDKSEKLISEGQMHG-GDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  415



>ref|XP_009147647.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCR2 [Brassica 
rapa]
Length=409

 Score =   356 bits (913),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 191/410 (47%), Positives = 256/410 (62%), Gaps = 23/410 (6%)
 Frame = +1

Query  118   GNDSGFRTVLDPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVY  285
             G +    T  D       LP  +F +     A+SLKD +V  TW  R G  V   D  +Y
Sbjct  19    GEEETVSTHKDSLTKLLSLPYRSFSKKLQRYALSLKDTIVFETWD-RSGKRVR--DFNLY  75

Query  286   TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  465
             TG+LGTAY   +S+Q   N  DL+LC +IV+ C +A+  + R +TF+CGR G+ ALGAVA
Sbjct  76    TGVLGTAYLLFQSYQVARNENDLKLCLEIVEACYTASKDSDR-VTFICGRAGVCALGAVA  134

Query  466   ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  645
             A   GD Q +D YL  F E+     LP           Y+LLYGRAG+LWA LF+ +H+G
Sbjct  135   AKLTGDSQLQDRYLARFHEIRLPGDLP-----------YELLYGRAGYLWACLFLNKHIG  183

Query  646   SEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPL  825
              ++V +  +  VVE I   GR    +   CPLM+ WHG +YWGAAHGLAGI++VL+H  L
Sbjct  184   KDSVSSARMRSVVEEIFRAGRQ-LGERVKCPLMFEWHGKKYWGAAHGLAGIMHVLMHVEL  242

Query  826   SEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPN  1005
               D +EDVKGTL YM+ +RFP SGNY  SEG+  D+LV WCHGA G+ + L KA+QVF  
Sbjct  243   EPDEMEDVKGTLSYMIQHRFP-SGNYLSSEGSESDRLVHWCHGAPGVALALVKAAQVFRK  301

Query  1006  DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFL  1185
             D EF +AA+EAGEV+W  GL+K VG+  G +GN Y  LSLYRLTG+  Y  RA+AF SFL
Sbjct  302   D-EFVEAAMEAGEVLWNRGLLKXVGICHGISGNTYVFLSLYRLTGKPEYLYRAKAFASFL  360

Query  1186  YHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                +  +++  +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  361   LDKSEKLISEGKMHG-GDRPFSLFEGIGGMAYMFLDMNEPTQALFPGYEL  409



>gb|AAL58268.1|AC068923_10 putative lanthionine synthetase [Oryza sativa Japonica Group]
Length=446

 Score =   357 bits (916),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 189/385 (49%), Positives = 246/385 (64%), Gaps = 19/385 (5%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  360
             E  L+AA+ +KD+V++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L
Sbjct  81    ERLLRAALRIKDKVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLAL  137

Query  361   CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  540
               DIV  C  AA   +  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   + 
Sbjct  138   AGDIVKEC-DAASRGLPFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEK  196

Query  541   LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSS  720
             +P            +LLYGRAG+LWA LF+  HLG + +P+E +  V + I++ GR  + 
Sbjct  197   VP-----------NELLYGRAGYLWACLFLNTHLGEKTIPHEHITSVAKDIIDEGRKLAK  245

Query  721   DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGN  900
               + CPLMY WHG +YWGAAHGLAGI++VL+H  L  D  +DVK TL YM+ NR+P +GN
Sbjct  246   KGN-CPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKLDEKDDVKNTLLYMIRNRYP-TGN  303

Query  901   YPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVG  1080
             YP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+  A EA EVVW  GL+K+VG
Sbjct  304   YPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAEAAEVVWNRGLLKRVG  362

Query  1081  LADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQ  1260
             +  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  ++A     G  DH +SLF+
Sbjct  363   ICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIADGAMHG-GDHPFSLFE  421

Query  1261  GLAGVACLWFDLIAPHNSRFPGYEI  1335
             G AG+A L  D+++P  S+FP YE+
Sbjct  422   GRAGMAYLLLDMVSPSESKFPAYEL  446



>ref|XP_004244211.1| PREDICTED: lanC-like protein GCL2 [Solanum lycopersicum]
Length=408

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/381 (48%), Positives = 245/381 (64%), Gaps = 20/381 (5%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  372
             + A  LK+ +V  TW  + G      D T+YTG LGTA+   +++Q T ++ DL LC+DI
Sbjct  48    RVAFDLKETIVKETWVCKRGRV---SDYTIYTGALGTAFLLFKAYQVTLDKNDLALCSDI  104

Query  373   VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  552
             +  C SA+  + R +TF+CG+ G+Y+LGAV A   GD+Q  D YL  F E+   K LP  
Sbjct  105   IKACDSASRGSGR-VTFICGQAGVYSLGAVVAKQSGDEQLCDHYLTKFKEIELPKDLP--  161

Query  553   PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM  732
                       +LLYGRAGFLWA  F+ +++G E +    +  VV  +++ GR        
Sbjct  162   ---------NELLYGRAGFLWACSFLNKNIGRETISPTQIRAVVAEVIKSGR--KMGKGK  210

Query  733   CPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVS  912
             CPLMY WHG RYWGAAHGLAGI++VL+   L  D VEDVK TL YM+ NRFP SGNYP S
Sbjct  211   CPLMYEWHGKRYWGAAHGLAGIMHVLMDMELKADEVEDVKATLHYMIRNRFP-SGNYPSS  269

Query  913   EGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADG  1092
             EG+  D+LV WCHGA G+ +TL KA++VF ND EF  AAIEA EV+W  GL+K+VG+  G
Sbjct  270   EGSESDRLVHWCHGAPGVALTLIKAAKVFSND-EFLQAAIEAAEVIWNRGLLKRVGICHG  328

Query  1093  TAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAG  1272
              +GN+Y  LSLYRLTG+  Y  +A+AF  FL+  A  +++     G  D  YSLF+G+ G
Sbjct  329   VSGNSYVFLSLYRLTGKVEYLYKAKAFACFLHTRAQTLISEGVMHG-GDRPYSLFEGMGG  387

Query  1273  VACLWFDLIAPHNSRFPGYEI  1335
             +A L+FD+I P  +RFP YE+
Sbjct  388   MAYLFFDMIDPIETRFPAYEL  408



>ref|XP_010051804.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Eucalyptus 
grandis]
Length=419

 Score =   355 bits (911),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 188/405 (46%), Positives = 253/405 (62%), Gaps = 22/405 (5%)
 Frame = +1

Query  124   DSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGT  303
             DS    +L    P     +E+F +AA+ LK+ +V  TW   G +     D T+Y G LGT
Sbjct  36    DSSLAKLLAKPYPVL---SESFKRAALDLKETIVVQTW---GATRQRVRDFTLYCGSLGT  89

Query  304   AYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGD  483
             A+   RS+Q T N  DL LC+ I+  C SA+ A  R +TF+CGR G+ ALGAV A Y GD
Sbjct  90    AFLLFRSYQITSNSNDLALCSQIIRACDSAS-AKSRDVTFICGRAGVCALGAVVAKYAGD  148

Query  484   QQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPN  663
                   YL++F E+   K++P            +LLYGRAGFLWA LF+ +H+G    P 
Sbjct  149   THSLTHYLNHFKEIKLSKSIPD-----------ELLYGRAGFLWACLFLNKHIGEGTAPX  197

Query  664   ETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVE  843
              T+  V + I + GRA +      PLM+ W+G +YWGAAHGLAGI++VL+H  L  D +E
Sbjct  198   STMRAVADEIFKNGRALAKRGGKSPLMFEWYGEKYWGAAHGLAGIMHVLMHMELKPDEME  257

Query  844   DVKGTLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFR  1020
             DVKGTL+YM+ NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF  D EF 
Sbjct  258   DVKGTLKYMIRNRFP-SGNYPSSEEDRNRDVLVHWCHGAPGIALTLVKAAEVF-RDEEFL  315

Query  1021  DAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAG  1200
              AA++A EVVW  GL+K+VG+  G +GN Y  LSLYR+TG + +  RA+AF  FL   A 
Sbjct  316   RAAVDAAEVVWNRGLLKRVGICHGISGNVYVFLSLYRVTGNAEFLYRAKAFACFLLDRAL  375

Query  1201  DIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              +++  +  G  D+ YSLF+G+ G A L+ D++ P  +RFP YE+
Sbjct  376   KLISTGEMHG-GDNPYSLFEGIGGTAYLFLDMVEPSAARFPAYEL  419



>ref|XP_008452476.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Cucumis melo]
Length=412

 Score =   355 bits (910),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 246/381 (65%), Gaps = 19/381 (5%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  372
             Q A++LK+ VV  TW   G       D T+YTG LGTA+  L+SF    N  DL+LC++I
Sbjct  51    QTALNLKETVVRETWTLSGRHP---QDYTLYTGALGTAFLALKSFLVFKNENDLKLCSEI  107

Query  373   VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  552
             V  C S +  + RH+TF+CGR G+ ALGAVAA +  D    D YL+ F ++     LP  
Sbjct  108   VAACESLSKKS-RHVTFICGRAGVCALGAVAAKFANDGMLVDHYLEKFKDIKLPSDLP--  164

Query  553   PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM  732
                       +LLYGRAGFLWA LF+ +H+G   + N  +  VV+ ++E GR      S 
Sbjct  165   ---------NELLYGRAGFLWACLFLNKHIGRNTISNTFMRSVVDEVIEAGRR-LGQKSK  214

Query  733   CPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVS  912
              PLMY WHG +YWGAAHGLAGI++VL+   L  D VEDVK TLRYM+ NRF  SGNYP S
Sbjct  215   SPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEDVKNTLRYMIKNRFL-SGNYPSS  273

Query  913   EGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADG  1092
             E +  D+LV WCHGA G+ +TL KA++VF +D EF  AAI+AGEVVW  GL+K+VG+  G
Sbjct  274   EESESDRLVHWCHGAPGVALTLGKAAEVFGDD-EFLQAAIDAGEVVWNRGLLKRVGICHG  332

Query  1093  TAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAG  1272
              +GN Y  LSLYRLTG+  Y  RA+AF  FL+ NA  +++  +   + D  YSLF+G+ G
Sbjct  333   ISGNTYVFLSLYRLTGDLTYLHRAKAFACFLHQNAEKLISEGKMH-SGDCPYSLFEGIGG  391

Query  1273  VACLWFDLIAPHNSRFPGYEI  1335
             +A L+ D++ P+ ++FP YE+
Sbjct  392   MAYLFLDMVEPYAAKFPSYEL  412



>emb|CDP05888.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   354 bits (908),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 251/392 (64%), Gaps = 24/392 (6%)
 Frame = +1

Query  172   LPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  339
             LP +T  +     A+ LK  VV  TW ARG       D T+YTG LGTA+   +++Q T 
Sbjct  38    LPCKTLFERLKNEALDLKKTVVKETWGARGKRLT---DYTLYTGTLGTAFLLFKAYQITK  94

Query  340   NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  519
             +++DL L ++I+  C SAA  + R +TF+CG+ G+YALGAV A + GD +    +L  F 
Sbjct  95    DKKDLLLSSEIIKACDSAASGSGR-VTFICGQAGVYALGAVVAKHSGDDRLSGYFLTKFR  153

Query  520   EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILE  699
             E+   K LP            +LLYGRAGFLWA+ F+ ++LG + V +  +  VV+ I++
Sbjct  154   EIKLPKELP-----------NELLYGRAGFLWASTFLNRNLGKDTVSSTEMRAVVDEIIK  202

Query  700   GGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNN  879
              GR  +     CPLMY WHG +YWGAAHGLAGI+ +L+   L  D +EDVKGTLRYM+ N
Sbjct  203   SGRKLAKGR--CPLMYEWHGKKYWGAAHGLAGIMYILMDMELKPDEIEDVKGTLRYMIKN  260

Query  880   RFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKS  1059
             RFP SGNYP SEG+  D+LV WCHGA GI +TL KA++VF + +EF   A++AGEVVW  
Sbjct  261   RFP-SGNYPSSEGSETDRLVHWCHGAPGIALTLSKAAEVF-SSKEFLQGAVDAGEVVWNR  318

Query  1060  GLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAAD  1239
             GL+K+VGL  G +GN Y  LSLYR+TG   Y  RA+AF SFL+  A  +++     G  D
Sbjct  319   GLLKRVGLCHGISGNTYVFLSLYRMTGRVEYLYRAKAFASFLHDRAKTLISEGIMHG-GD  377

Query  1240  HAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               YSLF+G+ G+A L+ D+  P  +RFP YE+
Sbjct  378   RPYSLFEGIGGMAYLFLDIAEPSAARFPAYEL  409



>ref|XP_004982728.1| PREDICTED: lanC-like protein 2-like [Setaria italica]
Length=446

 Score =   355 bits (910),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 192/386 (50%), Positives = 247/386 (64%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++ FL+AA  LKD+VV+ TW  + G  VT  D T+YTG LGTA    +SF+ TG+R DL 
Sbjct  80    SDRFLRAARRLKDKVVEETW-VKAGRQVT--DYTLYTGALGTALLLFKSFRVTGDRGDLA  136

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             L ADIV  C  A+   +  +TF+CGR G+ ALGAV A +C DQ +   YL  F E+   +
Sbjct  137   LAADIVHACDDASRG-LPFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITITE  195

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGRAG+LWA LF+ +HL  + +P E +  V + I+  GR  S
Sbjct  196   KVP-----------NELLYGRAGYLWACLFLNKHLSEKTIPLEHINSVAKDIIREGRKLS  244

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             S  S  PLMY WHG +YWGAAHGLAGI++VL+H  L  D  +DVK TLRYM+ NRFP SG
Sbjct  245   SKGS-SPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKLDEQDDVKNTLRYMIKNRFP-SG  302

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEGN  D+LV WCHGA G+ +TL KA +VF +D  F+ +A  A EVVW  GL+K+V
Sbjct  303   NYPSSEGNESDRLVHWCHGAPGVALTLAKAYEVFHDD-HFKQSAAGAAEVVWNRGLLKRV  361

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A + +A     G  D  +SLF
Sbjct  362   GICHGVSGNAYTFLSLYRLTGNVEYLYRAKAFACFLLEKADEFIAEGAMHG-GDRPFSLF  420

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G AG+A L  D++ P  SRFP YE+
Sbjct  421   EGKAGMAYLLLDMVDPSESRFPAYEL  446



>ref|XP_003540453.1| PREDICTED: lanC-like protein GCR2-like [Glycine max]
Length=405

 Score =   353 bits (906),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 250/392 (64%), Gaps = 23/392 (6%)
 Frame = +1

Query  172   LPAET----FLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  339
             LP +T    F  +A  LK  VV  TW +RG       D ++YTG LGTAY   +++Q T 
Sbjct  33    LPYQTLSTKFQASAFHLKQSVVRDTWGSRGKRV---KDYSLYTGALGTAYLLFKAYQVTK  89

Query  340   NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  519
             +  +L LC++IV  C SA+ A    +TF+CGR G+ ALGAV A + GD++  D YL  F 
Sbjct  90    DGNELNLCSEIVKACDSAS-ADSGKVTFICGRAGVCALGAVIAKHTGDERLLDYYLRQFK  148

Query  520   EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILE  699
             E+A  +  P           Y+LLYGRAG+LWA  F+ +H+G+  +P   +  +V+ ++ 
Sbjct  149   EIAIPRESP-----------YELLYGRAGYLWACSFLNKHIGNNTIPTTHMRSIVDEVIM  197

Query  700   GGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNN  879
              GR        CPLMY WHG +YWGAAHGLAGI++ L+   L  D VEDVKGTLRYM+NN
Sbjct  198   AGRH-LGRKGRCPLMYEWHGKKYWGAAHGLAGIMHALMDMELKPDEVEDVKGTLRYMINN  256

Query  880   RFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKS  1059
             R P SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D+EF  AA++AGEVVWK 
Sbjct  257   RLP-SGNYPSSEGSENDRLVHWCHGAPGLTLTLVKAAEVF-GDKEFSQAAVDAGEVVWKR  314

Query  1060  GLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAAD  1239
             GL+K+VG+  G +GN Y  LSLYR+TG   Y  RA+AF  FL   A ++++  +  G  D
Sbjct  315   GLLKRVGICHGISGNTYVFLSLYRMTGNEEYLYRAKAFACFLLDRAQNLISEGKMHG-GD  373

Query  1240  HAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               YSLF+GL G+A    D++ P  ++FPGYE+
Sbjct  374   RPYSLFEGLGGMAYTCLDMVDPQMAKFPGYEL  405



>gb|KHN28043.1| LanC-like protein 2 [Glycine soja]
Length=405

 Score =   353 bits (905),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 250/392 (64%), Gaps = 23/392 (6%)
 Frame = +1

Query  172   LPAET----FLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  339
             LP +T    F  +A  LK  VV  TW +RG       D ++YTG LGTAY   +++Q T 
Sbjct  33    LPYQTLSTKFQASAFHLKQSVVRDTWGSRGKRV---KDYSLYTGALGTAYLLFKAYQVTK  89

Query  340   NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  519
             +  +L LC++IV  C SA+ A    +TF+CGR G+ ALGAV A + GD++  D YL  F 
Sbjct  90    DGNELNLCSEIVKACDSAS-ADSGKVTFICGRAGVCALGAVIAKHTGDERLLDYYLRQFK  148

Query  520   EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILE  699
             E+A  +  P           Y+LLYGRAG+LWA  F+ +H+G+  +P   +  +V+ ++ 
Sbjct  149   EIAIPRESP-----------YELLYGRAGYLWACSFLNKHIGNNTIPTTHMRSIVDEVIM  197

Query  700   GGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNN  879
              GR        CPLMY WHG +YWGAAHGLAGI++ L+   L  D VEDVKGTLRYM+NN
Sbjct  198   AGRH-LGRKGRCPLMYEWHGKKYWGAAHGLAGIMHALMDMELKPDEVEDVKGTLRYMINN  256

Query  880   RFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKS  1059
             R P SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D+EF  AA++AGEVVWK 
Sbjct  257   RLP-SGNYPSSEGSENDRLVHWCHGAPGLTLTLVKAAEVF-GDKEFSQAAVDAGEVVWKR  314

Query  1060  GLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAAD  1239
             GL+K+VG+  G +GN Y  LSLYR+TG   Y  RA+AF  FL   A ++++  +  G  D
Sbjct  315   GLLKRVGICHGISGNTYVFLSLYRMTGNEEYLYRAKAFACFLLDRAQNLISEGKMHG-GD  373

Query  1240  HAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               YSLF+GL G+A    D++ P  ++FPGYE+
Sbjct  374   RPYSLFEGLGGMAYTCLDMVDPQMAKFPGYEL  405



>gb|ACN31611.1| unknown [Zea mays]
Length=408

 Score =   353 bits (905),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 195/415 (47%), Positives = 260/415 (63%), Gaps = 22/415 (5%)
 Frame = +1

Query  91    ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHM  270
             E+  ++ E    +G R +L   +  +   ++ F++AA  LKD+VV+ TW  + G  VT  
Sbjct  16    EAEASDGEGHRPAGHRGLL---SLPYTRLSDHFVRAARRLKDKVVEETW-VKAGRKVT--  69

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D T+YTG LGTA    +SFQ TG+R DL L ADIV  C  A+   +  +TF+CGR G+ A
Sbjct  70    DYTLYTGSLGTALLLFKSFQVTGDRGDLTLAADIVRACDDASRG-LPFLTFICGRAGVCA  128

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             LGAV A +C DQ +   YL  F E+   + +P            +LLYGRAG+LWA LF+
Sbjct  129   LGAVIAKHCDDQLRVTQYLSSFDEITITEKVP-----------NELLYGRAGYLWACLFL  177

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVL  810
              +HL  + +P E +  V + I+  GR  +S  S  PLMY WHG +YWGAAHGLAGI++VL
Sbjct  178   NKHLSEKTIPLEHINSVAKDIINEGRGLASKGS-SPLMYEWHGKKYWGAAHGLAGIMHVL  236

Query  811   LHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKAS  990
             +H  L  D  +DVK TLRYM+ N+FP SGNYP SEGN  D LV WCHGA G+ +TL KA 
Sbjct  237   MHTELKPDEQDDVKNTLRYMIKNKFP-SGNYPSSEGNESDHLVHWCHGAPGVALTLAKAY  295

Query  991   QVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARA  1170
             +VF +D  F+ +A EA EVVW  GL+K+VG+  G +GNAYA LSLYRLTG   +  RA+A
Sbjct  296   EVFHDDY-FKQSAAEAAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNVEHLYRAKA  354

Query  1171  FGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F  FL   A  ++A     G  D  +SLF+G AG++ L  D++ P  SRFP YE+
Sbjct  355   FACFLLEKADQLIAEGAMHG-GDRPFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  408



>gb|KJB84326.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=409

 Score =   352 bits (904),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 186/373 (50%), Positives = 243/373 (65%), Gaps = 19/373 (5%)
 Frame = +1

Query  217   QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             QVV  TW   G S     D T+YTG LGTAY   +++Q T N  DL+LC+DIV  C SA+
Sbjct  56    QVVRETW---GLSGKRVQDYTLYTGALGTAYLVFKAYQVTKNDNDLKLCSDIVKACDSAS  112

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
               + R +TF+CGR G+YALGAV A + GD   +  YL+ F E+     LP          
Sbjct  113   KDSGR-VTFICGRAGVYALGAVIAKHSGDTSLQQRYLEKFKEIRFPSDLP----------  161

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
              ++LLYGRAGFLWA  F+ +H+G + +    +  VV+ I+E G+   +    CPLMY WH
Sbjct  162   -HELLYGRAGFLWACSFLNKHIGKDTISTARIRAVVDEIIESGKR-LAGKGRCPLMYEWH  219

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             G +YWGAAHGLAGI++VL+   L  D  E VKGTLRY++ NRFP SGNYP SEG+  D+L
Sbjct  220   GKKYWGAAHGLAGIIHVLMDTELKPDEAEYVKGTLRYIIKNRFP-SGNYPSSEGSESDRL  278

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             V WCHGA GI +TL KA++VF  D+EF  AA++AGEVVWK GL+K+VG+  G +GNAY  
Sbjct  279   VHWCHGAPGITLTLVKAAEVF-GDKEFLQAALDAGEVVWKRGLLKRVGICHGISGNAYVF  337

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSLYRLTG   Y  RA+AF SFL   A  +++  +  G  D  YSLF+G+ G+A L+ D+
Sbjct  338   LSLYRLTGNVEYLYRAKAFTSFLSDRAEKLISQGKMHG-GDRPYSLFEGIGGMAHLFLDM  396

Query  1297  IAPHNSRFPGYEI  1335
             +    +RFP YEI
Sbjct  397   VKASEARFPAYEI  409



>tpg|DAA49457.1| TPA: LOW QUALITY PROTEIN: lanC-like protein 2 [Zea mays]
Length=400

 Score =   352 bits (903),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 247/386 (64%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++ F++AA  LKD+VV+ TW  + G  VT  D T+YTG LGTA    +SFQ TG+R DL 
Sbjct  34    SDHFVRAARRLKDKVVEETW-VKAGRKVT--DYTLYTGSLGTALLLFKSFQVTGDRGDLA  90

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             L ADIV  C  A+   +  +TF+CGR G+ ALGAV A +C DQ +   YL  F E+   +
Sbjct  91    LAADIVRACDDASRG-LPFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITITE  149

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGRAG+LWA LF+ +HL  + +P + +  V + I+  GR  +
Sbjct  150   KVP-----------NELLYGRAGYLWACLFLNKHLSEKTIPLDHINSVAKDIINEGRGFA  198

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             S  S  PLMY WHG +YWGAAHGLAGI++VL+H  L  D  +DVK TLRYM+ N+FP SG
Sbjct  199   SKGS-SPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKPDEQDDVKNTLRYMIKNKFP-SG  256

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEGN  D LV WCHGA G+ +TL KA +VF +D  F  +A EA EVVW  GL+K+V
Sbjct  257   NYPSSEGNESDHLVHWCHGAPGVALTLAKAYEVFHDDY-FEQSAAEAAEVVWNRGLLKRV  315

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAYA LSLYRLTG   Y  RA+AF  FL   A  ++A     G  D  +SLF
Sbjct  316   GICHGVSGNAYAFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAEGAMHG-GDRPFSLF  374

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G AG++ L  D++ P  SRFP YE+
Sbjct  375   EGKAGMSYLLLDMVDPSESRFPAYEL  400



>ref|NP_001149305.1| LOC100282928 [Zea mays]
 gb|ACG34942.1| lanC-like protein 2 [Zea mays]
Length=401

 Score =   352 bits (902),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 247/386 (64%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++ F++AA  LKD+VV+ TW  + G  VT  D T+YTG LGTA    +SFQ TG+R DL 
Sbjct  35    SDHFVRAARRLKDKVVEETW-VKAGRKVT--DYTLYTGSLGTALLLFKSFQVTGDRGDLA  91

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             L ADIV  C  A+   +  +TF+CGR G+ ALGAV A +C DQ +   YL  F E+   +
Sbjct  92    LAADIVRACDDASRG-LPFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITITE  150

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGRAG+LWA LF+ +HL  + +P + +  V + I+  GR  +
Sbjct  151   KVP-----------NELLYGRAGYLWACLFLNKHLSEKTIPLDHINSVAKDIINEGRGFA  199

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             S  S  PLMY WHG +YWGAAHGLAGI++VL+H  L  D  +DVK TLRYM+ N+FP SG
Sbjct  200   SKGS-SPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKPDEQDDVKNTLRYMIKNKFP-SG  257

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEGN  D LV WCHGA G+ +TL KA +VF +D  F  +A EA EVVW  GL+K+V
Sbjct  258   NYPSSEGNESDHLVHWCHGAPGVALTLAKAYEVFHDDY-FEQSAAEAAEVVWNRGLLKRV  316

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAYA LSLYRLTG   Y  RA+AF  FL   A  ++A     G  D  +SLF
Sbjct  317   GICHGVSGNAYAFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAEGAMHG-GDRPFSLF  375

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G AG++ L  D++ P  SRFP YE+
Sbjct  376   EGKAGMSYLLLDMVDPSESRFPAYEL  401



>ref|XP_008676974.1| PREDICTED: LOC100282928 isoform X1 [Zea mays]
 tpg|DAA49460.1| TPA: hypothetical protein ZEAMMB73_373795 [Zea mays]
Length=451

 Score =   353 bits (907),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 196/416 (47%), Positives = 259/416 (62%), Gaps = 22/416 (5%)
 Frame = +1

Query  91    ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHM  270
             E+  ++ E    +G R +L   +  +   ++ F++AA  LKD+VV+ TW  + G  VT  
Sbjct  57    EAEASDGEGHRPAGHRGLL---SLPYTRLSDHFVRAARRLKDKVVEETW-VKAGRKVT--  110

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH-ITFLCGRGGLY  447
             D T+YTG LGTA    +SFQ TG+R DL L ADIV  C  A+    R  +TF+CGR G+ 
Sbjct  111   DYTLYTGSLGTALLLFKSFQVTGDRGDLALAADIVRACDDASRGLPRRFLTFICGRAGVC  170

Query  448   ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  627
             ALGAV A +C DQ +   YL  F E+   + +P            +LLYGRAG+LWA LF
Sbjct  171   ALGAVIAKHCDDQLRVTQYLSSFDEITITEKVP-----------NELLYGRAGYLWACLF  219

Query  628   IKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNV  807
             + +HL  + +P + +  V + I+  GR  +S  S  PLMY WHG +YWGAAHGLAGI++V
Sbjct  220   LNKHLSEKTIPLDHINSVAKDIINEGRGFASKGS-SPLMYEWHGKKYWGAAHGLAGIMHV  278

Query  808   LLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKA  987
             L+H  L  D  +DVK TLRYM+ N+FP SGNYP SEGN  D LV WCHGA G+ +TL KA
Sbjct  279   LMHTELKPDEQDDVKNTLRYMIKNKFP-SGNYPSSEGNESDHLVHWCHGAPGVALTLAKA  337

Query  988   SQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERAR  1167
              +VF +D  F  +A EA EVVW  GL+K+VG+  G +GNAYA LSLYRLTG   Y  RA+
Sbjct  338   YEVFHDDY-FEQSAAEAAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNVEYLYRAK  396

Query  1168  AFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             AF  FL   A  ++A     G  D  +SLF+G AG++ L  D++ P  SRFP YE+
Sbjct  397   AFACFLLEKADQLIAEGAMHG-GDRPFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  451



>ref|XP_006392852.1| hypothetical protein EUTSA_v10011533mg [Eutrema salsugineum]
 gb|ESQ30138.1| hypothetical protein EUTSA_v10011533mg [Eutrema salsugineum]
Length=409

 Score =   352 bits (903),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 188/386 (49%), Positives = 249/386 (65%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             +E   + A+SLKD VV  TW+ R G  V   D ++YTG+LGTAY   +S+Q T N  DL+
Sbjct  43    SEKLQRYALSLKDTVVRETWE-RSGKRVG--DYSLYTGVLGTAYLLFKSYQITRNEDDLK  99

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC +IV+ C  A+  + R +TF+CGR G+ ALGAV A + GD Q +D YL  F E+    
Sbjct  100   LCLEIVEACDVASRDSER-LTFICGRAGVCALGAVVAKHLGDDQLQDRYLADFREIRLPS  158

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP           ++LLYGRAG+LWA LF+ +H+G + V +  +  VVE I   GR   
Sbjct  159   GLP-----------HELLYGRAGYLWACLFLNKHIGKDTVSSARMRSVVEEIFREGRQLG  207

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                S CPLMY WHG RYWGAAHGLAGI++VL+H  L +D ++DVK TL YM  +RFP SG
Sbjct  208   KRGS-CPLMYEWHGKRYWGAAHGLAGIMHVLMHMELEQDEMQDVKVTLAYMFLHRFP-SG  265

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NY  SEGN  D LV WCHGATG+ +TL KA+QV     E  +AA+EAGEVVW  GL+K+V
Sbjct  266   NYLSSEGNESDCLVHWCHGATGVALTLVKAAQVL-RTVELVEAAMEAGEVVWNRGLLKRV  324

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GN Y  LSLYRLTG+  Y  RA+AF SFL   +  +++  +  G  D  +SLF
Sbjct  325   GICHGISGNTYVFLSLYRLTGKPEYLYRAKAFASFLLDKSEKLISEGEMHG-GDRPFSLF  383

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G+ G+A ++FD+  P  + FP YE+
Sbjct  384   EGIGGMAYMFFDMNDPTRALFPAYEL  409



>gb|AES74528.2| G protein coupled receptor [Medicago truncatula]
Length=441

 Score =   353 bits (905),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 265/426 (62%), Gaps = 33/426 (8%)
 Frame = +1

Query  88    PESNGTNHED---------GNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWK  240
             PES  +  ++         G DS    +  P AP     ++   +AA+ LK+ +V  TW 
Sbjct  39    PESTPSTQQELQEAVTVTTGGDSLLNLLAMPHAPL----SQRLKRAALDLKETIVMETWG  94

Query  241   ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHIT  420
               G       D T+Y GLLGTA+  L+S+  T N  DL LC+ IV +C  AA  + R +T
Sbjct  95    LTGQRV---GDFTLYCGLLGTAFLLLKSYHVTCNTNDLALCSQIVKSC-DAASLSSRDVT  150

Query  421   FLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGR  600
             F+CGR G+ ALGAVAA + GD +    YL  F ++   K LP            +LLYG+
Sbjct  151   FICGRAGVCALGAVAAKHAGDDESLRYYLAQFQQIKLPKDLPD-----------ELLYGK  199

Query  601   AGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAA  780
              GFLWA LF+ +HLG   VP+     VV+ I++ GRA       CPLM+ W+G +YWGAA
Sbjct  200   GGFLWACLFLNKHLGQGTVPSSYTATVVDEIIKNGRALGQKRK-CPLMFEWYGEKYWGAA  258

Query  781   HGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGA  957
             HGLAGI+NVL+   L  D +EDV+GTL+YM++NRFP SGNYP S+ + + D LV WCHGA
Sbjct  259   HGLAGIMNVLMDMELKPDELEDVRGTLKYMIHNRFP-SGNYPASDKDKKSDVLVHWCHGA  317

Query  958   TGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLT  1137
              G+ +TL KA++VF  D+EF DAA+EAGEVVW  GL+K+VG+  G +GNAY  LSLY+LT
Sbjct  318   PGMALTLVKAAKVF-GDKEFLDAAMEAGEVVWSRGLLKRVGICHGISGNAYVFLSLYQLT  376

Query  1138  GESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSR  1317
             G + Y  RA+AF  FL   A ++++G +  G  D  +SLF+G+ G+A L+ D++ P  S+
Sbjct  377   GNTKYLYRAKAFACFLLDGAHNLISGGEMHG-GDSPHSLFEGVGGMAYLFLDMVNPSQSK  435

Query  1318  FPGYEI  1335
             FP YE+
Sbjct  436   FPAYEL  441



>ref|XP_006348234.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=408

 Score =   352 bits (902),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 246/385 (64%), Gaps = 20/385 (5%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  360
             E   + A  LK+ +V  TW  + G      D TVYTG LGTA+   +++Q T ++ DL L
Sbjct  44    EKLKRVAFDLKETIVKETWVCKRGRV---SDYTVYTGALGTAFLLFKAYQVTLDKNDLVL  100

Query  361   CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  540
             C+DI+  C SA+  +  H+TF+CG+ G+Y+LGAV A +  D+Q  D YL  F E+   K 
Sbjct  101   CSDIIKACDSASRGS-GHVTFICGQAGVYSLGAVVAKHNEDEQLCDHYLTKFKEIELPKD  159

Query  541   LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSS  720
             LP            +LLYGRAGFLWA  F+ +++G E +    +  VV  +++ GR    
Sbjct  160   LP-----------NELLYGRAGFLWACSFLNKNIGRETISLTQIRAVVAEVIKSGR--KM  206

Query  721   DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGN  900
                 CPLMY WHG RYWGAAHGLAGI++VL+   L  D VEDVK TL Y++ NRFP SGN
Sbjct  207   GKGRCPLMYEWHGKRYWGAAHGLAGIMHVLMDMELKADEVEDVKATLHYIIRNRFP-SGN  265

Query  901   YPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVG  1080
             YP SEG+  D+LV WCHGA G+ +TL KA++VF ND E+  AA+EA EV+W  GL+K+VG
Sbjct  266   YPSSEGSESDRLVHWCHGAPGVALTLTKAAKVFSND-EYLQAAVEAAEVIWNRGLLKRVG  324

Query  1081  LADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQ  1260
             +  G +GN+Y  LSLYRLTG+  Y  +A+AF  FL+  A  +++     G  D  YSLF+
Sbjct  325   ICHGVSGNSYVFLSLYRLTGKVGYLYKAKAFACFLHARAQALISEGVMHG-GDRPYSLFE  383

Query  1261  GLAGVACLWFDLIAPHNSRFPGYEI  1335
             G+ G+A L+FD+I P  +RFP YE+
Sbjct  384   GIGGMAYLFFDMIDPMETRFPAYEL  408



>gb|EMS68258.1| LanC-like protein 2 [Triticum urartu]
Length=436

 Score =   352 bits (903),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/373 (50%), Positives = 238/373 (64%), Gaps = 19/373 (5%)
 Frame = +1

Query  217   QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             QVV  TW   GG      D T+YTG LGTA    +SFQ TG+R+DL L +DIV  C  AA
Sbjct  83    QVVQETWTRTGGQVT---DYTLYTGALGTALLLFKSFQVTGDRRDLNLASDIVQAC-DAA  138

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
                +  +TF+CGR G+ ALGAV A +C DQ    ++L  F E+   + +P          
Sbjct  139   SLGLPFLTFICGRAGVCALGAVIAKHCNDQLMETNFLSSFDEIIITEKVP----------  188

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
               +LLYGRAG+LWA LF+ +HL  + +P E +  V + I+  GR  S+  S CPLMY WH
Sbjct  189   -NELLYGRAGYLWACLFLNEHLSDKTIPAEHISSVAKDIIREGRKLSNKGS-CPLMYEWH  246

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             G +YWGAAHGLAGI++VL+H  L  D  +DVK TLRYM++NRFP SGNYP SE +  D+L
Sbjct  247   GKKYWGAAHGLAGIMHVLMHTELKLDEQDDVKNTLRYMISNRFP-SGNYPSSEDSESDRL  305

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             V WCHGA G+ +TL KA QVF +D  F+ +A EA EVVW  GL+K+VG+  G +GNAY  
Sbjct  306   VHWCHGAPGVALTLAKAYQVFQDD-HFKQSAAEAAEVVWNRGLLKRVGICHGISGNAYVF  364

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSLYRLTG   Y  RA+AF  FL  NA  ++A     G  D  +SLF+G AG+A L  D+
Sbjct  365   LSLYRLTGNVEYLYRAKAFACFLLENADRLIAEEAMHG-GDRPFSLFEGKAGMAYLLLDM  423

Query  1297  IAPHNSRFPGYEI  1335
             + P  SRFP YE+
Sbjct  424   VNPSESRFPAYEL  436



>ref|XP_007149603.1| hypothetical protein PHAVU_005G083500g [Phaseolus vulgaris]
 gb|ESW21597.1| hypothetical protein PHAVU_005G083500g [Phaseolus vulgaris]
Length=427

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 189/398 (47%), Positives = 249/398 (63%), Gaps = 20/398 (5%)
 Frame = +1

Query  145   LDPTAP-SFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLR  321
             L  + P +FIL          S+  QVV  TW +RG       D T+YTG LGTAY   +
Sbjct  49    LKQSVPKNFILNLWVSFNWLSSILVQVVRETWGSRGKRV---KDYTLYTGALGTAYLLFK  105

Query  322   SFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDS  501
             ++Q T +  DL LC++IV+ C SA+  + R +TFLCGR G+ ALGAV A + GD +  D 
Sbjct  106   AYQVTKDGNDLNLCSEIVEACHSASADSGR-VTFLCGRAGVCALGAVVAKHTGDDRLLDY  164

Query  502   YLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPV  681
             YL  F E+   +  P           Y+LLYGR G+LWA  F+ +H+G   +P   +  V
Sbjct  165   YLRQFKEIVIPRDSP-----------YELLYGRTGYLWACSFLNKHIGHNTIPTTHMRSV  213

Query  682   VEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTL  861
             V+ ++  GR        CPLMY WHG +YWGAAHGLAGI++VL+   L  D VE+VKGTL
Sbjct  214   VDEVISAGRQ-LGHKGRCPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEEVKGTL  272

Query  862   RYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAG  1041
             RYM+N RFP SGNYP SEG+  D+LV WCHGA GI +TL KA++VF  ++EF  AA++AG
Sbjct  273   RYMINYRFP-SGNYPSSEGSENDRLVHWCHGAPGIILTLVKAAEVF-GEKEFLQAAVDAG  330

Query  1042  EVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQ  1221
             EVVWK GL+K+VG+  G +GN Y  LSLYRLTG   Y   A+AFG FL   A  +++G +
Sbjct  331   EVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNEEYLYMAKAFGCFLLDRAQKLISGGK  390

Query  1222  GDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               G  D  YSLF+GL G+A    D++ P  ++FPGYE 
Sbjct  391   MHG-GDRPYSLFEGLGGMAYTCLDMVDPKMAKFPGYEF  427



>tpg|DAA49459.1| TPA: hypothetical protein ZEAMMB73_373795 [Zea mays]
Length=449

 Score =   352 bits (903),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 195/415 (47%), Positives = 259/415 (62%), Gaps = 22/415 (5%)
 Frame = +1

Query  91    ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHM  270
             E+  ++ E    +G R +L   +  +   ++ F++AA  LKD+VV+ TW  + G  VT  
Sbjct  57    EAEASDGEGHRPAGHRGLL---SLPYTRLSDHFVRAARRLKDKVVEETW-VKAGRKVT--  110

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D T+YTG LGTA    +SFQ TG+R DL L ADIV  C  A+   +  +TF+CGR G+ A
Sbjct  111   DYTLYTGSLGTALLLFKSFQVTGDRGDLALAADIVRACDDASRG-LPFLTFICGRAGVCA  169

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             LGAV A +C DQ +   YL  F E+   + +P            +LLYGRAG+LWA LF+
Sbjct  170   LGAVIAKHCDDQLRVTQYLSSFDEITITEKVP-----------NELLYGRAGYLWACLFL  218

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVL  810
              +HL  + +P + +  V + I+  GR  +S  S  PLMY WHG +YWGAAHGLAGI++VL
Sbjct  219   NKHLSEKTIPLDHINSVAKDIINEGRGFASKGS-SPLMYEWHGKKYWGAAHGLAGIMHVL  277

Query  811   LHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKAS  990
             +H  L  D  +DVK TLRYM+ N+FP SGNYP SEGN  D LV WCHGA G+ +TL KA 
Sbjct  278   MHTELKPDEQDDVKNTLRYMIKNKFP-SGNYPSSEGNESDHLVHWCHGAPGVALTLAKAY  336

Query  991   QVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARA  1170
             +VF +D  F  +A EA EVVW  GL+K+VG+  G +GNAYA LSLYRLTG   Y  RA+A
Sbjct  337   EVFHDDY-FEQSAAEAAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNVEYLYRAKA  395

Query  1171  FGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F  FL   A  ++A     G  D  +SLF+G AG++ L  D++ P  SRFP YE+
Sbjct  396   FACFLLEKADQLIAEGAMHG-GDRPFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  449



>ref|XP_011085355.1| PREDICTED: lanC-like protein GCL2 [Sesamum indicum]
Length=422

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 249/389 (64%), Gaps = 24/389 (6%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++   +AA+ LK+ +V  TW A G       D T+YTG LGTA+   +SFQ  GN+ DL 
Sbjct  55    SQKLQRAALDLKETIVVETWGATGQRV---EDFTLYTGTLGTAFILFKSFQVAGNKNDLS  111

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC +IV  C S++ A+ R +TF+CGR G+ ALGAV A Y GD      YL  F E+   K
Sbjct  112   LCLEIVKACDSSS-ASSRDVTFICGRAGVCALGAVVAKYIGDDNLLQHYLAQFKEIRLSK  170

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRA-G  714
               P            +LLYGRAG+LW  LF+ +HLG E +P+ +   +V  ++  GR  G
Sbjct  171   DHPD-----------ELLYGRAGYLWTCLFLNKHLGKETIPSTSTGAIVREVISKGRKLG  219

Query  715   SSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHS  894
              +  S  PLM+ W+G RYWGAAHGLAGI +VL+ F L+ D  EDVKGTLRYMM NRFP S
Sbjct  220   EAGGS--PLMFEWYGERYWGAAHGLAGISHVLMEFELTSDEREDVKGTLRYMMKNRFP-S  276

Query  895   GNYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVK  1071
             GNYP SE +  RD LV WCHGA GI +TL KA++VF  D+EF +AA++A EVVW  GL+K
Sbjct  277   GNYPASEEDKKRDVLVHWCHGAPGIALTLIKAAEVF-GDKEFLEAAMDAAEVVWNRGLLK  335

Query  1072  KVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGD-GAADHAY  1248
             +VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  +M  S GD    D+  
Sbjct  336   RVGICHGISGNAYVFLSLYRLTGIVEYLYRAKAFACFLLDRAHMLM--STGDLHGGDNPS  393

Query  1249  SLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             SLF+G+ G+A L+ D++ P N+RFP YE+
Sbjct  394   SLFEGIGGMAHLFLDMVQPKNARFPAYEL  422



>ref|XP_008452475.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Cucumis melo]
Length=415

 Score =   350 bits (898),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 184/384 (48%), Positives = 247/384 (64%), Gaps = 22/384 (6%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  372
             Q A++LK+ VV  TW   G       D T+YTG LGTA+  L+SF    N  DL+LC++I
Sbjct  51    QTALNLKETVVRETWTLSGRHP---QDYTLYTGALGTAFLALKSFLVFKNENDLKLCSEI  107

Query  373   VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  552
             V  C S +  + RH+TF+CGR G+ ALGAVAA +  D    D YL+ F ++     LP  
Sbjct  108   VAACESLSKKS-RHVTFICGRAGVCALGAVAAKFANDGMLVDHYLEKFKDIKLPSDLP--  164

Query  553   PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLM---PVVEAILEGGRAGSSD  723
                       +LLYGRAGFLWA LF+ +H+G   + N  ++    VV+ ++E GR     
Sbjct  165   ---------NELLYGRAGFLWACLFLNKHIGRNTISNTFMVFHRSVVDEVIEAGRR-LGQ  214

Query  724   NSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNY  903
              S  PLMY WHG +YWGAAHGLAGI++VL+   L  D VEDVK TLRYM+ NRF  SGNY
Sbjct  215   KSKSPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEDVKNTLRYMIKNRFL-SGNY  273

Query  904   PVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGL  1083
             P SE +  D+LV WCHGA G+ +TL KA++VF +D EF  AAI+AGEVVW  GL+K+VG+
Sbjct  274   PSSEESESDRLVHWCHGAPGVALTLGKAAEVFGDD-EFLQAAIDAGEVVWNRGLLKRVGI  332

Query  1084  ADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQG  1263
               G +GN Y  LSLYRLTG+  Y  RA+AF  FL+ NA  +++  +   + D  YSLF+G
Sbjct  333   CHGISGNTYVFLSLYRLTGDLTYLHRAKAFACFLHQNAEKLISEGKMH-SGDCPYSLFEG  391

Query  1264  LAGVACLWFDLIAPHNSRFPGYEI  1335
             + G+A L+ D++ P+ ++FP YE+
Sbjct  392   IGGMAYLFLDMVEPYAAKFPSYEL  415



>ref|XP_006661914.1| PREDICTED: lanC-like protein GCR2-like [Oryza brachyantha]
Length=399

 Score =   348 bits (893),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 245/386 (63%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             A+    AA+ +KD+VV+ TW  R    VT  D T+YTG LGTA    +SFQ TG+R DL 
Sbjct  33    ADRLRAAALRIKDEVVEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGDRADLS  89

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             L  DIV  C  AA   +  +TF+CGR G+ ALGA+ A +  DQ     YL  F E+   +
Sbjct  90    LAGDIVKEC-DAASRGLPFLTFICGRAGVCALGAMIAKHSDDQLLVTHYLSKFDEILVTE  148

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGRAG+LWA LF+  HLG + +P   +  V + I+E GR  S
Sbjct  149   NVP-----------NELLYGRAGYLWACLFLNTHLGEKTIPIGHITSVAKDIIEEGRKLS  197

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             +  S CPLMY WHG +YWGAAHGLAGI++VL+H  L  D  +DVK TL YM+ NR+P SG
Sbjct  198   NRVS-CPLMYEWHGKKYWGAAHGLAGIMHVLMHTELEPDEKDDVKNTLLYMIRNRYP-SG  255

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+ +A EA EVVW  GL+K+V
Sbjct  256   NYPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQSAAEAAEVVWNRGLLKRV  314

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAY  LSLYRLTG   Y  RA+AF  FL  +A  ++A     G  DH +SLF
Sbjct  315   GICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLESADRLIADGTMHG-GDHPFSLF  373

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G AG+A L  D+I+P  S+FP YE+
Sbjct  374   EGKAGMAYLLLDMISPSESKFPAYEL  399



>ref|XP_011098332.1| PREDICTED: lanC-like protein GCR2 [Sesamum indicum]
Length=403

 Score =   348 bits (893),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/386 (47%), Positives = 251/386 (65%), Gaps = 25/386 (6%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             +E   +AA+ LKD VV               D T+YTG LGTA+   +++Q TG++ DL 
Sbjct  43    SEGLKKAALDLKDTVVK--------EXXXXGDYTLYTGALGTAFLLFKAYQITGDKNDLA  94

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC+DI++ C SA+  + R +TF+CGR G+YALGAVAA++ GD++    YL  F E+   K
Sbjct  95    LCSDIIEACDSASRGSGR-VTFICGRAGVYALGAVAAHHKGDKELCHQYLAQFKEIKLSK  153

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGRAGFLWA+ F+ +++G + + +  +  VV+ I++ GR  +
Sbjct  154   DLPD-----------ELLYGRAGFLWASSFLNKNIGKDTISSTRMRAVVDEIIKSGRQLA  202

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                  CPLM+ WHG RYWGAAHGLAGI+ VL+   L+ D VE VKGTLRYM+ NRFP SG
Sbjct  203   KGR--CPLMFEWHGKRYWGAAHGLAGIMYVLMDMDLTPDEVEHVKGTLRYMIKNRFP-SG  259

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA++VF ++ EF  AAI+AGEVVW  GL+K+V
Sbjct  260   NYPSSEGSETDRLVHWCHGAPGVALTLAKAAKVFASE-EFLQAAIDAGEVVWNRGLLKRV  318

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAY  LSLY+LTG+  +  RA+AF  FL H+   I+         D  YSLF
Sbjct  319   GVCHGISGNAYIFLSLYQLTGKQEFLYRAKAFACFL-HDRAQILISEGIIHGGDRPYSLF  377

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G+ G+A L+ D+  P  +RFP YE+
Sbjct  378   EGIGGMAYLFLDMTEPSQARFPAYEL  403



>ref|XP_010542278.1| PREDICTED: lanC-like protein GCR2 [Tarenaya hassleriana]
Length=408

 Score =   348 bits (893),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 190/417 (46%), Positives = 258/417 (62%), Gaps = 24/417 (6%)
 Frame = +1

Query  88    PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  267
             PE+ G   E G       +L     SF   ++   + A+ LKD V   TW     S    
Sbjct  15    PEAGGEEIEAGTKDSLEKLLCLPYRSF---SDRLRRYALDLKDTVARQTWIL---SEKRV  68

Query  268   MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  447
              D T+YTG LGTA+   +++QAT N  DLRLC+DI+  C SA+  +   +TF+CGR G+ 
Sbjct  69    QDYTLYTGSLGTAFLLFKAYQATKNENDLRLCSDIIKACDSASRNS-GPVTFICGRAGVC  127

Query  448   ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  627
             ALGAV A + GD +  D YL  F E+     LP            +LLYGRAG LWA LF
Sbjct  128   ALGAVVAKHIGDDRLLDHYLTRFDEIRLPSDLPC-----------ELLYGRAGCLWACLF  176

Query  628   IKQHLGSEAVPNETLMPVVEAILEGGRA-GSSDNSMCPLMYRWHGTRYWGAAHGLAGILN  804
             + +H+G E V    +  VVE I   GR  G +  S  PLMY WHG +YWGAAHGL+GI++
Sbjct  177   LNKHIGEERVSPARMRSVVEEIFSSGRQLGRTGRS--PLMYEWHGKKYWGAAHGLSGIMH  234

Query  805   VLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCK  984
             VL+H  L  D ++DVKGTL Y+M NRFP SGNY  SEGN  D+LV WCHGA G+ +TL K
Sbjct  235   VLMHMELRPDEIKDVKGTLHYIMKNRFP-SGNYRSSEGNESDRLVHWCHGAPGVALTLVK  293

Query  985   ASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERA  1164
             A++VF  + EF +AA+EAGEVVW  GL+K+VG+  G +GNA+  LSLYR+TG++ Y  RA
Sbjct  294   AAEVFGTE-EFLEAAVEAGEVVWNRGLLKRVGICHGISGNAFVFLSLYRVTGKAEYLYRA  352

Query  1165  RAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +AF +FL   +  +++     G  D  +S+F+G+ G+A L+FD+  P  +RFPG+++
Sbjct  353   KAFAAFLLDRSEKLISEGNMHG-GDRPFSIFEGIGGMAYLFFDMNDPSGARFPGFQL  408



>ref|XP_002534246.1| catalytic, putative [Ricinus communis]
 gb|EEF28136.1| catalytic, putative [Ricinus communis]
Length=419

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 187/385 (49%), Positives = 243/385 (63%), Gaps = 19/385 (5%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  360
             +T  ++A  L+D VV  TW   G S     D TVYTG+LGTAY   +++Q T N  DL L
Sbjct  54    DTLKRSAFELRDMVVKETW---GLSGKRVQDYTVYTGVLGTAYLLFKAYQVTKNENDLNL  110

Query  361   CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  540
              + IV  C SA+  + R +TF+CGR G+YALGAV A + GD++  D YL  F E+     
Sbjct  111   SSQIVKACDSASIDSGR-VTFICGRAGVYALGAVIAKHAGDERLLDHYLTRFKEIKFPSD  169

Query  541   LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSS  720
             LP            +LLYGRAGFLWA  F+ +H+  E +       VV  I + GR   +
Sbjct  170   LP-----------NELLYGRAGFLWACSFLNKHIDKEIISAGRQRAVVNEINKAGRK-LA  217

Query  721   DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGN  900
                  PLMY WHG +YWGAAHGLAGI++VL++  L  D  EDVK TLRYM+NNRF  SGN
Sbjct  218   HRERYPLMYEWHGKKYWGAAHGLAGIMHVLMNMELRPDETEDVKRTLRYMINNRF-RSGN  276

Query  901   YPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVG  1080
             YP SEGN  D+LV WCHGA G+ +TL KA++VF  D+EF  AA+EA EVVW  GL+K+VG
Sbjct  277   YPSSEGNESDRLVHWCHGAPGVALTLVKAAEVF-GDQEFLQAAMEAAEVVWNWGLLKRVG  335

Query  1081  LADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQ  1260
             L  G +GN Y  LSLY+LTG   Y  RA+AF  F++  A  +++  +  G  D  YSLF+
Sbjct  336   LCHGISGNTYVFLSLYQLTGNMEYLYRAKAFACFIHDRAQKLISEGKMHG-GDRPYSLFE  394

Query  1261  GLAGVACLWFDLIAPHNSRFPGYEI  1335
             G+ G+A L+FD+I P  +RFP YE+
Sbjct  395   GVGGMAYLFFDMIEPSEARFPAYEL  419



>ref|XP_007212308.1| hypothetical protein PRUPE_ppa006721mg [Prunus persica]
 gb|EMJ13507.1| hypothetical protein PRUPE_ppa006721mg [Prunus persica]
Length=398

 Score =   347 bits (890),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 183/380 (48%), Positives = 243/380 (64%), Gaps = 19/380 (5%)
 Frame = +1

Query  196   AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  375
             +A+ LK+ VV  TW   G S     D T+YTG+LGTA+   +++Q T N  DL+LC +IV
Sbjct  38    SALDLKETVVRQTW---GLSGKRVEDYTLYTGVLGTAFLAFKAYQVTKNENDLKLCCEIV  94

Query  376   DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  555
               C SA+  + R ++F CGR G+ ALGAV A + GDQ   D YL  F E+     LP   
Sbjct  95    KACDSASRGSGR-VSFTCGRAGVCALGAVVAKHAGDQMLLDRYLSQFKEIKLPSDLP---  150

Query  556   EEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMC  735
                      +LLYGRAGFLWA  F+ +H+G+  + N  +  VV+ I++ GR   +     
Sbjct  151   --------NELLYGRAGFLWACSFLNKHIGNGTISNTYMRSVVDEIIKAGRQ-LAKKGRS  201

Query  736   PLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSE  915
              LMY WHG +YWGAAHGLAGI++VL+   L  D VEDVKGTLRYM+ NRFP SGN+P SE
Sbjct  202   SLMYEWHGKKYWGAAHGLAGIMHVLMSMQLKPDEVEDVKGTLRYMIKNRFP-SGNFPSSE  260

Query  916   GNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGT  1095
             G+  D+LV WCHGA G+ +TL +A++VF  D EF  AAI+AGEVVW  GL+K+VG+  G 
Sbjct  261   GSESDRLVHWCHGAPGVALTLVRAAEVF-GDLEFLQAAIDAGEVVWNRGLLKRVGICHGI  319

Query  1096  AGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGV  1275
             +GN Y  LSLYRLTG+  Y  RA+AF  FL+  A ++++     G  D  YSLF+G+ G+
Sbjct  320   SGNTYVFLSLYRLTGKVEYLYRAKAFACFLHDRALNLISEGAMHG-GDRPYSLFEGVGGM  378

Query  1276  ACLWFDLIAPHNSRFPGYEI  1335
             A L  D+  P  +RFP YE+
Sbjct  379   AHLLLDMTEPSEARFPAYEL  398



>ref|XP_010918434.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Elaeis guineensis]
Length=404

 Score =   347 bits (890),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/386 (47%), Positives = 243/386 (63%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             A+  L+AA+ LK++VV  TW    G A    D T+YTG LGTA+   +++Q T NR DL 
Sbjct  38    ADKLLRAALDLKEKVVKETWVRLRGRA---KDFTLYTGALGTAFLLFKAYQVTNNRGDLS  94

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC++I+  C  A+     H+TF+CGR G+ ALGAV A + GD+   + YL  F  +    
Sbjct  95    LCSEIIRACDVASQGD-PHVTFICGRAGVCALGAVVAKHAGDEALLNHYLSSFRGIRMRG  153

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGR G+LWA  F+ +H+G   +P   +  + + I+  G+   
Sbjct  154   KVP-----------NELLYGRVGYLWACCFLNKHIGEGTIPTTHMGALAKEIITDGKR-L  201

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             S+   CPLMY WHG +YWGAAHGLAGI++VL+   L  D  ED+KGTL+YM+ NRFP SG
Sbjct  202   SNRGRCPLMYEWHGKKYWGAAHGLAGIMHVLMDMDLKPDEKEDIKGTLQYMIRNRFP-SG  260

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KASQVF  + +F   A+EA EVVW  GL+K+V
Sbjct  261   NYPSSEGSNNDRLVHWCHGAPGVSLTLTKASQVF-QEEQFLQVAVEAAEVVWNRGLLKRV  319

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAY  LSLYRLTG+  Y  RA+AF  FL   A  ++A     G  D  YSLF
Sbjct  320   GICHGISGNAYVFLSLYRLTGKVEYLYRAKAFACFLLDKANKLIADGLMHG-GDRPYSLF  378

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G AG+A L+ D++ P  SRFP YE+
Sbjct  379   EGQAGMAHLFLDMVRPSESRFPAYEL  404



>ref|XP_003539910.1| PREDICTED: lanC-like protein GCL2-like [Glycine max]
 gb|KHN31966.1| LanC-like protein 2 [Glycine soja]
Length=414

 Score =   345 bits (885),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 191/405 (47%), Positives = 256/405 (63%), Gaps = 24/405 (6%)
 Frame = +1

Query  124   DSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGT  303
             DS  + +  P AP      E   +AA+ LK+ +V  TW   G S     D T+Y G+LGT
Sbjct  33    DSLPKLLAMPHAPLL----ERLKRAALDLKETIVIETW---GLSGQQVRDFTLYCGVLGT  85

Query  304   AYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGD  483
             A+   +S++ TGN  DL LC++IV  C  AA A  R +TF+CGR G+ +LGAVAA + GD
Sbjct  86    AFLLFKSYRVTGNGNDLSLCSEIVKAC-DAASARSRDVTFICGRAGVCSLGAVAAKHAGD  144

Query  484   QQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPN  663
              +    YL  F ++   K LP            +LLYGR GFLWA LF+ +HLG   VP+
Sbjct  145   DESLKYYLAQFKKIKLSKDLPD-----------ELLYGRVGFLWACLFLNKHLGLGTVPS  193

Query  664   ETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVE  843
                  VV+ +++ GRA       CPLM+ W+G +YWGAAHGLAGI++VL+   L  D +E
Sbjct  194   NYTAVVVDEVIKNGRA-LGRKGRCPLMFEWYGEKYWGAAHGLAGIMHVLMDMELKPDELE  252

Query  844   DVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFR  1020
             DV+GTL+YM++NRF  SGNYPVSE + + D LV WCHGA G+ +TL KA++VF  D+EF 
Sbjct  253   DVRGTLKYMISNRF-RSGNYPVSEDDRKSDALVHWCHGAPGMALTLVKAAKVF-GDKEFL  310

Query  1021  DAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAG  1200
             DAAIEA EVVW  GL+KKVG+  G +GNAY  LSLY+LTG+  Y  RA+AF  FL   A 
Sbjct  311   DAAIEAAEVVWNRGLLKKVGICHGISGNAYVFLSLYQLTGDVKYLYRAKAFACFLLDRAH  370

Query  1201  DIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              +++  +  G  D  YS+F+GL G+A L+ D+  P  S+FP YE+
Sbjct  371   KLISRGEMHG-GDRPYSMFEGLGGMAYLFLDMSDPSLSKFPAYEL  414



>ref|XP_009400288.1| PREDICTED: lanC-like protein GCL2 [Musa acuminata subsp. malaccensis]
Length=403

 Score =   344 bits (882),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 243/386 (63%), Gaps = 20/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             A+ FL+AA+ LK++VV  TW  R G  V   D T+YTG LGTA+   +++Q T N  DL 
Sbjct  38    ADKFLRAALDLKEKVVKETW-LRNGRRVK--DFTLYTGALGTAFLLFKAYQVTNNLSDLS  94

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC +I+  C S +  + RH+TF+CGR G+ ALGAV A   GD    + YL  F E+    
Sbjct  95    LCGEIIRACDSVSAGS-RHVTFICGRAGVCALGAVVAKQAGDNVLLNHYLSSFREIKMRD  153

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
                  P E        LLYG+ G+LWA  F+ +H+G   +P+  + PV + I+  G+  S
Sbjct  154   V----PNE--------LLYGKVGYLWACSFLNKHIGESTIPSTHMSPVAKEIILDGKRLS  201

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             +  S CPLMY WHG +YWGAAHGLAGI++VL+   L  +  E +KGTL YM+N+RFP SG
Sbjct  202   NKGS-CPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPEDKECIKGTLSYMINHRFP-SG  259

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP S+G+  D+LV WCHGA G+ +TL KASQVF  D +   AA EA +VVW  GL+K+V
Sbjct  260   NYPSSQGSNSDRLVHWCHGAPGVALTLIKASQVF-QDEQILGAAEEAAKVVWSRGLLKRV  318

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GN Y  LSLYRLTG   Y  RA+AF  FL   A  ++A  +   + D  YS+F
Sbjct  319   GICHGISGNTYVFLSLYRLTGRVEYLYRAKAFACFLLDRANQLIADGRMH-SGDRPYSMF  377

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G AG+A L+ D+I P  SRFP YE+
Sbjct  378   EGQAGMAHLFLDMIRPSESRFPAYEL  403



>gb|EAZ16566.1| hypothetical protein OsJ_32039 [Oryza sativa Japonica Group]
Length=461

 Score =   346 bits (887),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 184/373 (49%), Positives = 237/373 (64%), Gaps = 19/373 (5%)
 Frame = +1

Query  217   QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             QV++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L  DIV  C  AA
Sbjct  108   QVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLALAGDIVKEC-DAA  163

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
                +  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   + +P          
Sbjct  164   SRGLPFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEKVP----------  213

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
               +LLYGRAG+LWA LF+  HLG + +P+E +  V + I++ GR  +   + CPLMY WH
Sbjct  214   -NELLYGRAGYLWACLFLNTHLGEKTIPHEHITSVAKDIIDEGRKLAKKGN-CPLMYEWH  271

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             G +YWGAAHGLAGI++VL+H  L  D  +DVK TL YM+ NR+P +GNYP SEG+  D+L
Sbjct  272   GKKYWGAAHGLAGIMHVLMHTELKLDEKDDVKNTLLYMIRNRYP-TGNYPSSEGSESDRL  330

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             V WCHGA G+ +TL KA QVF +D  F+  A EA EVVW  GL+K+VG+  G +GNAY  
Sbjct  331   VHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAEAAEVVWNRGLLKRVGICHGVSGNAYVF  389

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSLYRLTG   Y  RA+AF  FL   A  ++A     G  DH +SLF+G AG+A L  D+
Sbjct  390   LSLYRLTGNVEYLYRAKAFACFLLEKADQLIADGAMHG-GDHPFSLFEGRAGMAYLLLDM  448

Query  1297  IAPHNSRFPGYEI  1335
             ++P  S+FP YE+
Sbjct  449   VSPSESKFPAYEL  461



>ref|XP_008226665.1| PREDICTED: lanC-like protein GCR2 [Prunus mume]
Length=409

 Score =   344 bits (882),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 185/398 (46%), Positives = 245/398 (62%), Gaps = 23/398 (6%)
 Frame = +1

Query  148   DPTAPSFILPAETF----LQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  315
             D       LP ET       +A+ LK+ VV  TW   G S     D T+YTG+LGTA+  
Sbjct  29    DSLTKLLSLPYETLSDMLKSSALDLKETVVRQTW---GLSGKRVEDYTLYTGVLGTAFLA  85

Query  316   LRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKR  495
              +++Q T N  DL+LC++IV  C SA+  + R ++F CGR G+ ALGAV A + GDQ   
Sbjct  86    FKAYQVTKNENDLKLCSEIVKACDSASRGSGR-VSFTCGRAGVCALGAVVAKHAGDQMLL  144

Query  496   DSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLM  675
             D YL  F E+     LP            +LLYGRAGFLWA  F+ +H+G+  +    + 
Sbjct  145   DRYLSQFKEIKLPSDLP-----------NELLYGRAGFLWACSFLNKHIGNGTISTTRMR  193

Query  676   PVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKG  855
              VV+ I++ GR   +      LMY WHG +YWGAAHGLAGI++VL+   L  D VEDVKG
Sbjct  194   SVVDEIIKAGRQ-LAKKGRSSLMYEWHGKKYWGAAHGLAGIMHVLMSMQLKPDEVEDVKG  252

Query  856   TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  1035
             TL YM+ NRFP SGN+P SEG   D+LV WCHGA G+ +TL +A++VF  D+EF  AAI+
Sbjct  253   TLHYMIKNRFP-SGNFPSSEGTESDRLVHWCHGAPGVALTLVRAAEVF-GDKEFLQAAID  310

Query  1036  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  1215
             AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+  Y  RA+AF  FL+  A ++++ 
Sbjct  311   AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKVEYLYRAKAFACFLHDRALNLISE  370

Query  1216  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGY  1329
                 G  D  YSLF+G+ G+A L  D+  P  +RFP Y
Sbjct  371   GTMHG-GDRPYSLFEGVGGMAHLLLDMTEPSEARFPAY  407



>gb|AGV54697.1| lanC-like protein 2 [Phaseolus vulgaris]
Length=405

 Score =   343 bits (881),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 238/386 (62%), Gaps = 19/386 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             +E F  +A  LK  VV  TW +RG       D T+YTG LGTAY   +++Q T +  DL 
Sbjct  39    SEKFQASAFHLKQSVVRETWGSRGKRV---KDYTLYTGALGTAYLLFKAYQVTKDGNDLN  95

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC++IV+ C SA+  + R +TFLCGR G+ ALGAV A + GD +  D YL  F E+   +
Sbjct  96    LCSEIVEACHSASADSGR-VTFLCGRAGVCALGAVVAKHTGDDRLLDYYLRQFKEIVIPR  154

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
               P           Y+LLYGR G+LWA  F+ +H+G   +P   +  VV+ ++  GR   
Sbjct  155   DSP-----------YELLYGRTGYLWACSFLNKHIGHNTIPTTHMRSVVDEVISAGRQ-L  202

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                  CP MY WHG +YWGAAHGLAGI++VL+   L  D VE+VKGTLRYM+N RFP SG
Sbjct  203   GHKGRCPXMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEEVKGTLRYMINYRFP-SG  261

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+ V WCHGA GI  TL KA +VF   +EF  AA++AGEVVWK GL+K+V
Sbjct  262   NYPSSEGSENDRFVHWCHGAPGIIFTLVKAGEVF-GGKEFLQAAVDAGEVVWKRGLLKRV  320

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GN Y    LYRLTG   Y   A+AFG FL   A  +++G +  G  D  YSLF
Sbjct  321   GICHGISGNPYVFFFLYRLTGNEEYLYMAKAFGCFLLDRAQKLISGGKMHG-GDCPYSLF  379

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G  G+A    D++ P  ++FPGYE 
Sbjct  380   EGFGGMAYTCLDMVDPKMAKFPGYEF  405



>ref|XP_010241998.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nelumbo nucifera]
Length=409

 Score =   343 bits (881),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 187/411 (45%), Positives = 258/411 (63%), Gaps = 18/411 (4%)
 Frame = +1

Query  103   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  282
             TN E G +    ++L   +  +   A    + A+ LK+ +V  TW   G S     D T+
Sbjct  17    TNDETGAEGIEDSLLKLLSLPYPTLAAKLKRTALDLKETIVTNTW---GFSGRCVSDFTL  73

Query  283   YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAV  462
             YTG LGTA+   +++QAT N+ DL LCA+IV  C SA+  +   +TF+CGR G+ +LGA+
Sbjct  74    YTGSLGTAFLLFKAYQATKNKNDLNLCAEIVKACDSASSGSGSDVTFICGRAGVCSLGAI  133

Query  463   AANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHL  642
             AA + G++Q  + YL  F E+   K +P            +LLYGRAGFLWA LFI +H+
Sbjct  134   AAKHAGNEQLLNHYLTQFKEIKLPKNVP-----------NELLYGRAGFLWACLFINKHI  182

Query  643   GSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFP  822
             G   +P+    PVV+ I++ GR  +S  S CPLM+ W+GT+YWGAAHGLAGI++VL+   
Sbjct  183   GKGTIPSTLTGPVVKEIIKDGRRLASKVS-CPLMFEWYGTKYWGAAHGLAGIMHVLMDME  241

Query  823   LSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFP  1002
             L  D ++DV  TL YM+ NRF  SGNYP SE +  D LV WCHGA G+ +TL KA++VF 
Sbjct  242   LKPDELQDVNDTLSYMIKNRF-SSGNYPSSEDDGTDCLVHWCHGAPGVALTLVKAAEVF-  299

Query  1003  NDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSF  1182
               R+F  AA +AGEVVW  GL+K+VG+  G +GNAY  LSLYRLTG   +  RA+AF  F
Sbjct  300   GGRQFLKAAGDAGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNLEFLYRAKAFACF  359

Query  1183  LYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             L   A  +++  +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  360   LLDMAPKLISEGKMHG-GDSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL  409



>gb|EMT26581.1| LanC-like protein 2 [Aegilops tauschii]
Length=579

 Score =   349 bits (895),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 185/373 (50%), Positives = 238/373 (64%), Gaps = 19/373 (5%)
 Frame = +1

Query  217   QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             QVV  TW   GG      D T+YTG LGTA    +SFQ TG+R+DL L ++IV  C  AA
Sbjct  226   QVVQETWTRTGGHVT---DYTLYTGALGTALLLFKSFQVTGDRRDLNLASEIVQAC-DAA  281

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
                +  +TF+CGR G+ ALGAV A +C DQ    ++L  F E+   + +P          
Sbjct  282   SLGLPFLTFICGRAGVCALGAVIAKHCNDQLMETNFLSSFDEIIITEKVP----------  331

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
               +LLYGRAG+LWA LF+ +HL  + +P E +  V + I+  GR  S+  S CPLMY WH
Sbjct  332   -NELLYGRAGYLWACLFLNEHLSDKTIPAEHISSVAKDIIMEGRKLSNKGS-CPLMYEWH  389

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             G +YWGAAHGLAGI++VL+H  L  D  +DVK TLRYM++NRFP SGNYP SE +  D+L
Sbjct  390   GKKYWGAAHGLAGIMHVLMHTELKLDEQDDVKNTLRYMISNRFP-SGNYPSSEDSESDRL  448

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             V WCHGA G+ +TL KA QVF +D  F+ +A EA EVVW  GL+K+VG+  G +GNAY  
Sbjct  449   VHWCHGAPGVALTLAKAYQVFQDD-HFKQSAAEAAEVVWNRGLLKRVGICHGISGNAYVF  507

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSLYRLTG   Y  RA+AF  FL  NA  ++A     G  D  +SLF+G AG+A L  D+
Sbjct  508   LSLYRLTGNVEYLYRAKAFACFLLENADRLIAEEAMHG-GDRPFSLFEGKAGMAYLLLDM  566

Query  1297  IAPHNSRFPGYEI  1335
             + P  SRFP YE+
Sbjct  567   VNPSESRFPAYEL  579



>ref|XP_010241999.1| PREDICTED: lanC-like protein GCL2 isoform X3 [Nelumbo nucifera]
Length=408

 Score =   343 bits (880),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/411 (45%), Positives = 258/411 (63%), Gaps = 19/411 (5%)
 Frame = +1

Query  103   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  282
             TN E G +    ++L   +  +   A    + A+ LK+ +V  TW   G S     D T+
Sbjct  17    TNDETGAEGIEDSLLKLLSLPYPTLAAKLKRTALDLKETIVTNTW---GFSGRCVSDFTL  73

Query  283   YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAV  462
             YTG LGTA+   +++QAT N+ DL LCA+IV  C SA+  +   +TF+CGR G+ +LGA+
Sbjct  74    YTGSLGTAFLLFKAYQATKNKNDLNLCAEIVKACDSASSGS-GDVTFICGRAGVCSLGAI  132

Query  463   AANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHL  642
             AA + G++Q  + YL  F E+   K +P            +LLYGRAGFLWA LFI +H+
Sbjct  133   AAKHAGNEQLLNHYLTQFKEIKLPKNVP-----------NELLYGRAGFLWACLFINKHI  181

Query  643   GSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFP  822
             G   +P+    PVV+ I++ GR  +S  S CPLM+ W+GT+YWGAAHGLAGI++VL+   
Sbjct  182   GKGTIPSTLTGPVVKEIIKDGRRLASKVS-CPLMFEWYGTKYWGAAHGLAGIMHVLMDME  240

Query  823   LSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFP  1002
             L  D ++DV  TL YM+ NRF  SGNYP SE +  D LV WCHGA G+ +TL KA++VF 
Sbjct  241   LKPDELQDVNDTLSYMIKNRF-SSGNYPSSEDDGTDCLVHWCHGAPGVALTLVKAAEVF-  298

Query  1003  NDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSF  1182
               R+F  AA +AGEVVW  GL+K+VG+  G +GNAY  LSLYRLTG   +  RA+AF  F
Sbjct  299   GGRQFLKAAGDAGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNLEFLYRAKAFACF  358

Query  1183  LYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             L   A  +++  +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  359   LLDMAPKLISEGKMHG-GDSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL  408



>ref|XP_012088306.1| PREDICTED: lanC-like protein GCL2 [Jatropha curcas]
 gb|KDP24150.1| hypothetical protein JCGZ_25807 [Jatropha curcas]
Length=414

 Score =   343 bits (880),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/412 (45%), Positives = 259/412 (63%), Gaps = 23/412 (6%)
 Frame = +1

Query  103   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  282
             +  E+ +      +L    PS    ++ F +AA+ LK+ +V  TW   G +A +  D T+
Sbjct  25    SEKEETSGDSLMKLLSMPYPSL---SQRFQRAALDLKETIVMETW---GVNAQSVQDFTL  78

Query  283   YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAV  462
             Y+G LGTA+  L+++Q + N+ DL LC  IV  C SA+ A+ R +TF+CGR G+ A+GAV
Sbjct  79    YSGSLGTAFFLLKTYQVSNNKNDLSLCLQIVKACDSASLAS-RDLTFICGRAGVCAIGAV  137

Query  463   AANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHL  642
             AA +  D+  ++ YL+ F EV   +  P            +LLYGR+G+LWA LF+ +H+
Sbjct  138   AAKHANDEALKNYYLNQFGEVKLSRDHPD-----------ELLYGRSGYLWACLFLNKHI  186

Query  643   GSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFP  822
             G   +P  T+  V   I++ GR  + D    PLMY W+G RYWGAAHGLAGI++VL+   
Sbjct  187   GEGTIPPTTIRAVASEIIKNGRELAKDGG-PPLMYEWYGERYWGAAHGLAGIMHVLMDVE  245

Query  823   LSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVF  999
             L  D VEDVKGTL YM+ NRFP SGNYP SE +  RD LV WCHGA G+ +TL KA++VF
Sbjct  246   LKPDEVEDVKGTLNYMIKNRFP-SGNYPPSEEDRKRDVLVHWCHGAPGVALTLVKAAKVF  304

Query  1000  PNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGS  1179
               D EF  AA++A EVVW  GL+K+VG+  G +GNAY  LSLYR+TG   +  RA+AF S
Sbjct  305   GVD-EFLQAAVDAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRMTGNLEFLYRAKAFTS  363

Query  1180  FLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             FL   A  +++  + +G  D  YSLF+G+ G+A L+ D   P  SRFP YE+
Sbjct  364   FLLDRAHKLISAGEMNG-GDSPYSLFEGIGGMAYLFLDTTEPSESRFPAYEL  414



>ref|XP_008366750.1| PREDICTED: lanC-like protein GCL2 [Malus domestica]
Length=409

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/380 (48%), Positives = 244/380 (64%), Gaps = 19/380 (5%)
 Frame = +1

Query  196   AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  375
             +A+ LK+ VV  TW   GG  V   D ++YTG LGTA+   +++Q T N  DL+LC++IV
Sbjct  49    SALDLKETVVRQTW-GLGGKRVE--DYSLYTGALGTAFLAFKAYQVTKNESDLKLCSEIV  105

Query  376   DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  555
               C SA+  + R ++F+CGR G+ ALGAV A + GD+   D YL  F E+     LP   
Sbjct  106   KACDSASTGS-RRVSFICGRAGVCALGAVVAKHTGDEMLLDLYLSKFKEIKLSSDLP---  161

Query  556   EEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMC  735
                      +LLYGRAGFLWA  F+ +H+G+  +    +  VV+ I++ GR   +     
Sbjct  162   --------NELLYGRAGFLWACSFLNKHIGNGTISATCMRSVVDEIIKAGRQ-LAKKGRS  212

Query  736   PLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSE  915
              LMY WHG +YWGAAHGLAGI+ VL+   L    VEDVKGTLRYM+ NRFP SGN+P SE
Sbjct  213   SLMYEWHGKKYWGAAHGLAGIMYVLMSTELKPAEVEDVKGTLRYMIKNRFP-SGNFPSSE  271

Query  916   GNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGT  1095
             G+  D+LV WCHGA G+ +TL +A++VF  D+EF  AAI+AGEVVW  GL+K+VG+  G 
Sbjct  272   GSESDRLVHWCHGAPGVALTLLRAAEVF-GDQEFLQAAIDAGEVVWNQGLLKRVGICHGI  330

Query  1096  AGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGV  1275
             +GNAY  LSLYRLTG+  Y  RA+AF  FL+  A  +++     G  D +YSLF+G+ G+
Sbjct  331   SGNAYVFLSLYRLTGKVEYLYRAKAFACFLHDRALRLISEGMMHG-GDRSYSLFEGVGGM  389

Query  1276  ACLWFDLIAPHNSRFPGYEI  1335
             A L  D+  P  +RFP YE+
Sbjct  390   AHLLLDMTEPSEARFPAYEL  409



>ref|XP_007132705.1| hypothetical protein PHAVU_011G117700g [Phaseolus vulgaris]
 gb|ESW04699.1| hypothetical protein PHAVU_011G117700g [Phaseolus vulgaris]
Length=414

 Score =   342 bits (878),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 195/422 (46%), Positives = 261/422 (62%), Gaps = 28/422 (7%)
 Frame = +1

Query  88    PESNGTNHEDGNDSGFRTVLDPTAPSFILP----AETFLQAAVSLKDQVVDMTWKARGGS  255
             PE+  +  ++  ++   TV D       +P    +E   +AA+ LK+ +V  TW   G S
Sbjct  15    PEATPSTPQEQEEA--LTVGDSLPKLLAMPHAPLSERLKRAALDLKETIVIETW---GVS  69

Query  256   AVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGR  435
                  D ++Y G+LGTA+  L+S++ T N  DL LC+ IV  C  AA    R +TF+CGR
Sbjct  70    WRKDGDFSLYCGVLGTAFLLLKSYEVTRNGNDLSLCSQIVKAC-DAASVRSRDVTFICGR  128

Query  436   GGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLW  615
              G+ +LGAVAA + GD +    Y+  F ++   K LP            +LLYGR GFLW
Sbjct  129   AGVCSLGAVAAKHAGDDESLRYYMAQFEKIKLSKDLPD-----------ELLYGRVGFLW  177

Query  616   AALFIKQHLGSEAVPNE-TLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLA  792
             A LF+ +HLG   VP+  T M V E I  G R G      CPLM+ W+G +YWGAAHGLA
Sbjct  178   ACLFLNKHLGQGTVPSSYTAMVVDEVIKSGRRLGRKGR--CPLMFEWYGEKYWGAAHGLA  235

Query  793   GILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIG  969
             GI++VL+   L  D +EDVKGTL+YM++NRF  SGNYP SE + + D LV WCHGA GI 
Sbjct  236   GIMHVLMEMELKPDELEDVKGTLKYMISNRF-SSGNYPASEDDRKSDVLVHWCHGAPGIA  294

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESI  1149
             +TL KA++VF  D+EF DAA+EAGEVVW  GL+KKVG+  G +GNAY  LSLY+LTG   
Sbjct  295   LTLVKAAKVF-GDKEFLDAAMEAGEVVWNRGLLKKVGICHGISGNAYVFLSLYQLTGNVK  353

Query  1150  YQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGY  1329
             +  RA+AF  FL   A  +++G +  G  D  YSLF+GL G+A L+ D+I P  S+FP Y
Sbjct  354   HLYRAKAFACFLLDRAHKLISGGEMHG-GDRPYSLFEGLGGMAYLFLDMIDPSLSKFPAY  412

Query  1330  EI  1335
             E+
Sbjct  413   EL  414



>ref|XP_004514463.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=446

 Score =   343 bits (880),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 189/423 (45%), Positives = 260/423 (61%), Gaps = 28/423 (7%)
 Frame = +1

Query  82    ASPESNGTNHE----DGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARG  249
             A+P +    HE       DS  + +  P AP     +E   +AA+ LK  +V  TW   G
Sbjct  47    ATPSTQHELHEAITVTTGDSLHKLLAMPHAPL----SERLKRAALDLKQTIVMETW---G  99

Query  250   GSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLC  429
              +     D T+Y GLLGTA+   +S+  T N  DL LC+ I+  C +A+  + R ++F+C
Sbjct  100   FTEQRVGDFTLYCGLLGTAFLLFKSYNVTQNANDLTLCSQIIKACDTASLYS-REVSFIC  158

Query  430   GRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGF  609
             GR G+ ALGAVAA + G+ +    YL  F ++   K LP            +LLYGR GF
Sbjct  159   GRAGVCALGAVAAKHAGNDESLRYYLAQFQKIKLPKDLPD-----------ELLYGRVGF  207

Query  610   LWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGL  789
             LWA LF+ +HLG   VP+    PVV+ I++ GRA       CPLM+ W+G +YWGAAHGL
Sbjct  208   LWACLFLNKHLGQGTVPSSYTAPVVDEIIKNGRALGRKGK-CPLMFEWYGEKYWGAAHGL  266

Query  790   AGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGI  966
              GI++VL+   L  D +EDV+ TL+YM+ NRFP SGNYP SEG+  RD+LV WCHGA G+
Sbjct  267   VGIMHVLMDMELKPDQLEDVRDTLKYMILNRFP-SGNYPASEGDKKRDELVHWCHGAPGV  325

Query  967   GITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGES  1146
              +TL KAS+VF  D EF DAA+EA +VVW  GL+K+VG+  G +GNAY  LSLY+LTG +
Sbjct  326   ALTLVKASKVF-GDEEFLDAAMEAADVVWSRGLLKRVGMCHGISGNAYVFLSLYQLTGNA  384

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  +A+AF  FL   A  +++  +  G  D  YSLF+G+ G+A L+ D++ P  S+FP 
Sbjct  385   KYLYKAKAFACFLLDRAHKLISRGEMHG-GDRPYSLFEGVGGMAYLFLDMVDPSQSKFPA  443

Query  1327  YEI  1335
             YE+
Sbjct  444   YEL  446



>ref|XP_008229171.1| PREDICTED: lanC-like protein GCL2 [Prunus mume]
Length=413

 Score =   340 bits (872),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 252/404 (62%), Gaps = 25/404 (6%)
 Frame = +1

Query  127   SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTA  306
             S    +L    PS    +E F + A+ LK+ ++  TW A G       D T+Y+G LGTA
Sbjct  32    SSLMKLLSMPYPSL---SERFKRTALDLKETILTETWGATGQRV---HDFTLYSGALGTA  85

Query  307   YTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQ  486
                 +S+Q T N  DL LC+ I+  C SA+  + R +TF+CGR G+ ALGAVAA + GD 
Sbjct  86    LLLFKSYQVTSNTNDLSLCSQIIKACDSASLGS-RDVTFICGRAGICALGAVAAKHLGDS  144

Query  487   QKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNE  666
                D YL  F E+   + LP            +LLYG+ GFLWA LF+ +HLG   + + 
Sbjct  145   ASLDYYLAQFREIKLSRNLPD-----------ELLYGKVGFLWACLFLNKHLGEGTISSA  193

Query  667   TLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVED  846
              +  VV+ I++ GRA       CPLM+ W+G +YWGAAHGLAGI++VL+   L  D VED
Sbjct  194   YMRAVVDEIIKNGRA-LGKRGRCPLMFEWYGEKYWGAAHGLAGIMDVLMDMELKPDEVED  252

Query  847   VKGTLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRD  1023
             VKGTL+YM++NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++ F  D+EF +
Sbjct  253   VKGTLKYMIDNRFP-SGNYPASEEDKNRDVLVHWCHGAPGIALTLAKAAKFF-GDKEFME  310

Query  1024  AAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGD  1203
             AA++A E+VWK GL+K+VG+  G +GNAY  LSLY+LTG   +  RA+AF  FL   A  
Sbjct  311   AAVDAAEMVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNLGFLYRAKAFACFLVDRANK  370

Query  1204  IMAGSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  1332
             ++  S+G+    D  YSLF+G+ G+A L  D+I P  ++FP Y+
Sbjct  371   LI--SEGELHRGDSPYSLFEGVGGMAYLLLDMIEPSQAKFPAYK  412



>gb|ABQ14360.1| abscisic acid ABA receptor [Populus trichocarpa]
Length=443

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 238/378 (63%), Gaps = 25/378 (7%)
 Frame = +1

Query  217   QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  396
             +VV  TW   G S     D ++YTG LGTAY   +++Q T N+ DL LC+DI+  C S +
Sbjct  86    EVVRETW---GMSGKRVKDYSLYTGALGTAYLLFKAYQVTKNQNDLNLCSDIIKACDSVS  142

Query  397   PATIRHITFLCG-----RGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEE  561
               + R +TF+CG     R G+ ALGAVAA + GD +  D YL  F E+     LP     
Sbjct  143   RDSGR-VTFICGLTGCGRAGVCALGAVAAKHAGDGRLLDHYLAQFKEIKLPSDLP-----  196

Query  562   GGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPL  741
                   Y+LLYGRAGFLWA  F+ +H+G E +       VV+ I++ GR   +    CPL
Sbjct  197   ------YELLYGRAGFLWACSFLNKHIGKETISTSRKRAVVDEIIKAGRL--ARKGKCPL  248

Query  742   MYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN  921
             +Y WHG RYWGAAHGLAGI+ VL+   L+ D VEDVKGTL YM+ N FP SGNYP SEGN
Sbjct  249   LYEWHGKRYWGAAHGLAGIMLVLMDLELTPDEVEDVKGTLHYMIKNHFP-SGNYPSSEGN  307

Query  922   PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAG  1101
               D LV WCHGA GI +TL KA++VF  D+EF  AA+EAGEVVW  GL+K+VG+  G +G
Sbjct  308   KSDCLVHWCHGAPGIALTLAKAAEVF-GDKEFLQAAMEAGEVVWNRGLLKRVGICHGISG  366

Query  1102  NAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVAC  1281
             N Y  LSLYRLTG   Y  RA+AF  FL+  A  +++  +  G  D  YSLF+G  G+A 
Sbjct  367   NTYVFLSLYRLTGNVEYLYRAKAFACFLHDRAQKLVSEGKMHG-GDRPYSLFEGFGGMAY  425

Query  1282  LWFDLIAPHNSRFPGYEI  1335
             L+ D++ P  +RFP YE+
Sbjct  426   LFLDILEPSEARFPAYEL  443



>ref|XP_007215460.1| hypothetical protein PRUPE_ppa006408mg [Prunus persica]
 gb|EMJ16659.1| hypothetical protein PRUPE_ppa006408mg [Prunus persica]
Length=413

 Score =   340 bits (872),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 247/387 (64%), Gaps = 22/387 (6%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             +E F + A+ LK+ ++  T  A G       D T+Y+G LGTA    +S+Q T N  DL 
Sbjct  46    SERFKRTALDLKETILTETLGATGQHV---HDFTLYSGALGTALLLFKSYQVTSNTNDLS  102

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC+ I+  C SA+  + R +TF+CGR G+ ALGAVAA + GD    D YL  F E+   +
Sbjct  103   LCSQIIKACDSASLGS-RDVTFICGRAGVCALGAVAAKHLGDSASLDYYLTQFREIKLSR  161

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYG+ GFLWA LF+ +HLG   + +  +  VV+ I++ GRA  
Sbjct  162   NLPD-----------ELLYGKVGFLWACLFLNKHLGEGTISSAYMRAVVDEIIKNGRA-L  209

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                  CPLM+ W+G +YWGAAHGLAGI++VL+   L  D VEDVKGTL+YM++NRFP SG
Sbjct  210   GKRGRCPLMFEWYGEKYWGAAHGLAGIMDVLMDMELKPDEVEDVKGTLKYMIDNRFP-SG  268

Query  898   NYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             NYP SE +  RD LV WCHGA GI +TL KA++VF  D+EF +AA++A EVVWK GL+K+
Sbjct  269   NYPASEEDKNRDVLVHWCHGAPGISLTLAKAAKVF-GDKEFMEAAVDAAEVVWKRGLLKR  327

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGD-GAADHAYS  1251
             VG+  G +GNAY  LSLY+LTG   +  RA+AF  FL   A  ++  S+G+    D  YS
Sbjct  328   VGICHGISGNAYVFLSLYQLTGNLGFLYRAKAFACFLVDRAHKLI--SEGELHRGDSPYS  385

Query  1252  LFQGLAGVACLWFDLIAPHNSRFPGYE  1332
             LF+G+ G+A L  D+I P  ++FP YE
Sbjct  386   LFEGVGGMAYLLLDMIEPSQAKFPAYE  412



>gb|KHG20582.1| LanC-like protein 2 [Gossypium arboreum]
Length=409

 Score =   340 bits (871),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 254/417 (61%), Gaps = 23/417 (6%)
 Frame = +1

Query  88    PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  267
             PE+     ++  D+  + +  P +      ++ F + A+ LK+ V   TW   G ++   
Sbjct  15    PETTQHEQQEIGDTLIKLLSMPYSSL----SQHFKRTALDLKETVTLETW---GITSQKV  67

Query  268   MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  447
              D T+Y G LGTA+   +S+  T N  DL LC  IVD C SA+ ++ R  TFLCGR G+ 
Sbjct  68    SDFTLYCGTLGTAFLLFKSYLLTNNTNDLSLCLAIVDACNSASLSS-RDATFLCGRAGVC  126

Query  448   ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  627
             ALGAVAA Y G+Q+  + YL  F E+   + LP            +LLYGRAGFLWA LF
Sbjct  127   ALGAVAAKYAGNQESLNHYLTPFREIKLSRDLPD-----------ELLYGRAGFLWACLF  175

Query  628   IKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNV  807
             + +HLG   + + T   VV+ I++ GRA        PLM+ W+G +YWGAAHGLAGI+ V
Sbjct  176   LNKHLGEGTITSTTTRAVVDEIIKNGRALGKKGGGSPLMFEWYGEKYWGAAHGLAGIIYV  235

Query  808   LLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCK  984
             L+   L  D  EDVK TLRYM+ NRFP  GNYP SE + + D LV WCHGA GI +TL K
Sbjct  236   LMDTELKPDEAEDVKSTLRYMIRNRFP-GGNYPASEQDRKSDVLVHWCHGAPGIALTLVK  294

Query  985   ASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERA  1164
             A++VF +D EF +AA++A EVVW  GL+K+VG+  G +GNAY  LSLYR TG   +  RA
Sbjct  295   AAEVFGDD-EFLEAAVDAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRKTGNVKFLHRA  353

Query  1165  RAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +AF  FL   A  +++  +  G  D  YSLF+G+ G+A L+ D+I P  SRFP YE+
Sbjct  354   KAFACFLLDQAHKLISNGEMHG-GDRPYSLFEGIGGMAYLFLDMIEPLGSRFPAYEL  409



>gb|KJB79968.1| hypothetical protein B456_013G075200 [Gossypium raimondii]
Length=409

 Score =   339 bits (869),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 254/417 (61%), Gaps = 23/417 (6%)
 Frame = +1

Query  88    PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  267
             PE+     ++  D+  + +  P +      ++ F + A+ LK+ V   TW   G ++   
Sbjct  15    PETTQHEQQEIGDTLIKLLSMPYSSL----SQHFKRTALDLKETVTLETW---GITSQKV  67

Query  268   MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  447
              D T+Y G LGTA+   +S+Q T N  DL LC  IVD C SA+ ++ R  TFLCGR G+ 
Sbjct  68    SDFTLYCGSLGTAFLLFKSYQLTNNTNDLSLCLAIVDACNSASLSS-RDATFLCGRAGVC  126

Query  448   ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  627
             ALGAVAA Y G+Q+  + YL  F E+   + LP            +LLYGRAGFLWA  F
Sbjct  127   ALGAVAAKYSGNQESLNHYLTPFREIKLSRDLPD-----------ELLYGRAGFLWACFF  175

Query  628   IKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNV  807
             + +HLG   +P+ T   VV+ I++ GRA        PLM+ W+G +YWGAAHGLAGI+ V
Sbjct  176   LNKHLGEGTIPSTTTRAVVDEIIKNGRALGKKGGGSPLMFEWYGEKYWGAAHGLAGIIYV  235

Query  808   LLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCK  984
             L+   L  D  EDVK TLRYM+ NRFP  GNYP SE + + D LV WCHGA GI +TL K
Sbjct  236   LMDTELKPDEAEDVKSTLRYMIRNRFP-GGNYPASEQDRKSDVLVHWCHGAPGIALTLVK  294

Query  985   ASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERA  1164
             A++VF +D EF +AA++A EVVW  GL+K+VG+  G +GNAY  LSLY  TG   +  RA
Sbjct  295   AAEVFGDD-EFLEAAVDAAEVVWNRGLLKRVGICHGISGNAYVFLSLYGKTGNVKFLYRA  353

Query  1165  RAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +AF  FL   A  +++  +  G  D  YSLF+G+ G+A L+ D+I P  SRFP YE+
Sbjct  354   KAFACFLLDQAHKLISKGEMHG-GDRPYSLFEGIGGMAYLFLDMIEPLGSRFPAYEL  409



>ref|XP_002263345.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 ref|XP_010657174.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 ref|XP_010657175.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 emb|CBI28768.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 257/417 (62%), Gaps = 24/417 (6%)
 Frame = +1

Query  88    PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  267
             P    T  + G DS  + +  P    F   ++   + A+ LK+  V  TW   G      
Sbjct  19    PTQEETPPQGGEDSLIKLLSMP----FSALSQRLKRTALDLKETAVIETWGLTGQHV---  71

Query  268   MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  447
              D T+Y+G+LGTAY   R++  T N+ DL LC++IV  C SA+  + R +TF+CGR G+ 
Sbjct  72    RDFTLYSGVLGTAYLLFRAYLVTANKTDLGLCSEIVKACDSASLGS-RDVTFICGRAGVC  130

Query  448   ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  627
             ALGAVAA + GD++  + YL  F E+   ++LP            +LLYGR GFLWA LF
Sbjct  131   ALGAVAAKHNGDERLMNYYLTQFNEIKLPRSLPD-----------ELLYGRVGFLWACLF  179

Query  628   IKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNV  807
             + +H+G   VP      VV  I++ GR   ++   CPLM+ W+G +Y GAAHGLAGI++V
Sbjct  180   LNKHIGQGTVPPTYTGAVVSEIIKNGRR-LANKGRCPLMFEWYGEKYLGAAHGLAGIMHV  238

Query  808   LLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCK  984
             L+H  L  D +EDVKGTLRYM+ NRFP  GNYP SE +   D LV WCHGA G+ +TL K
Sbjct  239   LMHMELKIDEIEDVKGTLRYMIKNRFPR-GNYPASEEDRNGDVLVHWCHGAPGVALTLAK  297

Query  985   ASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERA  1164
             A++VF +D EF +AAI+A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG+  +  RA
Sbjct  298   AAEVFGDD-EFLEAAIDAAEVVWNRGLLKRVGVCHGISGNAYVFLSLYRLTGKMEFLYRA  356

Query  1165  RAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +AF  FL   A  +++  +  G  D  YSLF+G  G+A L+ D+I P  +RFP YE+
Sbjct  357   KAFACFLLDRAHKLISDGEMHG-GDSPYSLFEGSGGMAHLFLDMIEPSEARFPAYEL  412



>emb|CAN64758.1| hypothetical protein VITISV_008093 [Vitis vinifera]
Length=412

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 257/417 (62%), Gaps = 24/417 (6%)
 Frame = +1

Query  88    PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  267
             P    T  + G DS  + +  P    F   ++   + A+ LK+  V  TW   G      
Sbjct  19    PTQEETPPQGGEDSLIKLLSMP----FSALSQRLKRTALDLKETAVIETWGLTGQHV---  71

Query  268   MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  447
              D T+Y+G+LGTAY   R++  T N+ DL LC++IV  C SA+  + R +TF+CGR G+ 
Sbjct  72    RDFTLYSGVLGTAYLLFRAYLVTANKTDLGLCSEIVKACDSASLGS-RDVTFICGRAGVC  130

Query  448   ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  627
             ALGAVAA + GD++  + YL  F E+   ++LP            +LLYGR GFLWA LF
Sbjct  131   ALGAVAAKHNGDERLMNYYLTQFNEIKLPRSLPD-----------ELLYGRVGFLWACLF  179

Query  628   IKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNV  807
             + +H+G   VP      VV  I++ GR   ++   CPLM+ W+G +Y GAAHGLAGI++V
Sbjct  180   LNKHIGQGTVPPTYTGXVVSEIIKNGRR-LANKGRCPLMFEWYGEKYLGAAHGLAGIMHV  238

Query  808   LLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCK  984
             L+H  L  D +EDVKGTLRYM+ NRFP  GNYP SE +   D LV WCHGA G+ +TL K
Sbjct  239   LMHMELKIDEIEDVKGTLRYMIKNRFPR-GNYPASEEDRNGDVLVHWCHGAPGVALTLAK  297

Query  985   ASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERA  1164
             A++VF +D EF +AAI+A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG+  +  RA
Sbjct  298   AAEVFGDD-EFLEAAIDAAEVVWNRGLLKRVGVCHGISGNAYVFLSLYRLTGKMEFLYRA  356

Query  1165  RAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +AF  FL   A  +++  +  G  D  YSLF+G  G+A L+ D+I P  +RFP YE+
Sbjct  357   KAFACFLLDRAHKLISDGEMHG-GDSPYSLFEGSGGMAHLFLDMIEPSEARFPAYEL  412



>ref|XP_008809400.1| PREDICTED: lanC-like protein GCL2 [Phoenix dactylifera]
Length=404

 Score =   338 bits (868),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 242/389 (62%), Gaps = 25/389 (6%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             A+  L+AA+ LK++VV  TW   G  A    D T+YTG LGTA+   +++Q T NR DL 
Sbjct  38    ADKLLRAALDLKEKVVKETWVRFGRRA---KDFTLYTGALGTAFLLFKAYQVTNNRGDLS  94

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC++I+  C   +     H+TF+CGR G+ ALGAV A + GD+   + YL  F E+    
Sbjct  95    LCSEIIRACDVGSQGD-PHVTFICGRAGVCALGAVVAKHAGDEALLNHYLSSFREIRMPG  153

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGR G+LWA  F+ +H+G   +P+  +  + + I+  G+  S
Sbjct  154   KVP-----------NELLYGRVGYLWACAFLNKHIGEGTIPSTHMGALAKKIIMDGKRLS  202

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             +  S CPLMY WH  +YWGAAHGLAGI++VL+   L  D  ED+KGTLRYM+ NRF  SG
Sbjct  203   NRGS-CPLMYEWHDKKYWGAAHGLAGIMHVLMDMDLKPDEKEDIKGTLRYMIQNRFS-SG  260

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KA+QVF  + +F  A  EA EVVW  GL+K+V
Sbjct  261   NYPSSEGSNNDRLVHWCHGAPGVSLTLTKAAQVF-QEEQFLQATAEAAEVVWNRGLLKRV  319

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG---AADHAY  1248
             G+  G +GN Y  LSLYRLTG   Y  RA+AF  FL   A  ++A    DG   + D  Y
Sbjct  320   GICHGISGNTYVFLSLYRLTGNMEYLYRAKAFACFLLDKANKLIA----DGLMHSGDRPY  375

Query  1249  SLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             SLF+G AG+A L+ D++ P  SRFP YE+
Sbjct  376   SLFEGQAGMAHLFLDMVRPSESRFPAYEL  404



>ref|XP_003618310.1| LanC-like protein [Medicago truncatula]
Length=469

 Score =   341 bits (874),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 193/447 (43%), Positives = 268/447 (60%), Gaps = 47/447 (11%)
 Frame = +1

Query  88    PESNGTNHED---------GNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWK  240
             PES  +  ++         G DS    +  P AP     ++   +AA+ LK+ +V  TW 
Sbjct  39    PESTPSTQQELQEAVTVTTGGDSLLNLLAMPHAPL----SQRLKRAALDLKETIVMETWG  94

Query  241   ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHIT  420
               G       D T+Y GLLGTA+  L+S+  T N  DL LC+ IV +C  AA  + R +T
Sbjct  95    LTGQRV---GDFTLYCGLLGTAFLLLKSYHVTCNTNDLALCSQIVKSC-DAASLSSRDVT  150

Query  421   FLCGRGGLYALGAVAANYCGDQQKRDSYLDYF--------------FEVAQEKALPVG--  552
             F+CGR G+ ALGAVAA + GD +    YL  F                 A +  + V   
Sbjct  151   FICGRAGVCALGAVAAKHAGDDESLRYYLAQFQQDWAFMQTTCSNRLNAAMQSVIYVRFR  210

Query  553   -----PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
                  P++    +  +LLYG+ GFLWA LF+ +HLG   VP+     VV+ I++ GRA  
Sbjct  211   SDIKLPKD----LPDELLYGKGGFLWACLFLNKHLGQGTVPSSYTATVVDEIIKNGRALG  266

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                  CPLM+ W+G +YWGAAHGLAGI+NVL+   L  D +EDV+GTL+YM++NRFP SG
Sbjct  267   QKRK-CPLMFEWYGEKYWGAAHGLAGIMNVLMDMELKPDELEDVRGTLKYMIHNRFP-SG  324

Query  898   NYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             NYP S+ + + D LV WCHGA G+ +TL KA++VF  D+EF DAA+EAGEVVW  GL+K+
Sbjct  325   NYPASDKDKKSDVLVHWCHGAPGMALTLVKAAKVF-GDKEFLDAAMEAGEVVWSRGLLKR  383

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+  G +GNAY  LSLY+LTG + Y  RA+AF  FL   A ++++G +  G  D  +SL
Sbjct  384   VGICHGISGNAYVFLSLYQLTGNTKYLYRAKAFACFLLDGAHNLISGGEMHG-GDSPHSL  442

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F+G+ G+A L+ D++ P  S+FP YE+
Sbjct  443   FEGVGGMAYLFLDMVNPSQSKFPAYEL  469



>ref|XP_008381258.1| PREDICTED: lanC-like protein GCL2 [Malus domestica]
Length=414

 Score =   339 bits (869),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 189/418 (45%), Positives = 256/418 (61%), Gaps = 23/418 (6%)
 Frame = +1

Query  85    SPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVT  264
             +P  +    E GNDS    +L    PS    +     AA  LK  ++  TW     +   
Sbjct  17    APTPSPPQAEHGNDS-LMNLLSTPCPSL---SHLLKXAASDLKQTILTETWAGAAAAQSL  72

Query  265   HMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGL  444
             H D T+Y+G LGTA+   +S+Q TG+  D+ L A IV  C SA+  +   +TF+CGR G+
Sbjct  73    H-DFTLYSGALGTAFLLFKSYQVTGDANDITLXAQIVKACDSASLGSRDVVTFMCGRAGV  131

Query  445   YALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAAL  624
              ALGAVAA +CGD      YL  F E+   ++LP            +LLYG+ GFLWA L
Sbjct  132   CALGAVAAKHCGDSASLSYYLAQFREIKLSRSLPD-----------ELLYGKVGFLWACL  180

Query  625   FIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILN  804
             F+ +HLG   + +  +  VV+ I++ GRA       CPLM+ W+G +YWGAAHGLAGI++
Sbjct  181   FLNKHLGDGTISSAYMRAVVDEIIKNGRA-LGKGGRCPLMFEWYGEKYWGAAHGLAGIMH  239

Query  805   VLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLC  981
             VL+   L  D VEDVKGTL+YM+NNRFP SGNYP SE +  RD LV WCHGA GI +TL 
Sbjct  240   VLMDMELKPDEVEDVKGTLKYMINNRFP-SGNYPASEEDRHRDVLVHWCHGAPGIALTLA  298

Query  982   KASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQER  1161
             KA++VF  D+EF +AA +A EVVWK GL+K+VG+  G +GNAY  LSLY+LTG  ++  R
Sbjct  299   KAAKVF-GDKEFLEAAADAAEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNVVFLYR  357

Query  1162  ARAFGSFLYHNAGDIMAGSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  1332
             A+AF  FL   +  ++   QG+    D  YSLF+G+ G+A L  D++ P  ++FP YE
Sbjct  358   AKAFACFLLDRSHKLI--XQGEMHRGDSPYSLFEGVGGMAYLLLDMLEPSQAKFPAYE  413



>ref|XP_009767465.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   338 bits (866),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 189/402 (47%), Positives = 250/402 (62%), Gaps = 26/402 (6%)
 Frame = +1

Query  148   DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  315
             DP +    LP  T  Q    AA  LK+ +V  TW  +GG      D T+YTG LGTA+  
Sbjct  29    DPLSKLLHLPYRTVCQKLKSAAQDLKETIVKETWVCKGGRVS---DYTLYTGALGTAFLL  85

Query  316   LRSFQATGNRQDLRLCADIVDTCASAAPAT-IRHITFLCGRGGLYALGAVAANYCGDQQK  492
              +++Q T +  DL LC+ I+  C SA+  +  R +TF+CG+ G+YALGAV A + GD+Q 
Sbjct  86    FKAYQVTRDNNDLALCSHIIKACDSASHGSGCRRVTFICGQAGVYALGAVVAKHSGDEQL  145

Query  493   RDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAV-PNET  669
              D YL  F E+   K LP            +LLYGRAGFLWA  F+ +++G + + P + 
Sbjct  146   CDHYLTKFKEIELPKDLP-----------NELLYGRAGFLWACSFLNKNIGRDTISPTQI  194

Query  670   LMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDV  849
                VVE I  G + G      CPLMY WH  +YWGAAHGLAGI++VL+   L  D  EDV
Sbjct  195   QAVVVEVIKSGRKMG---KGRCPLMYEWHEKKYWGAAHGLAGIMHVLMDMELKADEAEDV  251

Query  850   KGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAA  1029
             K TLRYM+ NRFP SGNYP S+G+  D+LV WCHGA G+ +TL KA++VF +D EF  AA
Sbjct  252   KATLRYMIRNRFP-SGNYPSSDGSESDRLVHWCHGAPGVALTLIKAAEVFSSD-EFLQAA  309

Query  1030  IEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIM  1209
              EA EVVW  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +ARAF  FL+  A  ++
Sbjct  310   AEAAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKARAFACFLHARAQTLI  369

Query  1210  AGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +     G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  370   SEGVMHG-GDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  410



>ref|XP_010675629.1| PREDICTED: lanC-like protein GCR2 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/385 (46%), Positives = 243/385 (63%), Gaps = 20/385 (5%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  360
             E    +A+ LKD VV  TW A+ G  V   D ++YTG LGTA+   +++Q T N+ DL L
Sbjct  44    EILKNSALQLKDAVVKETW-AKSGKRV--QDYSLYTGALGTAFLLFKAYQVTNNKGDLAL  100

Query  361   CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  540
              + I+  C SA+  + ++ITF+CGR G+ ALGAV A + GD+   + Y+  F ++     
Sbjct  101   SSQIIQACDSASRGS-KNITFICGRSGVCALGAVVAKHAGDENLLNHYVTEFKQIKLPAD  159

Query  541   LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSS  720
             LP           Y+LLYG+ GFLW+  F+K+H+G + +   T+  +V  I++ G+    
Sbjct  160   LP-----------YELLYGKTGFLWSCSFLKKHIGEDTISYSTMREIVSDIMKAGK--KL  206

Query  721   DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGN  900
                 CPLMY WHG +YWGAAHGLAGIL+VL+   L+ D  ED+K  LRYM+  RFP  GN
Sbjct  207   GKGRCPLMYEWHGKKYWGAAHGLAGILHVLMSMELTLDEQEDIKSVLRYMIRGRFP-GGN  265

Query  901   YPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVG  1080
             YP SEG+  D+LV WCHGA G+ +TL KA +VF  D+E   AA++A EVVW  GL+K+VG
Sbjct  266   YPSSEGSESDRLVHWCHGAPGLALTLAKAYEVF-GDKELLQAAVDAAEVVWNRGLLKRVG  324

Query  1081  LADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQ  1260
             +  GT+GN Y  L+LYRLTG + Y  RA+AF SFL+  A  ++A     G  D  YSLF+
Sbjct  325   ICHGTSGNTYVFLALYRLTGNAEYLYRAKAFASFLHDRARRLIAEGFMHG-GDRPYSLFE  383

Query  1261  GLAGVACLWFDLIAPHNSRFPGYEI  1335
             GL G+A L+ D+  P  +RFP YE+
Sbjct  384   GLGGMAYLFLDMNEPAEARFPAYEL  408



>ref|XP_009357824.1| PREDICTED: lanC-like protein GCL2 [Pyrus x bretschneideri]
Length=414

 Score =   337 bits (865),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 189/418 (45%), Positives = 256/418 (61%), Gaps = 23/418 (6%)
 Frame = +1

Query  85    SPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVT  264
             +P  +    E GNDS    +L    PS    +    +AA  L   ++  TW     +   
Sbjct  17    APTPSPPQAEHGNDS-LMNLLSTPCPSL---SHLLKRAASDLIQIILTETWAGATAAQSL  72

Query  265   HMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGL  444
             H D T+Y+G LGTA+   +S+Q TG+  D+ +CA IV  C SA+  +   +TF+CGR G+
Sbjct  73    H-DFTLYSGALGTAFLLFKSYQVTGDANDVTICAQIVKACDSASLGSRDVVTFMCGRAGV  131

Query  445   YALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAAL  624
              ALGAVAA +CGD      YL  F E+   + LP            +LLYG+ GFLWA L
Sbjct  132   CALGAVAAKHCGDSASVSYYLAQFREIKLSRNLPD-----------ELLYGKVGFLWACL  180

Query  625   FIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILN  804
             F+ +HL    + +  +  VV+ I++ GRA       CPLM+ W+G +YWGAAHGLAGI++
Sbjct  181   FLNKHLEGGTISSAYMRAVVDEIIKNGRA-LGKGGRCPLMFEWYGEKYWGAAHGLAGIMH  239

Query  805   VLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLC  981
             VL+   L  D VEDVKGTL+YM+NNRFP SGNYP SE +  RD LV WCHGA GI +TL 
Sbjct  240   VLMDMELKPDEVEDVKGTLKYMINNRFP-SGNYPASEEDRHRDVLVHWCHGAPGIALTLA  298

Query  982   KASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQER  1161
             KA++VF  D+EF +AA +A EVVWK GL+K+VG+  G +GNAY  LSLY+LTG  ++  R
Sbjct  299   KAAKVF-GDKEFLEAAADAAEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNVVFLYR  357

Query  1162  ARAFGSFLYHNAGDIMAGSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  1332
             A+AF  FL   A  ++  SQG+    D  YSLF+G+ G+A L  D++ P  ++FP YE
Sbjct  358   AKAFACFLLDRAHKLI--SQGEMHRGDSPYSLFEGVGGMAYLLLDMVEPSQAKFPAYE  413



>gb|EYU26156.1| hypothetical protein MIMGU_mgv1a007017mg [Erythranthe guttata]
Length=422

 Score =   337 bits (865),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 186/414 (45%), Positives = 259/414 (63%), Gaps = 27/414 (7%)
 Frame = +1

Query  103   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  282
              N +   DS  R +  P    +   +  F +AA+ LK  +V  TW    G  V   D T+
Sbjct  33    VNPQATQDSLVRLLSQP----YTTISLKFQRAALDLKQTIVVKTWGGFTGQHVE--DFTL  86

Query  283   YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAV  462
             Y+G LGTA+   + +Q T N+ DL L ++IV  C SA+  + R ++F+CGR G+ ++GAV
Sbjct  87    YSGTLGTAFLLFKFYQVTHNKNDLTLSSEIVKACDSASVHS-RDVSFMCGRAGVCSIGAV  145

Query  463   AANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHL  642
              A + GD +    YL+ F ++   +  P            +LLYGRAG+LWA LF+ +H 
Sbjct  146   VAKHMGDDKLVHYYLNQFKKIRLSEDHPD-----------ELLYGRAGYLWACLFLNKHF  194

Query  643   GSEAVPNETLMPVVEAILEGGRA-GSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHF  819
             G+E +P+ ++  VV+ I++ GR  G  + S  PLMY WHG RYWGAAHGLAGI++VL+  
Sbjct  195   GNETIPSTSMSAVVKEIIKKGRKQGKKEGS--PLMYEWHGERYWGAAHGLAGIMHVLMEC  252

Query  820   PLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQV  996
              L+ D +EDVKGTL+YM+ N+FP SGNYPVSE +  RD LV WCHGA GI +TL KA+ V
Sbjct  253   RLTSDEIEDVKGTLKYMIKNQFP-SGNYPVSEEDKTRDALVHWCHGAPGIALTLTKAAMV  311

Query  997   FPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFG  1176
             F  D+EF + A+ A EVVW  GL+K++G+  G +GNAY  LSLYRLTG   Y  RA+AF 
Sbjct  312   F-GDKEFLEGAMGAAEVVWNRGLLKRIGMCHGISGNAYVFLSLYRLTGVVEYLYRAKAFA  370

Query  1177  SFLYHNAGDIMAGSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             SFL    G  M  S G+  + D+ +SLF+G+ G+  L+ D++ P N+RFP YE 
Sbjct  371   SFLLD--GTHMLISTGELHSGDNPFSLFEGMGGMTHLFLDMVQPKNARFPAYEF  422



>ref|XP_007043559.1| GCR2-like 2 isoform 1 [Theobroma cacao]
 gb|EOX99390.1| GCR2-like 2 isoform 1 [Theobroma cacao]
Length=408

 Score =   337 bits (864),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 181/387 (47%), Positives = 245/387 (63%), Gaps = 19/387 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++ F +AA+ LK+ V   TW   G       D T+Y G LGTA+   +S+Q   N  DL 
Sbjct  40    SQHFKRAALDLKETVTLDTWGLTGQKVS---DFTLYCGTLGTAFLLFKSYQLANNTNDLS  96

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC  IVD C SA+ ++ R +TFLCGR G+ ALGAVAA + G+Q+  D YL  F E+    
Sbjct  97    LCLAIVDACNSASFSS-RDVTFLCGRAGVCALGAVAAKHAGNQELLDYYLSQFKEIKLSS  155

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGRAGFLWA +F+ +HLG   +P+ T   VV+ +++ GR  +
Sbjct  156   NLPD-----------ELLYGRAGFLWACVFLNKHLGEGTIPSTTTRAVVDEVIKNGRQLA  204

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                   PLM+ ++G +YWGAAHGLAGI++VL+   L  D + DVKGTL+YM+ NRFP SG
Sbjct  205   KKGGGSPLMFEFYGEKYWGAAHGLAGIMHVLMDMELEPDEIMDVKGTLKYMIRNRFP-SG  263

Query  898   NYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             NYP SE +  RD LV WCHGA GI +TL KA++VF +D EF +AA++A EVV+  GL+K+
Sbjct  264   NYPASEQDRKRDVLVHWCHGAPGIALTLVKAAEVFGDD-EFLEAAVDAAEVVFNRGLLKR  322

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+  G +GNAY  LSLYR TG   +  RA+AF  FL   A  +++  +  G  D  YSL
Sbjct  323   VGICHGISGNAYVFLSLYRKTGNVEFLYRAKAFACFLLDRAHKLISKGEMHG-GDRPYSL  381

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F+G+ G+A L+ D+I P  +RFP YE 
Sbjct  382   FEGIGGMAYLFLDMIEPLGARFPAYEF  408



>ref|XP_004244212.1| PREDICTED: lanC-like protein GCR2 [Solanum lycopersicum]
Length=407

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 186/394 (47%), Positives = 245/394 (62%), Gaps = 25/394 (6%)
 Frame = +1

Query  172   LPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  339
             LP +T  Q     A++LKD+VV  TW A+G       D T+YTG LGTAY   +S+Q T 
Sbjct  33    LPYDTITQRLKLDAINLKDEVVRETWSAKGRHV---KDYTLYTGTLGTAYILFKSYQITR  89

Query  340   NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  519
             N  D+ LC+DI+  C +A        TF+ G  G+YALGAVAA   GD Q    +L  F 
Sbjct  90    NIDDIALCSDIIQACDTACNG-FGPPTFIGGHAGIYALGAVAAKNNGDDQLCQIFLTKF-  147

Query  520   EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILE  699
                +E  LP+        +  DL YGRAG+LWA  F+ +HLG   +    +  VV  +++
Sbjct  148   ---KEMKLPID-------LGDDLFYGRAGYLWACSFLNKHLGKGTISISQMREVVNELVK  197

Query  700   GGRAGSS-DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMN  876
              GR  S  +N   PLMY   G +YWGAAHG+AG++NVLL   L +D +EDVKGTLRYM+ 
Sbjct  198   SGRKLSKLENFKSPLMYESRGEKYWGAAHGIAGVMNVLLDMELKQDEIEDVKGTLRYMIK  257

Query  877   NRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWK  1056
             NRF  SGNY  SEG+  D  V WCHGA G+ +TL KA++VF +D EF +AA EAGEVVW+
Sbjct  258   NRFS-SGNYRTSEGDESDVRVHWCHGAAGVALTLAKAAKVFGDD-EFLEAAREAGEVVWR  315

Query  1057  SGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA-GSQGDGA  1233
              GL+K+VG+  G +GNAY  LSLY+LT E  Y  +A+AF  FL+  A  ++  G    G 
Sbjct  316   RGLLKRVGICHGISGNAYVFLSLYKLTREEEYLYKAKAFACFLHDRAHTLICEGVMHKG-  374

Query  1234  ADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              DH +SLF+G+ G+ACL+ DL+ P  SRFP YE+
Sbjct  375   -DHPFSLFEGIGGMACLFLDLVEPFESRFPAYEV  407



>ref|XP_009767466.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana sylvestris]
Length=408

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 189/401 (47%), Positives = 250/401 (62%), Gaps = 26/401 (6%)
 Frame = +1

Query  148   DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  315
             DP +    LP  T  Q    AA  LK+ +V  TW  +GG      D T+YTG LGTA+  
Sbjct  29    DPLSKLLHLPYRTVCQKLKSAAQDLKETIVKETWVCKGGRVS---DYTLYTGALGTAFLL  85

Query  316   LRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKR  495
              +++Q T +  DL LC+ I+  C SA+  + R +TF+CG+ G+YALGAV A + GD+Q  
Sbjct  86    FKAYQVTRDNNDLALCSHIIKACDSASHGSGR-VTFICGQAGVYALGAVVAKHSGDEQLC  144

Query  496   DSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAV-PNETL  672
             D YL  F E+   K LP            +LLYGRAGFLWA  F+ +++G + + P +  
Sbjct  145   DHYLTKFKEIELPKDLP-----------NELLYGRAGFLWACSFLNKNIGRDTISPTQIQ  193

Query  673   MPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVK  852
               VVE I  G + G      CPLMY WH  +YWGAAHGLAGI++VL+   L  D  EDVK
Sbjct  194   AVVVEVIKSGRKMG---KGRCPLMYEWHEKKYWGAAHGLAGIMHVLMDMELKADEAEDVK  250

Query  853   GTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  1032
              TLRYM+ NRFP SGNYP S+G+  D+LV WCHGA G+ +TL KA++VF +D EF  AA 
Sbjct  251   ATLRYMIRNRFP-SGNYPSSDGSESDRLVHWCHGAPGVALTLIKAAEVFSSD-EFLQAAA  308

Query  1033  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  1212
             EA EVVW  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +ARAF  FL+  A  +++
Sbjct  309   EAAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKARAFACFLHARAQTLIS  368

Query  1213  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  369   EGVMHG-GDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  408



>ref|XP_006348233.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=407

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 191/403 (47%), Positives = 248/403 (62%), Gaps = 27/403 (7%)
 Frame = +1

Query  148   DPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHM-DPTVYTGLLGTAYT  312
             D  +    LP +T  Q     A +LKD+VV  TW A+G     H+ D  +YTG LGTAY 
Sbjct  25    DSLSKLLSLPYDTISQRLKLDATNLKDEVVRETWAAKG----RHVNDYRLYTGTLGTAYL  80

Query  313   CLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQK  492
               +S+Q T N  DL LC+DI+  C +A   +    TF+ G  G+YALGAVAA   GD Q 
Sbjct  81    LFKSYQITQNNDDLVLCSDIIQACDAACNGS-GPPTFIGGHAGIYALGAVAAKNNGDDQL  139

Query  493   RDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETL  672
                +L  F E+     LP+        +  DL YGRAG+LWA  F+ +HLG   +    +
Sbjct  140   CQQFLTKFKEIK----LPID-------LGDDLFYGRAGYLWACSFLNKHLGKGTISISQM  188

Query  673   MPVVEAILEGGRAGSS-DNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDV  849
               VV  +++ GR  S  +N   PLMY   G +YWGAAHGLAG++NVLL   L +D +EDV
Sbjct  189   RAVVNELIKSGRKLSKLENFKSPLMYESRGKKYWGAAHGLAGVMNVLLDMELKQDEIEDV  248

Query  850   KGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAA  1029
             KGTLRYM+ NRF  SGNY  SEG+  D LV WCHGA G+ +TL KA++VF +D EF  AA
Sbjct  249   KGTLRYMIKNRFS-SGNYRTSEGDESDVLVHWCHGAPGVALTLAKAAKVFGDD-EFLKAA  306

Query  1030  IEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGD-I  1206
              EAGEVVW+ GL+K+VG+  G +GNAY  LSLYRLTG+  Y  +A+AF  FL+  A   I
Sbjct  307   REAGEVVWRRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYKAKAFACFLHDRAHTFI  366

Query  1207  MAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               G    G  +H +SLF+G+ G+ACL+ DL+ P  SRFP YE+
Sbjct  367   CEGIMHKG--NHPFSLFEGIGGMACLFLDLVEPFESRFPAYEL  407



>ref|XP_009766748.1| PREDICTED: lanC-like protein GCL2 [Nicotiana sylvestris]
Length=420

 Score =   337 bits (864),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 188/385 (49%), Positives = 239/385 (62%), Gaps = 20/385 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             +E F + A+ LK+ +V  +W   G +     D T+Y G LGTA+   +S+Q T N  DL 
Sbjct  47    SEKFKRTALDLKETIVVESW---GLTRQQVPDFTLYCGTLGTAFLLFKSYQVTNNTNDLA  103

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             +C+ IV  C SA+  + R +TFLCGR G+ ALGAV A Y GD Q    Y+  F E+   K
Sbjct  104   VCSQIVKDCDSASRNS-RDVTFLCGRAGVCALGAVVAKYMGDDQLVLYYVTQFKEIKLTK  162

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGRAGFLWA LF+ +H+G   VP+     VV  I+E GR   
Sbjct  163   DLPD-----------ELLYGRAGFLWACLFMNKHIGKGTVPSSYTAAVVNEIIENGRRLG  211

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                   PLMY W+G  YWGAAHGLAGI+ VL+ F L  D +EDVK TLRYM+ NRFP SG
Sbjct  212   G-RGRSPLMYEWYGEMYWGAAHGLAGIMYVLMDFELKPDELEDVKETLRYMVKNRFP-SG  269

Query  898   NYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             NYP SE +  RD LV WCHGA GI +TL KA++VF  DREF +AA++A EVVW  GL+K+
Sbjct  270   NYPASEEDKRRDVLVHWCHGAPGIALTLVKAAEVF-GDREFLNAAVDAAEVVWNRGLLKR  328

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+  G +GNAY  LSLY+LTG   Y  RA+AF  FL   A  ++A  +  G  D  YSL
Sbjct  329   VGMCHGISGNAYVFLSLYQLTGNEEYLYRAKAFACFLLDRAHKLIAKGEMHG-GDSPYSL  387

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGY  1329
             F+G+ G+A L+ DL  P  +RFP Y
Sbjct  388   FEGIGGMAYLFLDLTEPKEARFPAY  412



>ref|XP_006409014.1| hypothetical protein EUTSA_v10002001mg [Eutrema salsugineum]
 gb|ESQ50467.1| hypothetical protein EUTSA_v10002001mg [Eutrema salsugineum]
Length=405

 Score =   336 bits (862),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 189/413 (46%), Positives = 259/413 (63%), Gaps = 26/413 (6%)
 Frame = +1

Query  103   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  282
             T  E G DS    + +  A  +   ++   ++A+ LK+ VV  TW   G S     D T+
Sbjct  17    TESEAGGDS----LTNLLAMPYSSLSQLLKRSALDLKETVVMETW---GFSGQLVQDFTL  69

Query  283   YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAV  462
             Y+G LG A+   R++Q TGN  DL LC  IV  C  AA A+   +TF+CGR G++ LGA 
Sbjct  70    YSGALGAAFLLFRAYQVTGNANDLSLCLQIVKAC-DAASASSGDVTFICGRTGVFGLGAA  128

Query  463   AANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHL  642
             AA   GDQ+  + YL  F ++     +P            +LLYGR G+LWA LF+ +++
Sbjct  129   AAKRSGDQELLNYYLAQFRQIRLSSEIP-----------NELLYGRVGYLWACLFVNKYV  177

Query  643   GSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFP  822
             G+E +P+ T+  V + I++ GR+ + + S  PLM+ W+G RY GAAHGLAGI++VL+H  
Sbjct  178   GAETLPSATIRQVAQEIIQQGRSMAKNGS-SPLMFEWYGERYLGAAHGLAGIMHVLMHVQ  236

Query  823   LSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVF  999
             L  D  EDVKGTL+YM+ +RFP SGNY  SE + R D LV WCHGA GI +TL KA++VF
Sbjct  237   LKPDEAEDVKGTLKYMIKSRFP-SGNYAASEEDRRRDLLVHWCHGAPGIALTLVKAAEVF  295

Query  1000  PNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGS  1179
               +REF +AA  A EVVW  GL+K+VG+  G +GNAY  LSLYR TG S Y  RA+AF S
Sbjct  296   -KEREFLEAAAAAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATGRSEYLYRAKAFAS  354

Query  1180  FLYHNAGDIMAGSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             FL   A  ++  S+GD    D  YSLF+G+ G+ACL+ D++ P  +RFPGYE+
Sbjct  355   FLLDRAHKLL--SKGDMHGGDSPYSLFEGVGGMACLFLDMVDPFQARFPGYEL  405



>gb|KFK40450.1| hypothetical protein AALP_AA3G374700 [Arabis alpina]
Length=407

 Score =   336 bits (861),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 257/428 (60%), Gaps = 25/428 (6%)
 Frame = +1

Query  58    MSSSIVHLASPE-SNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMT  234
             M+    H   P+    T  E G DS    +  P +      +    ++A+ LK+ VV  T
Sbjct  3     MADRFFHNVMPDFVRETETEAGGDSLMHLLAMPYSS----LSHQLKRSALDLKETVVIET  58

Query  235   WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  414
             W   G +     D T+Y+G LG A+   RSFQ T N  DL LC  IV  C  AA A+ R 
Sbjct  59    W---GFTGQLVQDFTLYSGTLGVAFLLFRSFQVTKNANDLSLCLQIVKAC-DAASASSRD  114

Query  415   ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  594
             +TF+CGR G+ +LGA AA   G++   + YL  F ++     LP            +LLY
Sbjct  115   VTFICGRAGVCSLGAAAAKLSGEEDLLNYYLAQFRQIRLASDLP-----------NELLY  163

Query  595   GRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWG  774
             GR G+LWA LFI +++ +E + +  +  V + I++ GR+ + + S  PLM+ W+G +YWG
Sbjct  164   GRVGYLWACLFINKYVAAETLSSTNIRQVTQEIIKEGRSMAKNGS-SPLMFEWYGKKYWG  222

Query  775   AAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCH  951
             AAHGLAGI++VL+   L  D  EDVKGTL+YM+ NRFP SGNYP +E +  RD LV WCH
Sbjct  223   AAHGLAGIMHVLMDVQLKPDEAEDVKGTLKYMIKNRFP-SGNYPANEEDRRRDTLVHWCH  281

Query  952   GATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYR  1131
             GA GI +TL KAS+VF  +REF +A + A EVVWK GL+K+VG+  G +GNAY  L+LYR
Sbjct  282   GAPGIALTLVKASEVF-GEREFLEAGVAAAEVVWKRGLIKRVGICHGISGNAYVFLALYR  340

Query  1132  LTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHN  1311
              TG S Y  RA+AF SFL      +++  +  G  D  YSLF+G+ G+A L+ D++ P  
Sbjct  341   ATGRSEYLYRAKAFASFLLDRGHKLLSKGEMHG-GDSPYSLFEGIGGMAYLFLDMVDPTQ  399

Query  1312  SRFPGYEI  1335
             +RFPGYE+
Sbjct  400   ARFPGYEL  407



>ref|XP_002467007.1| hypothetical protein SORBIDRAFT_01g018190 [Sorghum bicolor]
 gb|EER94005.1| hypothetical protein SORBIDRAFT_01g018190 [Sorghum bicolor]
Length=451

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 196/419 (47%), Positives = 259/419 (62%), Gaps = 22/419 (5%)
 Frame = +1

Query  79    LASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSA  258
             +A  E++  + E    +G R +L+     +    +  L+AA  LKD+VV+ TW  + G  
Sbjct  55    VAEAEASDGDGEGHRPAGLRGLLEL---PYTRLCDRLLRAARRLKDKVVEETW-LKAGRK  110

Query  259   VTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRG  438
             VT  D T+YTG LGTA    +SFQ TG+R DL L ADIV  C  A+   +  +TF+CGR 
Sbjct  111   VT--DYTLYTGSLGTALLLFKSFQVTGDRGDLALAADIVRACDEASRG-LPFLTFICGRA  167

Query  439   GLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWA  618
             G+ ALGAV A +C DQ +   YL  F E+   + +P            +LLYGR G+LWA
Sbjct  168   GVCALGAVIAKHCDDQLRVTQYLSSFDEITVTEKVP-----------NELLYGRVGYLWA  216

Query  619   ALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGI  798
              LF+ +HL  + +P E +  V + I+  GR  +S  S  PLMY WHG +YWGAAHGLAGI
Sbjct  217   CLFLNKHLSEKTIPVEHINSVAKDIIIEGRNLASKGS-SPLMYEWHGKKYWGAAHGLAGI  275

Query  799   LNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITL  978
             ++VL+H  L  D  +DVK TLRYM+ NRFP SGNYP SEGN  D+LV WCHGA G+ +TL
Sbjct  276   MHVLMHTELKPDEQDDVKNTLRYMIENRFP-SGNYPSSEGNESDRLVHWCHGAPGVALTL  334

Query  979   CKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQE  1158
              KA +VF +D  F+ AA EA EVVW  GL+K+VG+  G +GNAY  LSLYRL+G   Y  
Sbjct  335   AKAYEVFHDDY-FKQAAAEAAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLSGNVEYLY  393

Query  1159  RARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             RA+AF  FL   A  ++A     G  D ++SLF+  AG+A L  D++ P  SRFP YE+
Sbjct  394   RAKAFACFLLEKADQLIAEGAMHG-GDRSFSLFEEKAGMAYLLLDMVDPSESRFPAYEL  451



>emb|CAJ86377.1| OSIGBa0155K17.4 [Oryza sativa Indica Group]
Length=422

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 192/395 (49%), Positives = 245/395 (62%), Gaps = 31/395 (8%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARG------GSAVTHMDPTVYTGLLGTAYTCLRSFQATG  339
             A+ FL AA+ LK +VV  TW  R       G AV   D T+YTG LGTA    R++  TG
Sbjct  50    ADRFLHAALHLKQKVVHETWDKRRRAAAAAGEAVG--DFTLYTGALGTALLLFRAYLVTG  107

Query  340   NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  519
             +R DL  CA+IV  C  AA       TF+CGR G+ ALGAV A + GD+     YL  F 
Sbjct  108   DRADLATCAEIVAAC-DAASMGAEIATFICGRAGVCALGAVVAKHAGDEAGVAHYLSAFK  166

Query  520   EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILE  699
             E+   K     P+E        LLYGRAG+LWA  F+ +HLG   +P  T   V+  I+ 
Sbjct  167   EI---KIHSKSPDE--------LLYGRAGYLWACTFLNKHLGDNTIPPTTTDTVMRDIIR  215

Query  700   GGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNN  879
              GR  S+    CPLMY W+G +YWGAAHGL+GI++VLL   L++D  E VKGTLRYM+ N
Sbjct  216   DGRTLSTIG--CPLMYEWYGEKYWGAAHGLSGIMHVLLDMDLTKDDTECVKGTLRYMIQN  273

Query  880   RFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKS  1059
             RFP SGNYPV+E +  D+ V WCHGA GI +TL KASQVFP +R F +A  EA EVVW  
Sbjct  274   RFP-SGNYPVTEEDKHDRFVHWCHGAPGISLTLAKASQVFPEER-FLEAIAEAAEVVWNR  331

Query  1060  GLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG---  1230
             GL+K+VG+  G +GNAY  L+L+RLT +  +  RA+AF  FL   A  ++A    DG   
Sbjct  332   GLLKRVGICHGVSGNAYTFLALFRLTKKKEHLYRAKAFACFLLDRAKQLIA----DGIMH  387

Query  1231  AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             + D  YSLF+G  G+A L+ D+I P +SRFPGYE+
Sbjct  388   SGDEPYSLFEGQVGMAYLFLDMINPLDSRFPGYEL  422



>ref|NP_001174024.1| Os04g0529600 [Oryza sativa Japonica Group]
 emb|CAD41202.1| OSJNBa0074L08.13 [Oryza sativa Japonica Group]
 emb|CAE03855.1| OSJNBa0081C01.1 [Oryza sativa Japonica Group]
 gb|EAY94933.1| hypothetical protein OsI_16739 [Oryza sativa Indica Group]
 gb|EAZ31418.1| hypothetical protein OsJ_15552 [Oryza sativa Japonica Group]
 dbj|BAH92752.1| Os04g0529600 [Oryza sativa Japonica Group]
Length=422

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 192/395 (49%), Positives = 245/395 (62%), Gaps = 31/395 (8%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARG------GSAVTHMDPTVYTGLLGTAYTCLRSFQATG  339
             A+ FL AA+ LK +VV  TW  R       G AV   D T+YTG LGTA    R++  TG
Sbjct  50    ADRFLHAALHLKQKVVHETWDKRRRAAAAAGEAVG--DFTLYTGALGTALLLFRAYLVTG  107

Query  340   NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  519
             +R DL  CA+IV  C  AA       TF+CGR G+ ALGAV A + GD+     YL  F 
Sbjct  108   DRADLATCAEIVAAC-DAASMGAEIATFICGRAGVCALGAVVAKHAGDEAGVAHYLSAFK  166

Query  520   EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILE  699
             E+   K     P+E        LLYGRAG+LWA  F+ +HLG   +P  T   V+  I+ 
Sbjct  167   EI---KIHSKSPDE--------LLYGRAGYLWACTFLNKHLGDNTIPPTTTDTVMRDIIR  215

Query  700   GGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNN  879
              GR  S+    CPLMY W+G +YWGAAHGL+GI++VLL   L++D  E VKGTLRYM+ N
Sbjct  216   DGRTLSTIG--CPLMYEWYGEKYWGAAHGLSGIMHVLLDMDLTKDDTECVKGTLRYMIQN  273

Query  880   RFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKS  1059
             RFP SGNYPV+E +  D+ V WCHGA GI +TL KASQVFP +R F +A  EA EVVW  
Sbjct  274   RFP-SGNYPVTEEDKHDRFVHWCHGAPGISLTLAKASQVFPEER-FLEAIAEAAEVVWNR  331

Query  1060  GLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG---  1230
             GL+K+VG+  G +GNAY  L+L+RLT +  +  RA+AF  FL   A  ++A    DG   
Sbjct  332   GLLKRVGICHGVSGNAYTFLALFRLTKKKEHLYRAKAFACFLLDRAKQLIA----DGIMH  387

Query  1231  AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             + D  YSLF+G  G+A L+ D+I P +SRFPGYE+
Sbjct  388   SGDEPYSLFEGQVGMAYLFLDMINPLDSRFPGYEL  422



>ref|XP_002884221.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60480.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   334 bits (857),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 186/410 (45%), Positives = 256/410 (62%), Gaps = 20/410 (5%)
 Frame = +1

Query  109   HEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYT  288
              E  ++SG  ++ +  A  +   ++   ++A+ LK+ VV  TW   G S  T  D T+Y+
Sbjct  15    KEKESESGGDSLRNLLAMPYSSLSQQLKRSALDLKETVVMETW---GFSGQTVEDFTLYS  71

Query  289   GLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAA  468
             G LG A+   R++Q TGN  DL LC +IV  C  AA A+   +TFLCGR G+  LGA AA
Sbjct  72    GTLGAAFLLFRAYQVTGNVNDLSLCLEIVKAC-DAASASSGDVTFLCGRAGVCGLGAAAA  130

Query  469   NYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  648
                G+++  + YL  F  +     LP            +LLYGR G+LWA LFI +++G 
Sbjct  131   KLSGEEELLNYYLAQFRLIRLSSDLP-----------NELLYGRVGYLWACLFINKYIGK  179

Query  649   EAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS  828
             E + ++T+  V + I++ GR+ +   S  PLM+ W+G RYWGAAHGLAGI++VL+   L 
Sbjct  180   ETLSSDTIREVAQEIIKDGRSMAKKGS-SPLMFEWYGKRYWGAAHGLAGIMHVLMDVQLK  238

Query  829   EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPN  1005
              D  EDVKGTL+YM+ NRFP SGNYP SE + R D LV WCHGA GI +TL KA++VF  
Sbjct  239   PDEAEDVKGTLKYMIKNRFP-SGNYPASEEDRRKDVLVHWCHGAPGIALTLVKAAEVF-G  296

Query  1006  DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFL  1185
             +REF +A   A EVVW  GL+K+VG+  G +GNAY  LSLYR TG S Y  RA+AF SFL
Sbjct  297   EREFLEAGAAAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATGMSEYLYRAKAFASFL  356

Query  1186  YHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                   +++  +  G  D  YSLF+G+AG+A L+ D++ P  +RFPGYE+
Sbjct  357   LDRGPKLLSKGEMHG-GDSPYSLFEGVAGMAYLYLDMVDPSQARFPGYEL  405



>ref|XP_011045509.1| PREDICTED: lanC-like protein GCL2 [Populus euphratica]
Length=409

 Score =   333 bits (854),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 185/387 (48%), Positives = 244/387 (63%), Gaps = 20/387 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++ F ++ + LK+ +V  TW    G  V H D T+Y+G LGTA    +S+Q T N  DL 
Sbjct  42    SKQFQRSGLDLKETIVMETWGL--GGQVVH-DFTLYSGNLGTALLLYKSYQVTSNENDLF  98

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC +IV  C SA+ A+ R +TF+CGR G+ ALGAVAA +  D+  +  YL    E+   K
Sbjct  99    LCLEIVKACDSASRAS-RDVTFICGRAGVCALGAVAAKHANDEALQSYYLSQLGEI---K  154

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              L   P+E        LLYGR+GFLWA LF+ +H+G   VP+ T+  V   I++ GRA +
Sbjct  155   LLRNHPDE--------LLYGRSGFLWACLFLNKHMGQGTVPDTTIRAVANEIIKNGRALA  206

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                   PLMY W+G RYWGAAHGLAGI+NVLL   L  D  EDVKGTL+YM+NN FP SG
Sbjct  207   KKGG-SPLMYEWYGERYWGAAHGLAGIMNVLLDVDLKPDDFEDVKGTLKYMINNCFP-SG  264

Query  898   NYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             NY  SE +  RD LV WCHGA GI +TL KA +VF  D+EF +AAI A EVVW  GL+K+
Sbjct  265   NYSTSEEDRKRDVLVHWCHGAPGIALTLVKAVKVF-GDKEFLEAAINAAEVVWNRGLLKR  323

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+    +GNAY  LSLY+LTG   +  +A+AF  FL   A  +++  +  G  D  YS+
Sbjct  324   VGICHDISGNAYVFLSLYQLTGNIEFLYKAKAFTCFLLDRAHKLISAGEMHG-GDSPYSM  382

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F+G  G+A L+ D+I P  +RFP YE+
Sbjct  383   FEGTGGMAYLFLDMIDPSKARFPAYEL  409



>ref|XP_009588409.1| PREDICTED: lanC-like protein GCL2 [Nicotiana tomentosiformis]
Length=423

 Score =   333 bits (854),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 239/385 (62%), Gaps = 20/385 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             +E F +AA+ LK+ ++  TW   G +     D T+Y G LGTA+   +S+Q T N  DL 
Sbjct  47    SEKFKRAALDLKETILVETW---GLTRQQVPDFTLYNGTLGTAFLMFKSYQVTNNTNDLA  103

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             +C+ IV  C  A+  + R +TFLCGR G+ ALGAV A Y GD Q    Y+  F E+   K
Sbjct  104   VCSQIVKDCDFASRNS-RDVTFLCGRAGVCALGAVVAKYMGDDQLVLYYVTQFKEIKLTK  162

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGRAGFLWA+LF+ +H+G   +P+     VV  I+E GR   
Sbjct  163   DLPD-----------ELLYGRAGFLWASLFMNKHIGKGTIPSTYTAAVVNEIIENGRRLG  211

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                   PLMY W+G  YWGAAHGLAGI+ VL+ F L  D +EDVK TLRYM+ NRFP SG
Sbjct  212   G-RGRSPLMYEWYGEMYWGAAHGLAGIMYVLMDFELKPDELEDVKETLRYMVKNRFP-SG  269

Query  898   NYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             NYP SE +  RD LV WCHGA GI +TL KA++VF  DREF +AA++A EVVW  GL+K+
Sbjct  270   NYPTSEEDKRRDVLVHWCHGAPGIALTLVKAAEVF-GDREFLNAAVDAAEVVWNRGLLKR  328

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+  G +GNAY  LSLY+LTG   Y  RA+A   FL   A  ++A  +  G  D  YSL
Sbjct  329   VGMCHGISGNAYVFLSLYQLTGNVEYLYRAKALACFLLDRAHKLIAKGEMHG-GDSPYSL  387

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGY  1329
             F+G+ G+A L+ D+  P  +RFP Y
Sbjct  388   FEGIGGMAYLFLDMTEPKEARFPAY  412



>ref|XP_009343572.1| PREDICTED: lanC-like protein GCR2 [Pyrus x bretschneideri]
Length=409

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/387 (46%), Positives = 242/387 (63%), Gaps = 21/387 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++    +A+ LK+ VV  T    GG  V   D ++YTG LGTA+   +++Q T N  DL+
Sbjct  43    SDILKSSALDLKETVVRQTC-GLGGKRVE--DYSLYTGALGTAFLAFKAYQVTKNESDLK  99

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC++IV  C SA+  + R ++F+CGR G+ ALGAV A + GD+   D Y+  F E+    
Sbjct  100   LCSEIVKACDSASTGS-RRVSFICGRAGVCALGAVVAKHTGDKMLLDRYISKFKEIKLSS  158

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRA-G  714
              LP            +LLYGRAGFLWA  F+ +H+G+  +    +  VV+ I++ GR   
Sbjct  159   DLP-----------NELLYGRAGFLWACSFLNKHIGNGTISTTRMRSVVDEIIKAGRQLA  207

Query  715   SSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHS  894
               D S   LMY WHG +YWGAAHGLAGI+ VL+   L  D VEDVKGTL YM+ NRFP S
Sbjct  208   KKDRS--SLMYEWHGKKYWGAAHGLAGIMYVLMSTELKPDEVEDVKGTLHYMIKNRFP-S  264

Query  895   GNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             GN+P SEG+  D LV WCHGA G+ +TL +A++VF  D+EF  AA++AGEVVW  GL+K+
Sbjct  265   GNFPSSEGSESDCLVHWCHGAPGVALTLLRAAEVF-GDQEFLQAAVDAGEVVWNRGLLKR  323

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+  G +GN Y  LSLYRLTG+  Y  RA+AF  FL+  A  +++     G  D  YSL
Sbjct  324   VGICHGISGNTYVFLSLYRLTGKVEYLYRAKAFACFLHDRALRLISEGTMHG-GDRPYSL  382

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F+G+ G+  L  D+  P  +RFP YE+
Sbjct  383   FEGVGGMVHLLLDMTEPSEARFPAYEL  409



>ref|XP_009617548.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana tomentosiformis]
Length=410

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 184/401 (46%), Positives = 247/401 (62%), Gaps = 24/401 (6%)
 Frame = +1

Query  148   DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  315
             DP      LP  T  Q    AA+ LK+ +V  TW ++GG      D T+YTG LGTA+  
Sbjct  29    DPLLKLLHLPYRTVCQKLQRAALDLKETIVKETWVSKGGRV---SDYTLYTGALGTAFLL  85

Query  316   LRSFQATGNRQDLRLCADIVDTCASAAPAT-IRHITFLCGRGGLYALGAVAANYCGDQQK  492
              +++Q T +  DL LC+ I+  C SA+  +  R +TF+CG+ G+YALGAV A + GD+Q 
Sbjct  86    FKAYQVTSDNNDLALCSHIIKACDSASRGSGCRRVTFICGQAGVYALGAVVAKHSGDEQL  145

Query  493   RDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETL  672
              D YL  F E+   K LP            +LLYGRAGFLWA  F+ +++G + +    +
Sbjct  146   CDYYLTKFKEIELPKDLP-----------NELLYGRAGFLWACSFLNKNIGRDTISPTQI  194

Query  673   MPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVK  852
               VV  +++ GR        CPLMY WH  +YWG AHGLAGI++VL+   L  D VEDVK
Sbjct  195   QAVVAEVIKSGR--KLGKGRCPLMYEWHEKKYWGVAHGLAGIMHVLMDMELKADEVEDVK  252

Query  853   GTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  1032
              TL YM+ N FP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D EF  AA 
Sbjct  253   DTLHYMIRNHFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLIKAAKVFSID-EFLQAAA  310

Query  1033  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  1212
             EA EVVW  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +A+AF  FL+  A  +++
Sbjct  311   EAAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKAKAFACFLHARAQTLIS  370

Query  1213  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  371   EGVMHG-GDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  410



>ref|XP_009400289.1| PREDICTED: lanC-like protein GCL2 [Musa acuminata subsp. malaccensis]
Length=404

 Score =   332 bits (850),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 180/385 (47%), Positives = 238/385 (62%), Gaps = 19/385 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             A+  L+AA+ LKD+VV  TW   G  A    D T+YTG  GTA+   +S+Q T NR DL 
Sbjct  38    ADKLLKAALDLKDKVVKETWVRSGRRA---KDYTLYTGAFGTAFLLFKSYQVTSNRSDLG  94

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC +IV  C  A+  +   +TF+CGR G+ ALGAV A   GD+     YL  F E+    
Sbjct  95    LCNEIVRACDQASQGS-PFVTFICGRAGVCALGAVVAKEAGDEDLLRHYLRSFREIKMPG  153

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              +P            +LLYGRAG+LWA  F+ +H+G   +P+  +  + E I+  G+  +
Sbjct  154   DVP-----------NELLYGRAGYLWACSFLNKHIGEGTIPSTDMSSIGEDIILDGKRLA  202

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                S CPLMY W+G +YWGAAHGLAGI++VL+   L  + +E VKGTL YM+ N FP SG
Sbjct  203   IKGS-CPLMYEWYGEKYWGAAHGLAGIMHVLMDVNLKPEDLEYVKGTLHYMIQNHFP-SG  260

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG   D+LV WCHGA G+ +TL KA+QVF  D+ F  AA EA +VVW  GL+K+V
Sbjct  261   NYPSSEGFDTDRLVHWCHGAPGVALTLTKAAQVF-QDKLFLKAAAEAADVVWNRGLLKRV  319

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAY  LSLYRLTG   Y  +A+AF  FL   A  ++A  +   + DH YSLF
Sbjct  320   GICHGVSGNAYVFLSLYRLTGNVSYLYQAKAFTCFLLDRANKLIAEGKMH-SGDHPYSLF  378

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYE  1332
             +G AG+A L+ D+  P  SRFP Y+
Sbjct  379   EGQAGMAYLFLDMTTPSQSRFPAYK  403



>ref|XP_004291663.1| PREDICTED: lanC-like protein GCR2 [Fragaria vesca subsp. vesca]
Length=403

 Score =   331 bits (848),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 180/386 (47%), Positives = 239/386 (62%), Gaps = 22/386 (6%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++    +A+ LK  VV  TW  R G      D ++YTG LGTA    +++Q T N  DL+
Sbjct  40    SDMLKSSALDLKQTVVMQTWGKRVG------DYSLYTGALGTACLAFKAYQVTKNLSDLK  93

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC DIV  C  A+  +  H++F+CGR G+ A GAVAA + GD    D YL  F E+    
Sbjct  94    LCCDIVKACDIASRDS-GHVSFICGRAGVCAFGAVAAKHAGDGMLLDHYLSQFKEIKLYS  152

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGRAG+LWA  F+ +++G+  V    +  VV+ I++ GR   
Sbjct  153   DLP-----------NELLYGRAGYLWACSFLNKNIGNGTVSTTRIRSVVDEIIKSGRQ-L  200

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             +      LMY WHG +YWGAAHGLAGI+ VL+   L  + VEDVKGTLRYM+ N FP SG
Sbjct  201   AKKGRSSLMYEWHGKKYWGAAHGLAGIMYVLMTVQLKPEEVEDVKGTLRYMIKNCFP-SG  259

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NY  SEG+  D+LV WCHGA G+ +TL KA++VF  D EF  AAI+AGEVVW+ GL+K+V
Sbjct  260   NYLSSEGSESDRLVHWCHGAPGVALTLVKAAEVF-GDEEFVQAAIDAGEVVWRRGLLKRV  318

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             GL  G +GN Y  LSLYR TG+  Y  RA+AF  FLY  A  +++  +  G  D  YSLF
Sbjct  319   GLCHGISGNTYVFLSLYRFTGKVEYLYRAKAFACFLYDRAPRLISEGRMHG-GDRPYSLF  377

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G+ G+A L+ D+  P  +RFPGYE+
Sbjct  378   EGVGGMAHLFLDMTDPSEARFPGYEL  403



>ref|XP_009617549.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana tomentosiformis]
Length=408

 Score =   331 bits (848),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 184/400 (46%), Positives = 247/400 (62%), Gaps = 24/400 (6%)
 Frame = +1

Query  148   DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  315
             DP      LP  T  Q    AA+ LK+ +V  TW ++GG      D T+YTG LGTA+  
Sbjct  29    DPLLKLLHLPYRTVCQKLQRAALDLKETIVKETWVSKGGRV---SDYTLYTGALGTAFLL  85

Query  316   LRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKR  495
              +++Q T +  DL LC+ I+  C SA+  + R +TF+CG+ G+YALGAV A + GD+Q  
Sbjct  86    FKAYQVTSDNNDLALCSHIIKACDSASRGSGR-VTFICGQAGVYALGAVVAKHSGDEQLC  144

Query  496   DSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLM  675
             D YL  F E+   K LP            +LLYGRAGFLWA  F+ +++G + +    + 
Sbjct  145   DYYLTKFKEIELPKDLP-----------NELLYGRAGFLWACSFLNKNIGRDTISPTQIQ  193

Query  676   PVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKG  855
              VV  +++ GR        CPLMY WH  +YWG AHGLAGI++VL+   L  D VEDVK 
Sbjct  194   AVVAEVIKSGR--KLGKGRCPLMYEWHEKKYWGVAHGLAGIMHVLMDMELKADEVEDVKD  251

Query  856   TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  1035
             TL YM+ N FP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D EF  AA E
Sbjct  252   TLHYMIRNHFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLIKAAKVFSID-EFLQAAAE  309

Query  1036  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  1215
             A EVVW  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +A+AF  FL+  A  +++ 
Sbjct  310   AAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKAKAFACFLHARAQTLISE  369

Query  1216  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                 G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  370   GVMHG-GDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  408



>ref|NP_850003.1| protein GCR2-LIKE 2 [Arabidopsis thaliana]
 sp|Q8VZQ6.1|GCL2_ARATH RecName: Full=LanC-like protein GCL2; AltName: Full=G protein-coupled 
receptor 2-like protein 2; Short=Protein GCR2-like 
2 [Arabidopsis thaliana]
 gb|AAL36290.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20120.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07068.1| protein GCR2-LIKE 2 [Arabidopsis thaliana]
Length=405

 Score =   331 bits (848),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 257/410 (63%), Gaps = 20/410 (5%)
 Frame = +1

Query  109   HEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYT  288
              E  + SG  T+ +  A  +   ++   ++A+ LK+ VV  TW   G S  T  D T+Y+
Sbjct  15    KEKESVSGGDTLRNLLAMPYSSLSQQLKRSALDLKETVVIETW---GFSGQTVEDFTLYS  71

Query  289   GLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAA  468
             G LG A+   R++Q TGN  DL LC +IV  C +A+ A+   +TFLCGR G+  LGAVAA
Sbjct  72    GTLGAAFLLFRAYQVTGNANDLSLCLEIVKACDTAS-ASSGDVTFLCGRAGVCGLGAVAA  130

Query  469   NYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  648
                G++   + YL  F  +     LP            +LLYGR G+LWA LFI +++G 
Sbjct  131   KLSGEEDLLNYYLGQFRLIRLSSDLP-----------NELLYGRVGYLWACLFINKYIGK  179

Query  649   EAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS  828
             E + ++T+  V + I++ GR+ +   S  PLM+ W+G RYWGAAHGLAGI++VL+   L 
Sbjct  180   ETLSSDTIREVAQEIIKEGRSMAKKGS-SPLMFEWYGKRYWGAAHGLAGIMHVLMDVQLK  238

Query  829   EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPN  1005
              D  EDVKGTL+YM+ NRFP SGNYP SE +  +D LV WCHGA GI +TL KA++VF  
Sbjct  239   PDEAEDVKGTLKYMIKNRFP-SGNYPASEEDKKKDILVHWCHGAPGIALTLGKAAEVF-G  296

Query  1006  DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFL  1185
             +REF +A+  A EVVW  GL+K+VG+  G +GNAY  L+LYR TG S Y  RA+AF SFL
Sbjct  297   EREFLEASAAAAEVVWNRGLLKRVGICHGISGNAYVFLALYRATGRSEYLYRAKAFASFL  356

Query  1186  YHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                   +++  +  G  D  YSLF+G+AG+A L+ D++ P  +RFPGYE+
Sbjct  357   LDRGPKLLSKGEMHG-GDSPYSLFEGVAGMAYLFLDMVDPSEARFPGYEL  405



>ref|XP_004248157.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Solanum lycopersicum]
Length=413

 Score =   331 bits (848),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 197/419 (47%), Positives = 261/419 (62%), Gaps = 26/419 (6%)
 Frame = +1

Query  82    ASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAV  261
             A  E    N +  N+S  + +   + P  IL ++ F +AA+ LK+ +V  TW   G +  
Sbjct  19    AIEEEQHPNPQGTNESLLKLL---STPYHIL-SKKFKRAALDLKETIVAETW---GLTRQ  71

Query  262   THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGG  441
                D T+Y G LGTA+   +++Q T N  DL +C+ IV  C SA+  + R +TFLCGR G
Sbjct  72    QVPDFTLYCGTLGTAFLLFKAYQVTKNTNDLAVCSQIVKDCDSASRHS-RDVTFLCGRAG  130

Query  442   LYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAA  621
             + ALGAV A Y GD Q    Y+  F E+   K LP            +LLYGRAG+LWA 
Sbjct  131   VCALGAVVAKYMGDDQLVFYYVSQFKEIKLTKDLPD-----------ELLYGRAGYLWAF  179

Query  622   LFIKQHLGSEAVPNETLMPVVEAILEGGRA-GSSDNSMCPLMYRWHGTRYWGAAHGLAGI  798
             LFI +H+G   +P+     V++ I++ GR  G    S  PLM+ W+G  YWGAAHGLAGI
Sbjct  180   LFINKHIGQGTIPSTYTAAVIDEIIKNGRKLGGKGRS--PLMHEWYGEMYWGAAHGLAGI  237

Query  799   LNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGIT  975
             ++VL+ F L  D +EDVKGTL+YM+ NRFP SGNYP SE +  RD LV WCHGA GI +T
Sbjct  238   MHVLMDFELKPDDLEDVKGTLKYMVKNRFP-SGNYPASENDRRRDLLVHWCHGAPGIVLT  296

Query  976   LCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQ  1155
             L KA++VF  D EF +AA+ A EVVW  GL+K+VG+  G +GNAYA LSLYRLTG + Y 
Sbjct  297   LVKAAEVF-GDEEFINAAVAAAEVVWNRGLLKRVGICHGISGNAYALLSLYRLTGNAEYL  355

Query  1156  ERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  1332
              RA+AF  FL   A  ++A  +  G  D  YSLF+G+AG+A L+ D+  P N+RFP YE
Sbjct  356   YRAKAFACFLLDRAHKLIAKGEMHG-GDTPYSLFEGIAGMAYLFLDMPDPKNARFPAYE  413



>ref|XP_010241996.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nelumbo nucifera]
Length=436

 Score =   329 bits (843),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 187/438 (43%), Positives = 258/438 (59%), Gaps = 45/438 (10%)
 Frame = +1

Query  103   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  282
             TN E G +    ++L   +  +   A    + A+ LK+ +V  TW   G S     D T+
Sbjct  17    TNDETGAEGIEDSLLKLLSLPYPTLAAKLKRTALDLKETIVTNTW---GFSGRCVSDFTL  73

Query  283   YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI------------------  408
             YTG LGTA+   +++QAT N+ DL LCA+IV  C SA+  +                   
Sbjct  74    YTGSLGTAFLLFKAYQATKNKNDLNLCAEIVKACDSASSGSGFSLSLSLSLHSFSLTVLI  133

Query  409   ---------RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEE  561
                        +TF+CGR G+ +LGA+AA + G++Q  + YL  F E+   K +P     
Sbjct  134   YGFMRLLYSSDVTFICGRAGVCSLGAIAAKHAGNEQLLNHYLTQFKEIKLPKNVP-----  188

Query  562   GGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPL  741
                    +LLYGRAGFLWA LFI +H+G   +P+    PVV+ I++ GR  +S  S CPL
Sbjct  189   ------NELLYGRAGFLWACLFINKHIGKGTIPSTLTGPVVKEIIKDGRRLASKVS-CPL  241

Query  742   MYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN  921
             M+ W+GT+YWGAAHGLAGI++VL+   L  D ++DV  TL YM+ NRF  SGNYP SE +
Sbjct  242   MFEWYGTKYWGAAHGLAGIMHVLMDMELKPDELQDVNDTLSYMIKNRFS-SGNYPSSEDD  300

Query  922   PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAG  1101
               D LV WCHGA G+ +TL KA++VF   R+F  AA +AGEVVW  GL+K+VG+  G +G
Sbjct  301   GTDCLVHWCHGAPGVALTLVKAAEVF-GGRQFLKAAGDAGEVVWNRGLLKRVGICHGVSG  359

Query  1102  NAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVAC  1281
             NAY  LSLYRLTG   +  RA+AF  FL   A  +++  +  G  D  YSLF+G+ G+A 
Sbjct  360   NAYVFLSLYRLTGNLEFLYRAKAFACFLLDMAPKLISEGKMHG-GDSPYSLFEGIGGMAY  418

Query  1282  LWFDLIAPHNSRFPGYEI  1335
             L+ D+I P  +RFP YE+
Sbjct  419   LFLDMIEPSEARFPAYEL  436



>ref|XP_006299729.1| hypothetical protein CARUB_v10015922mg [Capsella rubella]
 gb|EOA32627.1| hypothetical protein CARUB_v10015922mg [Capsella rubella]
Length=403

 Score =   326 bits (836),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 182/401 (45%), Positives = 249/401 (62%), Gaps = 24/401 (6%)
 Frame = +1

Query  148   DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  315
             D  +   ++P  +  Q    +A+ LK+ VV  TW   G S  T  D T+Y+G LG A+  
Sbjct  22    DSLSNLLVMPYSSLSQHLKRSALDLKETVVMNTW---GFSGQTVEDFTLYSGTLGAAFLL  78

Query  316   LRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKR  495
              R++Q T N  DL LC +IV  C  AA A+   +TFLCGR G+  LGA AA   G+++  
Sbjct  79    FRAYQVTRNANDLSLCLEIVKAC-DAASASSGDVTFLCGRAGVCGLGAAAAKLSGEEELL  137

Query  496   DSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLM  675
             + YL  F  +     LP            +LLYGR G+LWA LFI +++G E + ++T+ 
Sbjct  138   NYYLAQFRLIRLSSDLP-----------NELLYGRIGYLWACLFINKYVGKETLSSDTIR  186

Query  676   PVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKG  855
              V + I++ GR+ + + S  PLM+ W+G +YWGAAHGLAGI++VL+   L  D  EDVKG
Sbjct  187   QVAQEIIKEGRSMAKNGS-SPLMFEWYGRKYWGAAHGLAGIMHVLMDVQLKPDEAEDVKG  245

Query  856   TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  1032
             TLRYM+ NRFP SGNYP SE + R D LV WCHGA GI +TL KA++VF  +REF +A  
Sbjct  246   TLRYMIKNRFP-SGNYPASEEDRRKDVLVHWCHGAPGIALTLVKAAEVF-GEREFLEAGA  303

Query  1033  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  1212
              A EVVW  GL+K+VG+  G +GN Y  L+LYR TG S Y  RA+AF SFL      +++
Sbjct  304   AAAEVVWNRGLLKRVGICHGISGNTYVFLALYRATGRSEYLYRAKAFASFLLDRGPKLLS  363

Query  1213  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               +  G  D  YSLF+G+AG+A L+FD++ P  +RFP YE+
Sbjct  364   QGEMHG-GDSPYSLFEGVAGMAYLFFDMVDPSQARFPCYEL  403



>gb|AAD20918.1| hypothetical protein [Arabidopsis thaliana]
Length=371

 Score =   322 bits (824),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 176/377 (47%), Positives = 242/377 (64%), Gaps = 20/377 (5%)
 Frame = +1

Query  208   LKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCA  387
             +K++ +  TW   G S  T  D T+Y+G LG A+   R++Q TGN  DL LC +IV  C 
Sbjct  14    VKEKEMIETW---GFSGQTVEDFTLYSGTLGAAFLLFRAYQVTGNANDLSLCLEIVKACD  70

Query  388   SAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGG  567
             +A+ A+   +TFLCGR G+  LGAVAA   G++   + YL  F  +     LP       
Sbjct  71    TAS-ASSGDVTFLCGRAGVCGLGAVAAKLSGEEDLLNYYLGQFRLIRLSSDLP-------  122

Query  568   FGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMY  747
                  +LLYGR G+LWA LFI +++G E + ++T+  V + I++ GR+ +   S  PLM+
Sbjct  123   ----NELLYGRVGYLWACLFINKYIGKETLSSDTIREVAQEIIKEGRSMAKKGS-SPLMF  177

Query  748   RWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN-P  924
              W+G RYWGAAHGLAGI++VL+   L  D  EDVKGTL+YM+ NRFP SGNYP SE +  
Sbjct  178   EWYGKRYWGAAHGLAGIMHVLMDVQLKPDEAEDVKGTLKYMIKNRFP-SGNYPASEEDKK  236

Query  925   RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGN  1104
             +D LV WCHGA GI +TL KA++VF  +REF +A+  A EVVW  GL+K+VG+  G +GN
Sbjct  237   KDILVHWCHGAPGIALTLGKAAEVF-GEREFLEASAAAAEVVWNRGLLKRVGICHGISGN  295

Query  1105  AYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACL  1284
             AY  L+LYR TG S Y  RA+AF SFL      +++  +  G  D  YSLF+G+AG+A L
Sbjct  296   AYVFLALYRATGRSEYLYRAKAFASFLLDRGPKLLSKGEMHG-GDSPYSLFEGVAGMAYL  354

Query  1285  WFDLIAPHNSRFPGYEI  1335
             + D++ P  +RFPGYE+
Sbjct  355   FLDMVDPSEARFPGYEL  371



>emb|CDY53809.1| BnaA06g01740D [Brassica napus]
Length=386

 Score =   322 bits (826),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 181/410 (44%), Positives = 244/410 (60%), Gaps = 46/410 (11%)
 Frame = +1

Query  118   GNDSGFRTVLDPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVY  285
             G +  F T  D       LP  +F +     A+SLKD +V  TW  R G  V   D  +Y
Sbjct  19    GEEETFSTHKDSLTKLLSLPYRSFSKKLQRYALSLKDTIVFETWD-RSGKRVR--DFNLY  75

Query  286   TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  465
             TG+LGTAY   +S+Q   N  DL+LC +IV+ C +A+  + R +TF+CGR G+ ALGAVA
Sbjct  76    TGVLGTAYLLFQSYQVARNENDLKLCLEIVEACYTASKDSDR-VTFICGRAGVCALGAVA  134

Query  466   ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  645
             A   GD Q +D YL  F E+     LP           Y+LLYGRAG+LWA LF+ +H+G
Sbjct  135   AKLTGDSQLQDRYLARFHEIRLPGDLP-----------YELLYGRAGYLWACLFLNKHIG  183

Query  646   SEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPL  825
              ++V +  +  VVE I   GR    +   CPLM+ WHG +YWGAAHGLAGI++VL+H  L
Sbjct  184   KDSVSSARMRSVVEEIFRAGRQ-LGERVKCPLMFEWHGKKYWGAAHGLAGIMHVLMHVEL  242

Query  826   SEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPN  1005
               D +EDVKGTL YM+ +RFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QVF  
Sbjct  243   EPDEMEDVKGTLSYMIQHRFP-SGNYLSSEGSESDRLVHWCHGAPGVALTLVKAAQVFRT  301

Query  1006  DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFL  1185
             D EF +AA+EAGEVVW  GL+K+                      E +Y  RA+AF SFL
Sbjct  302   D-EFVEAAMEAGEVVWNRGLLKR---------------------PEYLY--RAKAFASFL  337

Query  1186  YHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                +  +++  +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  338   LDKSEKLISEGKMHG-GDRPFSLFEGIGGMAYMFLDMNEPTQALFPGYEL  386



>emb|CDP14758.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   323 bits (827),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 185/409 (45%), Positives = 247/409 (60%), Gaps = 28/409 (7%)
 Frame = +1

Query  121   NDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDM--TWKARGGSAVTHMDPTVYTGL  294
              +S FR +  P    +   +E   +AA+ LK+ +V +  TW   G       D T+Y+G 
Sbjct  37    EESLFRLLATP----YTTLSEKLKRAALDLKETIVVVVDTWGLTGQKVD---DFTLYSGA  89

Query  295   LGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANY  474
             LGTA    +SF  T N  DL LC+ IV+ C SA+  +   +TF+CGR G+ ALGAV A Y
Sbjct  90    LGTALLLFKSFLVTRNGNDLILCSQIVNACDSASLHST-DVTFICGRAGVCALGAVVAKY  148

Query  475   CGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEA  654
              G  Q    YL++F E+   + LP            +LLYGRAG+LWA LFI +H+G   
Sbjct  149   LGYDQLLHYYLNHFKEIRLTRDLPD-----------ELLYGRAGYLWACLFINEHIGRGT  197

Query  655   V-PNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSE  831
             + P E    V E    G + G    S  PLM+ W+G +YWGAAHGLAGI+++LLHF L  
Sbjct  198   ILPTEMGAAVKEIFRSGRKLGGRGRS--PLMFEWYGEKYWGAAHGLAGIMHILLHFELKA  255

Query  832   DGVEDVKGTLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPND  1008
             D  E+VK TL YM+ NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF  D
Sbjct  256   DEREEVKETLNYMIKNRFP-SGNYPASEEDKRRDVLVHWCHGAPGIALTLVKAAEVF-GD  313

Query  1009  REFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLY  1188
             + F  AAI+A EVVW  GL+K+VG+  G +GN Y  L+LYRLTG   +  RA+AF  FL 
Sbjct  314   KRFLQAAIDAAEVVWNRGLLKRVGICHGVSGNTYVFLALYRLTGNVEFLYRAKAFSCFLL  373

Query  1189  HNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               A  +++  +  G  D  YSLF+G+ G+A L+ D++ P N+RFP YE+
Sbjct  374   DRAYKLISKGEMHG-GDSPYSLFEGIGGMAYLFLDMVEPTNARFPAYEL  421



>emb|CDY26028.1| BnaC06g05960D [Brassica napus]
Length=386

 Score =   318 bits (814),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 179/410 (44%), Positives = 242/410 (59%), Gaps = 46/410 (11%)
 Frame = +1

Query  118   GNDSGFRTVLDPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVY  285
             G +    T  D       LP  +F +     A+SLKD +V  TW+ R G  V   D  +Y
Sbjct  19    GEEETVSTHKDSLTKLLSLPYRSFSKKLQRYALSLKDTIVFETWE-RSGKRVR--DFNLY  75

Query  286   TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  465
             TG+LGTAY   +S Q T N+ DL+LC +IV+ C +A+  + R +TF+CGR G+ ALGAVA
Sbjct  76    TGVLGTAYLLFKSCQVTRNKNDLKLCLEIVEACYTASKDSDR-VTFICGRAGVCALGAVA  134

Query  466   ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  645
             A   GD Q +D YL  F E+     LP           Y+LLYGRAG+LWA LF+ +H+ 
Sbjct  135   AKLTGDSQLQDRYLARFHEIRLPSDLP-----------YELLYGRAGYLWACLFLNKHIE  183

Query  646   SEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPL  825
              ++V +  +  VVE I   GR        CPLM+ WHG +YWG AHGLAGI++VL+H  L
Sbjct  184   KDSVSSARMRSVVEEIFRAGRQLGG-RVKCPLMFEWHGKKYWGTAHGLAGIMHVLMHVEL  242

Query  826   SEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPN  1005
               D +EDVKGTL YM+ +RFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QVF  
Sbjct  243   EPDEMEDVKGTLSYMIQHRFP-SGNYLSSEGSESDRLVHWCHGAPGVALTLVKAAQVFRK  301

Query  1006  DREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFL  1185
             D EF +AA+EAGEVVW  GL+K+                      E +Y  RA+AF SFL
Sbjct  302   D-EFVEAAMEAGEVVWNRGLLKR---------------------PEYLY--RAKAFASFL  337

Query  1186  YHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                +  +++  +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  338   LDKSEKLISEGKMQG-GDRRFSLFEGIGGMAYMFLDMNEPTQALFPGYEL  386



>ref|XP_007207243.1| hypothetical protein PRUPE_ppa006265m1g, partial [Prunus persica]
 gb|EMJ08442.1| hypothetical protein PRUPE_ppa006265m1g, partial [Prunus persica]
Length=235

 Score =   312 bits (799),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 184/239 (77%), Gaps = 10/239 (4%)
 Frame = +1

Query  58   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  237
            MS  +   +SPE     HED N+     ++DPTAP++ LP+ETFL+AAVSLKDQVV  TW
Sbjct  1    MSFGVELTSSPE----GHEDANNERL-DLIDPTAPNWSLPSETFLRAAVSLKDQVVQATW  55

Query  238  KARGGSAV-----THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPA  402
            +  G S         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L  ++VD C +   A
Sbjct  56   EGGGDSGSGLRTGMVLDPTVYTGLLGTAFTCLRSYEATGNRQDLVLSTEVVDKCVTIERA  115

Query  403  TIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSY  582
            + RH+TFLCGRGG+YA+GAV AN  GD Q+RD YL+ F EVAQEKAL VGPEEGGFGMSY
Sbjct  116  STRHVTFLCGRGGVYAIGAVVANLIGDHQRRDLYLNLFLEVAQEKALSVGPEEGGFGMSY  175

Query  583  DLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHG  759
            DLL+GRAGFLWAALFI ++LG E VP++ LMPVV+A+L GGRAG+SDN  CPLMYRWHG
Sbjct  176  DLLHGRAGFLWAALFINKYLGQEKVPSDLLMPVVDAVLAGGRAGASDNPSCPLMYRWHG  234



>gb|KDO74127.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=298

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 205/309 (66%), Gaps = 15/309 (5%)
 Frame = +1

Query  409   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  588
             R +TF+CGR G+ ALGAV A + GD++  D YL  F E+     LP            +L
Sbjct  5     RRVTFICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPSDLP-----------NEL  53

Query  589   LYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRY  768
             LYGR GFLWA  F+ +H+G + +    +  VV+ I++ GR   ++   CPLMY WHG +Y
Sbjct  54    LYGRVGFLWACSFLNKHMGKDTISTAQMRAVVDEIIKAGRR-LANRGRCPLMYEWHGKKY  112

Query  769   WGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWC  948
             WGAAHGLAGI++VL+   L  D VEDVKGTLRYM+ NRFP SGNYP SEG+  D+LV WC
Sbjct  113   WGAAHGLAGIMHVLMDMELKPDEVEDVKGTLRYMIKNRFP-SGNYPSSEGSESDRLVHWC  171

Query  949   HGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLY  1128
             HGA G+ +TL KA++VF  ++EF  AA++AGEVVWK GL+K+VG+  G +GN Y  LSLY
Sbjct  172   HGAPGVTLTLAKAAEVF-GEKEFLQAAVDAGEVVWKRGLLKRVGICHGISGNTYVFLSLY  230

Query  1129  RLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPH  1308
             RLTG   Y  RA+AF  FLY  A  ++A  +  G  D  YSLF+G+ G+  L+ D+I P 
Sbjct  231   RLTGNVEYLYRAKAFACFLYDRAQKLIAEGKMHG-GDRPYSLFEGIGGMTHLFLDMIEPS  289

Query  1309  NSRFPGYEI  1335
              +RFP YE+
Sbjct  290   EARFPAYEL  298



>gb|AGV54199.1| lanC-like protein [Phaseolus vulgaris]
Length=414

 Score =   313 bits (803),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 185/423 (44%), Positives = 256/423 (61%), Gaps = 30/423 (7%)
 Frame = +1

Query  88    PESNGTNHEDGNDSGFRTVLDPTAPSFILP----AETFLQAAVSLKDQVVDMTWKARGGS  255
             PE+  +  ++  ++   TV D       +P    +E   +AA+ LK+ +V  TW   G S
Sbjct  15    PEATPSTPQEQEEA--LTVGDSLPKLLAMPHAPLSERLKRAALDLKETIVIETW---GVS  69

Query  256   AVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGR  435
                  D ++Y G+LGTA+  L+S++ T N  DL LC+ IV  C  AA    R +TF+CGR
Sbjct  70    WRKDGDFSLYCGVLGTAFLLLKSYEVTRNGNDLSLCSQIVKAC-DAASVRSRDVTFICGR  128

Query  436   GGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLW  615
              G+ +LGAVAA + GD +    Y+  F ++   K LP            +LLYG++ FL 
Sbjct  129   AGVCSLGAVAAKHAGDDESLRYYMAQFEKIKLSKDLPD-----------ELLYGKSWFLV  177

Query  616   AALFIKQHLGS-EAVPNETLMPVVEAI-LEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGL  789
                  KQHLG      + TL  ++++  +E G  G      CP+M+ W+G +YWGAAHGL
Sbjct  178   GLFVPKQHLGQGNGSFSYTLWVLMKSFKMERGWVG---RGRCPVMFEWYGEKYWGAAHGL  234

Query  790   AGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGI  966
             AGI++VL+   L  D +EDVKGTL+YM++NRF  SGNYP SE + + D LV WCHGA GI
Sbjct  235   AGIMHVLMEMELKPDELEDVKGTLKYMISNRF-RSGNYPASEDDRKSDVLVHWCHGAPGI  293

Query  967   GITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGES  1146
              +TL KA +VF  D+EF DAA+EAGEVVW  GL+KKVG+  G +GNAY  LSLY+LTG  
Sbjct  294   ALTLVKAGKVF-GDKEFLDAAMEAGEVVWNRGLLKKVGICHGISGNAYVFLSLYQLTGNV  352

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              +  RA+AF  FL   A  +++G +  G  D  YSLF+GL G+A L+ D+I P  S+FP 
Sbjct  353   KHLYRAKAFACFLLDRAHKLISGGEMHG-GDRPYSLFEGLGGMAYLFLDMIDPSLSKFPA  411

Query  1327  YEI  1335
             YE+
Sbjct  412   YEL  414



>ref|XP_010555129.1| PREDICTED: lanC-like protein GCL2 [Tarenaya hassleriana]
Length=405

 Score =   313 bits (801),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 177/387 (46%), Positives = 244/387 (63%), Gaps = 20/387 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++ F ++A+ LK+ +V  TW   G S     D T+Y+G LG A    +  Q + N  DL 
Sbjct  38    SQQFKRSALDLKETIVMETW---GFSGQNVKDFTLYSGTLGAALLLFKVHQMSKNANDLA  94

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC  IV  C +A+ ++ R++TF+CGR G+ ALGA AA   G+ +    YL  F ++   +
Sbjct  95    LCLQIVKACDAASRSS-RNVTFICGRAGVCALGAAAAKVAGEAELLSYYLTQFRQIELPR  153

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGRAG+LWA LF+ +H+G E VP+ T+  VV  +++GGR  +
Sbjct  154   DLPD-----------ELLYGRAGYLWACLFLNKHIGEETVPSATISEVVGEVIKGGRTMA  202

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                S  PLMY W+G +YWGAAHGLAGI+NVL+  PL  D  EDVKGTL+Y++ NRFP  G
Sbjct  203   KKGS-SPLMYEWYGDKYWGAAHGLAGIMNVLMDVPLKPDEAEDVKGTLKYLIKNRFP-CG  260

Query  898   NYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             NY  SE +  RD LV WCHGA GI +TL KA++VF  D +F  AA +A EVVW  GL+K+
Sbjct  261   NYAASEEDRRRDVLVHWCHGAPGIALTLTKAAKVF-GDGDFLKAAADAAEVVWNRGLLKR  319

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+  G +GNAY  LSLYR T  + Y  RA+AF  FL   A ++++  +  G  D  YSL
Sbjct  320   VGICHGISGNAYVFLSLYRATSNTEYLYRAKAFACFLLDRAHELLSEGEMHG-GDSPYSL  378

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F+G+ G+A L+ D++ P  +RFPGYE+
Sbjct  379   FEGIGGMAYLFLDMVEPSQARFPGYEL  405



>ref|XP_010555131.1| PREDICTED: lanC-like protein GCL2 [Tarenaya hassleriana]
Length=405

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 177/387 (46%), Positives = 243/387 (63%), Gaps = 20/387 (5%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++ F ++A+ LK+ +V  TW   G S     D T+Y+G LG A    +  Q + N  DL 
Sbjct  38    SQQFKRSALDLKETIVMETW---GFSGQNVKDFTLYSGTLGAALLLFKVHQMSKNANDLA  94

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC  IV  C +A+ ++ R +TF+CGR G+ ALGA AA   G+ +    YL  F ++   +
Sbjct  95    LCLQIVKACDAASRSS-RDVTFICGRAGVCALGAAAAKVAGEAELLSYYLTQFRQIELPR  153

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGRAG+LWA LF+ +H+G E VP+ T+  VV  +++GGR  +
Sbjct  154   DLPD-----------ELLYGRAGYLWACLFLNKHIGEETVPSATISEVVGEVIKGGRTMA  202

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                S  PLMY W+G +YWGAAHGLAGI+NVL+  PL  D  EDVKGTL+Y++ NRFP  G
Sbjct  203   KKGS-SPLMYEWYGDKYWGAAHGLAGIMNVLMDVPLKPDEAEDVKGTLKYLIKNRFP-CG  260

Query  898   NYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK  1074
             NY  SE +  RD LV WCHGA GI +TL KA++VF  D +F  AA +A EVVW  GL+K+
Sbjct  261   NYAASEEDRRRDVLVHWCHGAPGIALTLTKAAKVF-GDGDFLKAAADAAEVVWNRGLLKR  319

Query  1075  VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSL  1254
             VG+  G +GNAY  LSLYR T  + Y  RA+AF  FL   A ++++  +  G  D  YSL
Sbjct  320   VGICHGISGNAYVFLSLYRATSNTEYLYRAKAFACFLLDRAHELLSEGEMHG-GDSPYSL  378

Query  1255  FQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             F+G+ G+A L+ D++ P  +RFPGYE+
Sbjct  379   FEGIGGMAYLFLDMVEPSQARFPGYEL  405



>ref|XP_009102106.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Brassica 
rapa]
Length=408

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 173/418 (41%), Positives = 249/418 (60%), Gaps = 22/418 (5%)
 Frame = +1

Query  88    PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  267
             P+ + +  E+G+     ++++  A  +   ++   ++A+ LK+ VV  TW   G +    
Sbjct  11    PDLSQSVAEEGD-----SLMNLLAMPYSFLSQNLQRSALGLKETVVMETW---GFTGQLV  62

Query  268   MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  447
              D  +Y+G LG A+   R++Q T N  DL L   I+  C  AA A+ R ITF+CGR G+ 
Sbjct  63    QDFPLYSGTLGAAFLLFRAYQVTANPNDLSLFLQILKACCDAASASSRDITFICGRAGVC  122

Query  448   ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  627
             ALG  AA   GDQ+  + YL  F +      L          ++ +LLYG  G+LWA LF
Sbjct  123   ALGTAAAKRSGDQELLNYYLSQFRQFCFSTLLSSY-------IANELLYGIVGYLWACLF  175

Query  628   IKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNV  807
             + +++G+E + + T+  V E I++  R+  + N   PLM+ W+G RYWG AHGLAGI++V
Sbjct  176   VNKYVGAETLSSTTIHQVTEEIIKESRS-MTKNEKSPLMFEWYGQRYWGTAHGLAGIMHV  234

Query  808   LLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGITLCK  984
             L+   L  D  EDVKGTL+Y++NNRFP S NYP SE +  RD LV WCHGA GI +TL K
Sbjct  235   LMDVQLKPDEAEDVKGTLKYLINNRFP-SXNYPASEEDRRRDLLVHWCHGAPGIALTLVK  293

Query  985   ASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERA  1164
             A++     REF +A   A EVVW  GL+K+VG+  G +GNAY  LS YR TG + Y  RA
Sbjct  294   AAEFL--GREFLEAGEAAAEVVWNRGLLKRVGICHGISGNAYVFLSFYRATGRNEYLHRA  351

Query  1165  RAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAG-VACLWFDLIAPHNSRFPGYEI  1335
             +AF SFL      +++  +  G  D  YSLF+G+ G +A L+ D++ P  +RFPGYE+
Sbjct  352   KAFASFLLDRGHKLLSKGEMHG-GDSPYSLFEGVVGKMAYLFLDMVDPSQARFPGYEL  408



>ref|XP_010686440.1| PREDICTED: lanC-like protein GCL2 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 176/382 (46%), Positives = 238/382 (62%), Gaps = 20/382 (5%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  372
             + A+ +K+ VV  TW   G + V   D T+Y G LGTA+   +S++ T N  DL LC +I
Sbjct  48    RQALDIKETVVVETWGRSGQNVV---DFTLYVGDLGTAFLLFKSYKVTNNIHDLTLCHEI  104

Query  373   VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  552
             V  C  A+  + R +TF+CGR G+ ALGAV A + G++Q  + YL  F ++   K LP  
Sbjct  105   VKACDHASSHS-RDVTFICGRAGVCALGAVVAKHMGNEQLLNYYLTQFKQINLPKDLPD-  162

Query  553   PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM  732
                       +LLYGRAGFLWA LF+ +HLG   +P   +  V+  I+E GR    +   
Sbjct  163   ----------ELLYGRAGFLWACLFVNKHLGDGTIPPMIMRSVITDIIEDGRR-MPNKGK  211

Query  733   CPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVS  912
              PLM+ W+G +YWGAAHGLAGI++VL+   L  D  EDVK TL  M+ NRFP SGNYP S
Sbjct  212   WPLMFEWYGEKYWGAAHGLAGIMHVLMETDLKPDEREDVKNTLLSMIQNRFP-SGNYPAS  270

Query  913   -EGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLAD  1089
              E + RD LV WCHGA G+ +TL KA +V   D+ F +AA EA EVVW+ GL+K+VG+  
Sbjct  271   GEDSRRDLLVHWCHGAPGVALTLIKAYEVL-GDKVFLEAAAEAAEVVWRRGLLKRVGICH  329

Query  1090  GTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLA  1269
             G +GN Y  LSLYR+T    Y  RA+AF SFL  NA  ++A  +  G  D+ YSLF+G+ 
Sbjct  330   GISGNTYVFLSLYRVTRNPSYLYRAKAFASFLLDNAHKLIAAGEMHG-GDNPYSLFEGIG  388

Query  1270  GVACLWFDLIAPHNSRFPGYEI  1335
             G+A L+ D+  P ++RFP YE+
Sbjct  389   GMAYLFLDMKEPTSARFPAYEL  410



>gb|KJB84322.1| hypothetical protein B456_N018400 [Gossypium raimondii]
 gb|KJB84325.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=300

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 205/309 (66%), Gaps = 15/309 (5%)
 Frame = +1

Query  409   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  588
             R +TF+CGR G+YALGAV A + GD   +  YL+ F E+     LP           ++L
Sbjct  7     RRVTFICGRAGVYALGAVIAKHSGDTSLQQRYLEKFKEIRFPSDLP-----------HEL  55

Query  589   LYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRY  768
             LYGRAGFLWA  F+ +H+G + +    +  VV+ I+E G+   +    CPLMY WHG +Y
Sbjct  56    LYGRAGFLWACSFLNKHIGKDTISTARIRAVVDEIIESGKR-LAGKGRCPLMYEWHGKKY  114

Query  769   WGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWC  948
             WGAAHGLAGI++VL+   L  D  E VKGTLRY++ NRFP SGNYP SEG+  D+LV WC
Sbjct  115   WGAAHGLAGIIHVLMDTELKPDEAEYVKGTLRYIIKNRFP-SGNYPSSEGSESDRLVHWC  173

Query  949   HGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLY  1128
             HGA GI +TL KA++VF  D+EF  AA++AGEVVWK GL+K+VG+  G +GNAY  LSLY
Sbjct  174   HGAPGITLTLVKAAEVF-GDKEFLQAALDAGEVVWKRGLLKRVGICHGISGNAYVFLSLY  232

Query  1129  RLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPH  1308
             RLTG   Y  RA+AF SFL   A  +++  +  G  D  YSLF+G+ G+A L+ D++   
Sbjct  233   RLTGNVEYLYRAKAFTSFLSDRAEKLISQGKMHG-GDRPYSLFEGIGGMAHLFLDMVKAS  291

Query  1309  NSRFPGYEI  1335
              +RFP YEI
Sbjct  292   EARFPAYEI  300



>gb|KJB84323.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=340

 Score =   305 bits (781),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 206/313 (66%), Gaps = 15/313 (5%)
 Frame = +1

Query  397   PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  576
             P+    +TF+CGR G+YALGAV A + GD   +  YL+ F E+     LP          
Sbjct  43    PSKKPRVTFICGRAGVYALGAVIAKHSGDTSLQQRYLEKFKEIRFPSDLP----------  92

Query  577   SYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWH  756
              ++LLYGRAGFLWA  F+ +H+G + +    +  VV+ I+E G+   +    CPLMY WH
Sbjct  93    -HELLYGRAGFLWACSFLNKHIGKDTISTARIRAVVDEIIESGKR-LAGKGRCPLMYEWH  150

Query  757   GTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKL  936
             G +YWGAAHGLAGI++VL+   L  D  E VKGTLRY++ NRFP SGNYP SEG+  D+L
Sbjct  151   GKKYWGAAHGLAGIIHVLMDTELKPDEAEYVKGTLRYIIKNRFP-SGNYPSSEGSESDRL  209

Query  937   VQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYAS  1116
             V WCHGA GI +TL KA++VF  D+EF  AA++AGEVVWK GL+K+VG+  G +GNAY  
Sbjct  210   VHWCHGAPGITLTLVKAAEVF-GDKEFLQAALDAGEVVWKRGLLKRVGICHGISGNAYVF  268

Query  1117  LSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDL  1296
             LSLYRLTG   Y  RA+AF SFL   A  +++  +  G  D  YSLF+G+ G+A L+ D+
Sbjct  269   LSLYRLTGNVEYLYRAKAFTSFLSDRAEKLISQGKMHG-GDRPYSLFEGIGGMAHLFLDM  327

Query  1297  IAPHNSRFPGYEI  1335
             +    +RFP YEI
Sbjct  328   VKASEARFPAYEI  340



>ref|XP_010918435.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Elaeis guineensis]
Length=365

 Score =   304 bits (778),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 172/386 (45%), Positives = 222/386 (58%), Gaps = 58/386 (15%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             A+  L+AA+ LK++VV  TW    G A    D T+YTG LGTA+   +++Q T NR DL 
Sbjct  38    ADKLLRAALDLKEKVVKETWVRLRGRA---KDFTLYTGALGTAFLLFKAYQVTNNRGDLS  94

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC++I+  C  A+     H+TF+CGR G+ ALGAV A + GD+   + YL  F       
Sbjct  95    LCSEIIRACDVASQGD-PHVTFICGRAGVCALGAVVAKHAGDEALLNHYLSSF-------  146

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
                                 R G L                        E I +G R   
Sbjct  147   --------------------RGGAL----------------------AKEIITDGKRL--  162

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             S+   CPLMY WHG +YWGAAHGLAGI++VL+   L  D  ED+KGTL+YM+ NRFP SG
Sbjct  163   SNRGRCPLMYEWHGKKYWGAAHGLAGIMHVLMDMDLKPDEKEDIKGTLQYMIRNRFP-SG  221

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKV  1077
             NYP SEG+  D+LV WCHGA G+ +TL KASQVF  + +F   A+EA EVVW  GL+K+V
Sbjct  222   NYPSSEGSNNDRLVHWCHGAPGVSLTLTKASQVF-QEEQFLQVAVEAAEVVWNRGLLKRV  280

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  G +GNAY  LSLYRLTG+  Y  RA+AF  FL   A  ++A     G  D  YSLF
Sbjct  281   GICHGISGNAYVFLSLYRLTGKVEYLYRAKAFACFLLDKANKLIADGLMHG-GDRPYSLF  339

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G AG+A L+ D++ P  SRFP YE+
Sbjct  340   EGQAGMAHLFLDMVRPSESRFPAYEL  365



>ref|XP_007207244.1| hypothetical protein PRUPE_ppa006265m2g, partial [Prunus persica]
 gb|EMJ08443.1| hypothetical protein PRUPE_ppa006265m2g, partial [Prunus persica]
Length=184

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  775   AAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHG  954
             AA+GLAGI     HFPL +D  EDVK TLRYMM NRFPHSGNYP SEGNPRDK V W HG
Sbjct  1     AANGLAGICKSA-HFPLLKD-AEDVKATLRYMMANRFPHSGNYPSSEGNPRDKFVHWSHG  58

Query  955   ATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRL  1134
             A G+ ITLCKASQVFP DREFR AAIEAGEVVWK+GL+KKVGLADG AGNAYA LSLYRL
Sbjct  59    AAGMAITLCKASQVFPGDREFRHAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRL  118

Query  1135  TGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNS  1314
             TGE+IY+ RA+AF SFLYHN  +++      G A+HAYSLFQGLAG ACL FDL  P N+
Sbjct  119   TGEAIYEGRAKAFASFLYHNGRELVTVGDTHG-AEHAYSLFQGLAGTACLLFDLHVPENA  177

Query  1315  RFPGYEI  1335
             RFPGYE+
Sbjct  178   RFPGYEL  184



>ref|XP_007043561.1| GCR2-like 2 isoform 3 [Theobroma cacao]
 gb|EOX99392.1| GCR2-like 2 isoform 3 [Theobroma cacao]
Length=288

 Score =   264 bits (675),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 138/293 (47%), Positives = 189/293 (65%), Gaps = 15/293 (5%)
 Frame = +1

Query  460   VAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQH  639
             +AA + G+Q+  D YL  F E+     LP            +LLYGRAGFLWA +F+ +H
Sbjct  10    LAAKHAGNQELLDYYLSQFKEIKLSSNLPD-----------ELLYGRAGFLWACVFLNKH  58

Query  640   LGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHF  819
             LG   +P+ T   VV+ +++ GR  +      PLM+ ++G +YWGAAHGLAGI++VL+  
Sbjct  59    LGEGTIPSTTTRAVVDEVIKNGRQLAKKGGGSPLMFEFYGEKYWGAAHGLAGIMHVLMDM  118

Query  820   PLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGITLCKASQV  996
              L  D + DVKGTL+YM+ NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++V
Sbjct  119   ELEPDEIMDVKGTLKYMIRNRFP-SGNYPASEQDRKRDVLVHWCHGAPGIALTLVKAAEV  177

Query  997   FPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFG  1176
             F +D EF +AA++A EVV+  GL+K+VG+  G +GNAY  LSLYR TG   +  RA+AF 
Sbjct  178   FGDD-EFLEAAVDAAEVVFNRGLLKRVGICHGISGNAYVFLSLYRKTGNVEFLYRAKAFA  236

Query  1177  SFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              FL   A  +++  +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE 
Sbjct  237   CFLLDRAHKLISKGEMHG-GDRPYSLFEGIGGMAYLFLDMIEPLGARFPAYEF  288



>ref|XP_002982067.1| hypothetical protein SELMODRAFT_115837, partial [Selaginella 
moellendorffii]
 gb|EFJ16735.1| hypothetical protein SELMODRAFT_115837, partial [Selaginella 
moellendorffii]
Length=215

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 163/219 (74%), Gaps = 4/219 (2%)
 Frame = +1

Query  679   VVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGT  858
             +V+AIL  GRAG+S +S CPLMY+WHGTRYWGAAHGLAGI+ VL+HFPLS     DVK T
Sbjct  1     IVDAILAAGRAGASQSS-CPLMYQWHGTRYWGAAHGLAGIMYVLMHFPLSARDAADVKET  59

Query  859   LRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEA  1038
             L YM+ NRF  SGNYP S+GN RDKL+ WCHGA GI +TLCKA++VFP +  FR+AA+ A
Sbjct  60    LLYMIANRF-QSGNYPSSDGNQRDKLIHWCHGAPGICLTLCKAAKVFP-EPVFREAAVAA  117

Query  1039  GEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGS  1218
             GE++WK GL+++VGL  G +GN Y  L+LYRLTG+  +  RAR+F +FL +   +++   
Sbjct  118   GELIWKKGLLRRVGLCHGVSGNTYPFLALYRLTGDRKHLFRARSFATFLCNQGRELIDSG  177

Query  1219  QGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
                G  DH YSLF+GLAG A LW DL  P  +RFPGYE+
Sbjct  178   DMHG-GDHPYSLFEGLAGTAFLWLDLQRPEEARFPGYEL  215



>gb|ERM97345.1| hypothetical protein AMTR_s00073p00158570 [Amborella trichopoda]
Length=248

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 161/213 (76%), Gaps = 6/213 (3%)
 Frame = +1

Query  193  QAAVSLKDQVVDMTW-KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCAD  369
            +AAV +K++VV+ TW K+ GG+     DPT+YTGLLGTA+TCL S +ATGN +DL++ +D
Sbjct  35   KAAVGMKEEVVENTWRKSEGGTE----DPTLYTGLLGTAFTCLLSHRATGNGEDLQIASD  90

Query  370  IVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPV  549
            IVDTC      T R + FLCGR G+Y LGA+ ANY  DQ +R+ +L+ F EV +E+ALP 
Sbjct  91   IVDTCTVVVRTTKRRVAFLCGRAGVYVLGAMVANYRDDQYRRELFLNLFCEVVEERALPA  150

Query  550  GPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNS  729
            GP EG  GM Y+LL+G AGFLW+ALFI +HLG   +P   LMP+VEA++ GGR G++ ++
Sbjct  151  GPGEGVLGMPYELLFGWAGFLWSALFINKHLGDGTIPQSLLMPIVEAVISGGRIGAT-HT  209

Query  730  MCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS  828
             CPLMY+WHGT YWGAA  LAGI++VLLHFPLS
Sbjct  210  TCPLMYQWHGTHYWGAAQDLAGIMHVLLHFPLS  242



>gb|KDO74126.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=320

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 178/277 (64%), Gaps = 17/277 (6%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++T   +A++LK  VV+ TW   G       D T+YTG LGTAY   +++Q T N  +L+
Sbjct  41    SDTLKNSALALKQTVVNETWGVSGKRV---QDYTLYTGALGTAYLLFKAYQVTKNDNELK  97

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC DIV+ C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F E+    
Sbjct  98    LCCDIVEACDSASRDSGR-VTFICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPS  156

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGR GFLWA  F+ +H+G + +    +  VV+ I++ GR   
Sbjct  157   DLP-----------NELLYGRVGFLWACSFLNKHMGKDTISTAQMRAVVDEIIKAGRR-L  204

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
             ++   CPLMY WHG +YWGAAHGLAGI++VL+   L  D VEDVKGTLRYM+ NRFP SG
Sbjct  205   ANRGRCPLMYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEDVKGTLRYMIKNRFP-SG  263

Query  898   NYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPND  1008
             NYP SEG+  D+LV WCHGA G+ +TL KA++V  ++
Sbjct  264   NYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVILDE  300



>ref|XP_008781994.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Phoenix 
dactylifera]
Length=276

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 169/254 (67%), Gaps = 7/254 (3%)
 Frame = +1

Query  583   DLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGT  762
             +LLYGR G+LWA  F+ +H+G   +P+     + + I+  G+  S+  S CPLMY W+G 
Sbjct  27    ELLYGRVGYLWACFFLNKHIGEGTIPSTHTGAIAKEIIMDGQRLSNRGS-CPLMYEWYGE  85

Query  763   RYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQ  942
             +YWGAAHGLAGI+++L+   L  D  ED+KGTL YM+ NRFP SGNYP SEG+  D+L+ 
Sbjct  86    KYWGAAHGLAGIMHILMDVELKPDEKEDIKGTLHYMIQNRFP-SGNYPSSEGSYDDRLMH  144

Query  943   WCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLS  1122
             WCHGA G+ +TL KA+QVF  + +F   A EA EVVW  GL+K+VG+  G +GN Y  L+
Sbjct  145   WCHGAPGVALTLTKAAQVF-QEEQFLQVAAEAAEVVWSRGLLKRVGICHGISGNXYVFLA  203

Query  1123  LYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG---AADHAYSLFQGLAGVACLWFD  1293
             LYRLTG  +Y  RA+AF  FL  +  D       DG   + DH YSLF+G AG+A L+ D
Sbjct  204   LYRLTGNVVYLYRAKAFACFLL-DKLDKANKLIADGLMHSGDHPYSLFEGQAGMAYLFLD  262

Query  1294  LIAPHNSRFPGYEI  1335
             ++ P  SRFP YE+
Sbjct  263   MVRPSESRFPAYEL  276



>gb|KDO74128.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
 gb|KDO74129.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=228

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 161/232 (69%), Gaps = 4/232 (2%)
 Frame = +1

Query  640   LGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHF  819
             +G + +    +  VV+ I++ GR   ++   CPLMY WHG +YWGAAHGLAGI++VL+  
Sbjct  1     MGKDTISTAQMRAVVDEIIKAGRR-LANRGRCPLMYEWHGKKYWGAAHGLAGIMHVLMDM  59

Query  820   PLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVF  999
              L  D VEDVKGTLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF
Sbjct  60    ELKPDEVEDVKGTLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVF  118

Query  1000  PNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGS  1179
               ++EF  AA++AGEVVWK GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  
Sbjct  119   -GEKEFLQAAVDAGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAFAC  177

Query  1180  FLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             FLY  A  ++A  +  G  D  YSLF+G+ G+  L+ D+I P  +RFP YE+
Sbjct  178   FLYDRAQKLIAEGKMHG-GDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  228



>ref|XP_010327070.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Solanum lycopersicum]
Length=340

 Score =   251 bits (640),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 149/337 (44%), Positives = 202/337 (60%), Gaps = 25/337 (7%)
 Frame = +1

Query  82    ASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAV  261
             A  E    N +  N+S  + +   + P  IL ++ F +AA+ LK+ +V  TW   G +  
Sbjct  19    AIEEEQHPNPQGTNESLLKLL---STPYHIL-SKKFKRAALDLKETIVAETW---GLTRQ  71

Query  262   THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGG  441
                D T+Y G LGTA+   +++Q T N  DL +C+ IV  C SA+  + R +TFLCGR G
Sbjct  72    QVPDFTLYCGTLGTAFLLFKAYQVTKNTNDLAVCSQIVKDCDSASRHS-RDVTFLCGRAG  130

Query  442   LYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAA  621
             + ALGAV A Y GD Q    Y+  F E+   K LP            +LLYGRAG+LWA 
Sbjct  131   VCALGAVVAKYMGDDQLVFYYVSQFKEIKLTKDLPD-----------ELLYGRAGYLWAF  179

Query  622   LFIKQHLGSEAVPNETLMPVVEAILEGGRA-GSSDNSMCPLMYRWHGTRYWGAAHGLAGI  798
             LFI +H+G   +P+     V++ I++ GR  G    S  PLM+ W+G  YWGAAHGLAGI
Sbjct  180   LFINKHIGQGTIPSTYTAAVIDEIIKNGRKLGGKGRS--PLMHEWYGEMYWGAAHGLAGI  237

Query  799   LNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGIT  975
             ++VL+ F L  D +EDVKGTL+YM+ NRFP SGNYP SE +  RD LV WCHGA GI +T
Sbjct  238   MHVLMDFELKPDDLEDVKGTLKYMVKNRFP-SGNYPASENDRRRDLLVHWCHGAPGIVLT  296

Query  976   LCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLA  1086
             L KA++VF  D EF +AA+ A E +  + +  K+  A
Sbjct  297   LVKAAEVF-GDEEFINAAVAAAEEMRSTCIEPKLSPA  332



>ref|XP_007043560.1| GCR2-like 2 isoform 2, partial [Theobroma cacao]
 gb|EOX99391.1| GCR2-like 2 isoform 2, partial [Theobroma cacao]
Length=308

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 134/293 (46%), Positives = 182/293 (62%), Gaps = 25/293 (9%)
 Frame = +1

Query  178   AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
             ++ F +AA+ LK+ V   TW   G       D T+Y G LGTA+   +S+Q   N  DL 
Sbjct  40    SQHFKRAALDLKETVTLDTWGLTGQKVS---DFTLYCGTLGTAFLLFKSYQLANNTNDLS  96

Query  358   LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
             LC  IVD C SA+ ++ R +TFLCGR G+ ALGAVAA + G+Q+  D YL  F E+    
Sbjct  97    LCLAIVDACNSASFSS-RDVTFLCGRAGVCALGAVAAKHAGNQELLDYYLSQFKEIKLSS  155

Query  538   ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
              LP            +LLYGRAGFLWA +F+ +HLG   +P+ T   VV+ +++ GR  +
Sbjct  156   NLP-----------DELLYGRAGFLWACVFLNKHLGEGTIPSTTTRAVVDEVIKNGRQLA  204

Query  718   SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                   PLM+ ++G +YWGAAHGLAGI++VL+   L  D + DVKGTL+YM+ NRFP SG
Sbjct  205   KKGGGSPLMFEFYGEKYWGAAHGLAGIMHVLMDMELEPDEIMDVKGTLKYMIRNRFP-SG  263

Query  898   NYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVW  1053
             NYP SE +  RD LV WCHGA GI +TL KA+++        +AA++A EVV+
Sbjct  264   NYPASEQDRKRDVLVHWCHGAPGIALTLVKAAEL--------EAAVDAAEVVF  308



>emb|CBG76444.1| OO_Ba0013J05-OO_Ba0033A15.31 [Oryza officinalis]
Length=1333

 Score =   262 bits (669),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 194/309 (63%), Gaps = 27/309 (9%)
 Frame = +1

Query  409   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  588
             R +TF+CGR G+ ALGAV A + GD+     YL  F E+  +  LP            +L
Sbjct  1052  RIVTFICGRAGVCALGAVVAKHAGDEAGVAHYLSAFKEIKIQSKLP-----------DEL  1100

Query  589   LYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRY  768
             LYGRAG+LWA  F+ +HLG   VP  T   V+  I+  GR  S+    CPLMY W+G +Y
Sbjct  1101  LYGRAGYLWACTFLNKHLGESTVPPTTTDTVMRDIIRDGRTLSTIG--CPLMYEWYGEKY  1158

Query  769   WGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWC  948
             WGAAHGL+GI++VLL   L+ D +E VKGTLRYM+ NRFP SGNYP  E +  D+LV WC
Sbjct  1159  WGAAHGLSGIMHVLLDMDLTRDDIESVKGTLRYMIENRFP-SGNYPTIEEDNYDRLVHWC  1217

Query  949   HGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTAGNAYASLSLY  1128
             HGA GI +TL KASQVFP +R F +A  EA EVVW  GL+K+VG+  G +GNAY  L+L+
Sbjct  1218  HGAPGISLTLTKASQVFPEER-FLEAVAEAAEVVWNRGLLKRVGICHGVSGNAYTFLALF  1276

Query  1129  RLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPH  1308
             RLT +  +  RA+            I  G    G  D  YSLF+G AG+A L+ D+I P 
Sbjct  1277  RLTKKKEHLYRAKQL----------IADGIMHSG--DKPYSLFEGQAGMAYLFLDMINPL  1324

Query  1309  NSRFPGYEI  1335
             +SRFPGYE+
Sbjct  1325  DSRFPGYEL  1333



>gb|KEH24852.1| G protein coupled receptor [Medicago truncatula]
Length=343

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 186/314 (59%), Gaps = 31/314 (10%)
 Frame = +1

Query  88   PESNGTNHED---------GNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWK  240
            PES  +  ++         G DS    +  P AP     ++   +AA+ LK+ +V  TW 
Sbjct  39   PESTPSTQQELQEAVTVTTGGDSLLNLLAMPHAPL----SQRLKRAALDLKETIVMETWG  94

Query  241  ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHIT  420
              G       D T+Y GLLGTA+  L+S+  T N  DL LC+ IV +C  AA  + R +T
Sbjct  95   LTGQRV---GDFTLYCGLLGTAFLLLKSYHVTCNTNDLALCSQIVKSC-DAASLSSRDVT  150

Query  421  FLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGR  600
            F+CGR G+ ALGAVAA + GD +    YL  F ++   K LP            +LLYG+
Sbjct  151  FICGRAGVCALGAVAAKHAGDDESLRYYLAQFQQIKLPKDLP-----------DELLYGK  199

Query  601  AGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAA  780
             GFLWA LF+ +HLG   VP+     VV+ I++ GRA       CPLM+ W+G +YWGAA
Sbjct  200  GGFLWACLFLNKHLGQGTVPSSYTATVVDEIIKNGRALGQKRK-CPLMFEWYGEKYWGAA  258

Query  781  HGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGA  957
            HGLAGI+NVL+   L  D +EDV+GTL+YM++NRFP SGNYP S+ + + D LV WCHGA
Sbjct  259  HGLAGIMNVLMDMELKPDELEDVRGTLKYMIHNRFP-SGNYPASDKDKKSDVLVHWCHGA  317

Query  958  TGIGITLCKASQVF  999
             G+ +TL KA++V 
Sbjct  318  PGMALTLVKAAKVI  331



>emb|CDY05791.1| BnaC07g00120D [Brassica napus]
Length=269

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 176/260 (68%), Gaps = 9/260 (3%)
 Frame = +1

Query  559   EGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMCP  738
             +G  G+++    GR G+LWA LF+ + +G+E + +  L  V E I++ GR+  + N   P
Sbjct  18    DGDLGLNWSAYSGRVGYLWACLFVNKCVGAETLIS-VLRQVTEEIIKEGRS-MAKNGNSP  75

Query  739   LMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEG  918
             LM++W+G RYWGAAHGLAGI++VL+   L  D  EDV+GTL+Y++NNRFP +GNYP SE 
Sbjct  76    LMFQWYGQRYWGAAHGLAGIMHVLMDVQLKPDVAEDVRGTLKYIINNRFP-NGNYPASEE  134

Query  919   N-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGT  1095
             +  RD LV WCHGA G   TL KA++VF  +REF +A   A EVVW  GL+K+VG+  G 
Sbjct  135   DRRRDFLVHWCHGAPG---TLVKAAEVF-GEREFLEAGEAAAEVVWNRGLLKQVGICHGI  190

Query  1096  AGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGV  1275
             +GNAY SLSLYR TG + Y  +A+AF SFL      +++  +  G  D  YSLF+G+ G+
Sbjct  191   SGNAYVSLSLYRATGRNEYLHQAKAFASFLLDKGHKLLSKGEMHG-GDSPYSLFEGVGGM  249

Query  1276  ACLWFDLIAPHNSRFPGYEI  1335
             A L+ D++ P  +RFPGYE+
Sbjct  250   AYLFLDMVDPSQARFPGYEL  269



>dbj|BAJ96048.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 167/278 (60%), Gaps = 25/278 (9%)
 Frame = +1

Query  127  SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTA  306
            +G R +L    P     ++  L+AA+ LKD+VV  TW   GG      D T+YTG LGTA
Sbjct  26   AGLRGLLSLPYPRL---SDRLLRAALRLKDKVVQETWTRTGGQVT---DYTLYTGALGTA  79

Query  307  YTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQ  486
                ++FQ TG+R+DL L +DIV  C   A   +  +TF+ GR G+ ALGAV A +C DQ
Sbjct  80   LLLFKAFQVTGDRRDLNLASDIVQAC-DVASLGLPFLTFISGRAGVCALGAVIAKHCNDQ  138

Query  487  QKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNE  666
                ++L  F E+   + +P            +LLYGRAG+LWA LF+ +HL  + +P E
Sbjct  139  LMVTNFLSSFDEIIITEKVP-----------NELLYGRAGYLWACLFLNEHLSDKTIPAE  187

Query  667  TLMPVVEAILEGGRAGSSDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVED  846
             +  V + I+  GR  S+  S CPLMY WHG +YWGAAHGLAGI++VL+H  L  D  +D
Sbjct  188  HISSVAKDIIREGRKLSNKGS-CPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKLDEQDD  246

Query  847  VKGTLRYMMNNRFPHSGNYP-VSEGNPRDKLVQWCHGA  957
            VK TLRYM++NRFP SGNYP V   NP    + WC GA
Sbjct  247  VKNTLRYMISNRFP-SGNYPRVKTVNP----IAWCIGA  279



>ref|XP_002319360.2| hypothetical protein POPTR_0013s13850g [Populus trichocarpa]
 gb|EEE95283.2| hypothetical protein POPTR_0013s13850g [Populus trichocarpa]
Length=286

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 165/275 (60%), Gaps = 31/275 (11%)
 Frame = +1

Query  178  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  357
            ++ F ++ + LK+ +V  TW   GG+             LGTA    +S+Q TGN  DL 
Sbjct  42   SKQFQRSGLDLKETIVMETW---GGN-------------LGTALLLYKSYQVTGNENDLF  85

Query  358  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  537
            LC +IV  C SA+ A+ R +TF+CGR G+ ALGAVAA +  D+  +  YL    E+   K
Sbjct  86   LCLEIVKACDSASRAS-RDVTFICGRAGVCALGAVAAKHVNDEALQSYYLSQLGEI---K  141

Query  538  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGS  717
             L   P+E        LLYGR+GFLWA LF+ +HLG   VP+ T+  V   I++ GRA +
Sbjct  142  LLRNHPDE--------LLYGRSGFLWACLFLNKHLGQGTVPDTTIRAVANEIIKNGRALA  193

Query  718  SDNSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSG  897
                  PLMY W+G RYWGA HGLAGI+NVLL   L  D  EDVKGTL+YM+NN FP SG
Sbjct  194  KKGG-SPLMYEWYGERYWGADHGLAGIMNVLLDVELRPDEFEDVKGTLKYMINNCFP-SG  251

Query  898  NYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVF  999
            NY  SE +  RD LV WCHG  GI +TL KA ++ 
Sbjct  252  NYSTSEEDRKRDVLVHWCHGPPGIALTLVKAVKIM  286



>gb|KCW89517.1| hypothetical protein EUGRSUZ_A01805 [Eucalyptus grandis]
Length=196

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = +1

Query  742   MYRWHGTRYWGAAHGLAGILNVLLHFPLSEDGVEDVKGTLRYMMNNRFPHSGNYPVSEGN  921
             M+ W+G +YWGAAHGLAGI++VL+H  L  D +EDVKGTL+YM+ NRFP SGNYP SE +
Sbjct  1     MFEWYGEKYWGAAHGLAGIMHVLMHMELKPDEMEDVKGTLKYMIRNRFP-SGNYPSSEED  59

Query  922   -PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKKVGLADGTA  1098
               RD LV WCHGA GI +TL KA++VF  D EF  AA++A EVVW  GL+K+VG+  G +
Sbjct  60    RNRDVLVHWCHGAPGIALTLVKAAEVF-RDEEFLRAAVDAAEVVWNRGLLKRVGICHGIS  118

Query  1099  GNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVA  1278
             GN Y  LSLYR+TG + +  RA+AF  FL   A  +++  +  G  D+ YSLF+G+ G A
Sbjct  119   GNVYVFLSLYRVTGNAEFLYRAKAFACFLLDRALKLISTGEMHG-GDNPYSLFEGIGGTA  177

Query  1279  CLWFDLIAPHNSRFPGYEI  1335
              L+ D++ P  +RFP YE+
Sbjct  178   YLFLDMVEPSAARFPAYEL  196



>ref|XP_006634360.1| PREDICTED: lanC-like protein 2-like [Lepisosteus oculatus]
Length=432

 Score =   216 bits (551),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 134/386 (35%), Positives = 211/386 (55%), Gaps = 26/386 (7%)
 Frame = +1

Query  205   SLKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVD  378
              ++ ++ D+  +   G  +A  H D + YTG  G A   L+  + T  +  L+   D + 
Sbjct  64    KVQSKITDLLQQMEEGLKTADPH-DFSTYTGWTGIALLYLQLHRVTQEQSHLQRALDYLK  122

Query  379   TCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPE  558
                       R +TFLCG  G  A+GAV  +   ++ +    +    ++  ++++ +   
Sbjct  123   RTLRNLNG--RRVTFLCGDAGPLAVGAVVHHKLKNEAESKECITKLLQL--QRSVVISDS  178

Query  559   EGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM--  732
             +    +  +LLYGR+G+L+A L++   +G E VP  T+  VVE +LE G+  S +     
Sbjct  179   D----LPDELLYGRSGYLYALLYVNTEIGPETVPASTISEVVETLLESGKNMSKEEKKMD  234

Query  733   -CPLMYRWHGTRYWGAAHGLAGILNVLLH--FPLSEDGV-EDVKGTLRYMMNNRFPHSGN  900
              CPL+Y+WH  +Y GAAHGLAGI  +L+     +S++ + E VK ++ Y+ + +F  SGN
Sbjct  235   RCPLLYQWHRKQYVGAAHGLAGIYYMLMQPGVKVSQEMLTELVKPSIDYVRHKKF-RSGN  293

Query  901   YPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-V  1077
             YP S  N  D+LV WCHGA G+   L +A  VF  ++  +D A+E GEV+W+ GL++K  
Sbjct  294   YPSSLSNETDRLVHWCHGAPGVIHMLIQAYMVFKEEKYLKD-AVECGEVIWQRGLLRKGY  352

Query  1078  GLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLF  1257
             G+  GTAGN Y+ LSLY+LT E  Y  RA  F  +       +  G+ G    D  YSLF
Sbjct  353   GICHGTAGNGYSFLSLYKLTQEKKYLYRACKFAEWC------LDYGTHGCRIPDRPYSLF  406

Query  1258  QGLAGVACLWFDLIAPHNSRFPGYEI  1335
             +G+AG      D++ P  SRFP +E+
Sbjct  407   EGMAGAIHYLSDVLMPETSRFPAFEL  432



>ref|XP_003424467.1| PREDICTED: lanC-like protein 2 isoform X2 [Nasonia vitripennis]
Length=405

 Score =   213 bits (543),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/360 (35%), Positives = 204/360 (57%), Gaps = 19/360 (5%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D ++YTGL G AYT     +   ++  +    ++V  C        RH+TFL G  G  A
Sbjct  60    DTSLYTGLPGVAYTFYHYGKYFEDQSYISRSTELVGKCIEKLRGK-RHVTFLTGNAGPLA  118

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             LGAV  ++ G++++  + +     ++          E G G+  ++LYGRAG+L+A LF+
Sbjct  119   LGAVMNHFLGEKEESKNMISKLKYLSSYAIY-----EDGSGLPDEILYGRAGYLYALLFV  173

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM-CPLMYRWHGTRYWGAAHGLAGILNV  807
              +H+    + ++ +  V+  IL  G++ +  + +  PLMY WH + Y G AHGLAGIL +
Sbjct  174   NKHMTPPPIEDDLIRQVINYILSSGKSYAKAHGIESPLMYMWHDSEYLGGAHGLAGILYL  233

Query  808   LLHFP--LSEDGVE-DVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITL  978
             LL     L+ED ++ +V+ +++++ N ++P SGN+P S G+  DKLV WCHGA  + +  
Sbjct  234   LLQAREFLTEDQLKTEVEPSIQWLENLKYP-SGNFPSSVGSTTDKLVHWCHGAPSMTMLF  292

Query  979   CKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQ  1155
             C A ++F  D ++ + A++ GEV+W+ GL+KK  G+  G AGNAY+ LSLY+LT +  + 
Sbjct  293   CLAYEIFKKD-QYLNTALKCGEVIWERGLLKKGCGICHGVAGNAYSFLSLYQLTKDPKHL  351

Query  1156  ERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              RA  F  +       +   +     AD  +SLF+GLAG      D+  P  ++FPGY +
Sbjct  352   YRACKFTEWC------LDYDAHQTRPADRPFSLFEGLAGTIYFLVDMQKPSEAKFPGYTL  405



>ref|XP_001605213.2| PREDICTED: lanC-like protein 1 isoform X1 [Nasonia vitripennis]
 ref|XP_008216990.1| PREDICTED: lanC-like protein 1 isoform X1 [Nasonia vitripennis]
Length=451

 Score =   214 bits (545),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 127/361 (35%), Positives = 206/361 (57%), Gaps = 21/361 (6%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D ++YTGL G AYT     +   ++  +    ++V  C        RH+TFL G  G  A
Sbjct  106   DTSLYTGLPGVAYTFYHYGKYFEDQSYISRSTELVGKCIEKLRGK-RHVTFLTGNAGPLA  164

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALP-VGPEEGGFGMSYDLLYGRAGFLWAALF  627
             LGAV  ++ G++++  +       +++ K L      E G G+  ++LYGRAG+L+A LF
Sbjct  165   LGAVMNHFLGEKEESKNM------ISKLKYLSSYAIYEDGSGLPDEILYGRAGYLYALLF  218

Query  628   IKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM-CPLMYRWHGTRYWGAAHGLAGILN  804
             + +H+    + ++ +  V+  IL  G++ +  + +  PLMY WH + Y G AHGLAGIL 
Sbjct  219   VNKHMTPPPIEDDLIRQVINYILSSGKSYAKAHGIESPLMYMWHDSEYLGGAHGLAGILY  278

Query  805   VLLHFP--LSEDGVE-DVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGIT  975
             +LL     L+ED ++ +V+ +++++ N ++P SGN+P S G+  DKLV WCHGA  + + 
Sbjct  279   LLLQAREFLTEDQLKTEVEPSIQWLENLKYP-SGNFPSSVGSTTDKLVHWCHGAPSMTML  337

Query  976   LCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIY  1152
              C A ++F  D ++ + A++ GEV+W+ GL+KK  G+  G AGNAY+ LSLY+LT +  +
Sbjct  338   FCLAYEIFKKD-QYLNTALKCGEVIWERGLLKKGCGICHGVAGNAYSFLSLYQLTKDPKH  396

Query  1153  QERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  1332
               RA  F  +       +   +     AD  +SLF+GLAG      D+  P  ++FPGY 
Sbjct  397   LYRACKFTEWC------LDYDAHQTRPADRPFSLFEGLAGTIYFLVDMQKPSEAKFPGYT  450

Query  1333  I  1335
             +
Sbjct  451   L  451



>ref|XP_418874.2| PREDICTED: lanC-like protein 2 [Gallus gallus]
Length=455

 Score =   214 bits (544),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 208/391 (53%), Gaps = 28/391 (7%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCA  366
             Q    ++ ++ D+  +   G  +A  H D + YTG  G A   L+ ++ T N+  L+   
Sbjct  70    QFTKRIQTKIKDLLQQMEEGLKTADPH-DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSL  128

Query  367   DIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALP  546
             D V           R +TFLCG  G  A+GAV  +   ++ +    +    ++ Q   + 
Sbjct  129   DYVKRILRNLSG--RRVTFLCGDAGPLAVGAVVYHVLKNESESKECVARLLQL-QRTVIS  185

Query  547   VGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDN  726
             +  E     +  +LLYGRAG+L+A L++   + S+ VP   +  V++AI+E G+  S + 
Sbjct  186   MDAE-----LPDELLYGRAGYLYALLYLNTEIASDTVPQSIIKEVIDAIIESGKNFSKEE  240

Query  727   ---SMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS----EDGVEDVKGTLRYMMNNRF  885
                  CPL+Y+WH  +Y GAAHG+AGI  +L+  P++    E   E VK ++ Y+ + +F
Sbjct  241   RKTERCPLLYQWHRKQYVGAAHGVAGIYYMLMQ-PIANVDQETLTELVKPSIDYVRHKKF  299

Query  886   PHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGL  1065
               SGNYP S  N  D+LV WCHGA G+   L +A + F  D+  +D A+E  +V+W+ GL
Sbjct  300   -RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKTFKEDKYLKD-AMECSDVIWQRGL  357

Query  1066  VKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADH  1242
             ++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  G+ G    D 
Sbjct  358   LRKGYGICHGTAGNGYSFLSLYNLTQDKKYLYRACKFAEWC------LEYGAHGCRIPDR  411

Query  1243  AYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              YSLF+G+AG      D+  P  SRFP +E+
Sbjct  412   PYSLFEGMAGAIHFLSDISVPETSRFPAFEL  442



>ref|XP_010711417.1| PREDICTED: lanC-like protein 2 [Meleagris gallopavo]
Length=400

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/395 (34%), Positives = 209/395 (53%), Gaps = 28/395 (7%)
 Frame = +1

Query  181   ETFLQAAVSLKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDL  354
             E   Q +  ++ ++ D+  +   G  +A  H D + YTG  G A   L+ ++ T  +  L
Sbjct  11    EVTAQFSKRIQTKIKDLLQQMEEGLKTADPH-DCSAYTGWTGIALLYLQLYRVTKKQSHL  69

Query  355   RLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQE  534
             +   D V           R +TFLCG  G  A+GAV  +   ++ +    +    ++ Q 
Sbjct  70    QRSLDYVKRILRNLNG--RRVTFLCGDAGPLAVGAVVYHMLKNETESKECVARLLQL-QR  126

Query  535   KALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAG  714
               + +  E     +  +LLYGRAG+L+A L++   + S+ VP   +  V++AI+E G+  
Sbjct  127   TVVSMDAE-----LPDELLYGRAGYLYALLYLNTEIASDTVPQSIIKEVIDAIIESGKNF  181

Query  715   SSD---NSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS----EDGVEDVKGTLRYMM  873
             S +      CPL+Y+WH  +Y GAAHG+AGI  +L+  P++    E   E VK ++ Y+ 
Sbjct  182   SKEERKTERCPLLYQWHRKQYVGAAHGVAGIYYMLMQ-PIANVDQETLTELVKPSIDYVR  240

Query  874   NNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVW  1053
             + +F  SGNYP S  N  D+LV WCHGA G+   L +A + F  D+  +D A+E  +V+W
Sbjct  241   HKKF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKTFKEDKYLKD-AMECSDVIW  298

Query  1054  KSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDG  1230
             + GL++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  G+ G  
Sbjct  299   QRGLLRKGYGICHGTAGNGYSFLSLYNLTQDKKYLYRACKFAEWC------LEYGAHGCR  352

Query  1231  AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
               D  YSLF+G+AG      D+  P  SRFP +E+
Sbjct  353   IPDRPYSLFEGMAGAIHFLSDISVPETSRFPAFEL  387



>ref|XP_010137609.1| PREDICTED: lanC-like protein 2 [Buceros rhinoceros silvestris]
Length=370

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 131/375 (35%), Positives = 200/375 (53%), Gaps = 32/375 (9%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG--PEEGGFGMSYDLLYGRAGFLWAAL  624
             +GAV  +   ++ +    +    ++ +    P    P+E        LLYGRAG+L+A L
Sbjct  70    VGAVVYHKLKNESESKECVARLLQLQRTVISPDAELPDE--------LLYGRAGYLYALL  121

Query  625   FIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAG  795
             ++   +G + VP   +  V++AI+E G++ S +      CPL+Y+WH  +Y GAAHG+AG
Sbjct  122   YLNTEIGPDTVPQSVVKEVIDAIIESGKSFSKEERKTDRCPLLYQWHRKQYVGAAHGVAG  181

Query  796   ILNVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATG  963
             I  +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G
Sbjct  182   IYYMLMQ-PIANVDQETLAELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPG  239

Query  964   IGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTG  1140
             +   L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT 
Sbjct  240   VIHMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQ  298

Query  1141  ESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRF  1320
             +  Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+F
Sbjct  299   DKKYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQF  352

Query  1321  PGYEI*TLKPKHNPI  1365
             P +E   L+P+   I
Sbjct  353   PAFE---LRPQRREI  364



>ref|XP_009946789.1| PREDICTED: lanC-like protein 2 [Leptosomus discolor]
Length=370

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 195/363 (54%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECIAKLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +  +AVP   +  V++AI+E G+  S +      CPL+Y+WHG +Y GAAHG+AGI 
Sbjct  124   NTEISPDAVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHGKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PVAKVDQETLAELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLIQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>gb|EOB04765.1| LanC-like protein 2, partial [Anas platyrhynchos]
Length=413

 Score =   211 bits (538),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 205/391 (52%), Gaps = 28/391 (7%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCA  366
             Q    ++ ++ D+  +   G  +A  H D + YTG  G A   L+ ++ T N+  L+   
Sbjct  28    QFTKRIQTKIKDLLQQMEEGLKTADPH-DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSL  86

Query  367   DIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALP  546
             D V           R +TFLCG  G  A+GAV  +   +  +    +    ++ Q     
Sbjct  87    DYVKRILRNLNG--RRVTFLCGDAGPLAVGAVVYHKLKNDSESKECVTRLLQL-QRTVTS  143

Query  547   VGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDN  726
                E     +  +LLYGRAG+L+A L++   +G + VP   +  V++AI+E G+  S + 
Sbjct  144   TDAE-----LPDELLYGRAGYLYALLYLNTEIGPDTVPQSVIKEVIDAIIESGKNFSKEE  198

Query  727   ---SMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS----EDGVEDVKGTLRYMMNNRF  885
                  CPL+Y+WH  +Y GAAHG+AGI  +L+  P++    E   E VK ++ Y+ + +F
Sbjct  199   RKTERCPLLYQWHRKQYVGAAHGVAGIYYMLMQ-PIANVDQETLTELVKPSIDYVRHKKF  257

Query  886   PHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGL  1065
               SGNYP S  N  D+LV WCHGA G+   L +A + F  D+  +D A+E  +V+W+ GL
Sbjct  258   -RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKTFKEDKYLKD-AMECSDVIWQRGL  315

Query  1066  VKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADH  1242
             ++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  G+ G    D 
Sbjct  316   LRKGYGICHGTAGNGYSFLSLYNLTQDKKYLYRACKFAEWC------LEYGAHGCRIPDR  369

Query  1243  AYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              YSLF+G+AG      D+  P  SRFP +E+
Sbjct  370   PYSLFEGMAGAIHFLSDIAVPETSRFPAFEL  400



>gb|KGL96810.1| LanC-like 2, partial [Charadrius vociferus]
Length=377

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  32    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  89

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  90    VGAVVYHKLKNDSESKECVAKLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  143

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  144   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  203

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  204   YILMQ-PIANVDQETLAELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  261

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A+E  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  262   HMLMQAYKTFKEDKYLKD-AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  320

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  321   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  374

Query  1327  YEI  1335
             +E+
Sbjct  375   FEL  377



>ref|XP_009966730.1| PREDICTED: lanC-like protein 2 [Tyto alba]
Length=370

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECVARLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PIANVDQETLAELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AVDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  SRFP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSRFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_009887721.1| PREDICTED: lanC-like protein 2 [Charadrius vociferus]
Length=370

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECVAKLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YILMQ-PIANVDQETLAELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A+E  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_010311253.1| PREDICTED: lanC-like protein 2 [Balearica regulorum gibbericeps]
Length=370

 Score =   209 bits (533),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECVAKLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PIANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A+E  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_008489494.1| PREDICTED: lanC-like protein 2 [Calypte anna]
Length=395

 Score =   210 bits (535),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  37    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  94

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  95    VGAVVYHKLKNDSESKECVAKLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  148

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G   +P   +  V++AI+E G++ S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  149   NTEIGPNTIPQSVIKEVIDAIIESGKSFSKEERKTDRCPLLYQWHKKQYVGAAHGVAGIY  208

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  209   YMLMQ-PIANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  266

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A+E  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  267   HMLMQAYKTFKEDKYLKD-AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  325

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  326   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  379

Query  1327  YEI  1335
             +E+
Sbjct  380   FEL  382



>ref|XP_008934094.1| PREDICTED: lanC-like protein 2, partial [Merops nubicus]
Length=389

 Score =   210 bits (534),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 130/363 (36%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  31    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  88

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  89    VGAVVYHKLKNDSESKECVAKLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  142

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  VV+AILE GR  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  143   NTEIGPDTVPQSVVKEVVDAILESGRNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  202

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  203   YMLMQ-PVAHVDPETLAELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  260

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  261   HMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  319

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  320   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  373

Query  1327  YEI  1335
             +E+
Sbjct  374   FEL  376



>ref|XP_005014987.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein 2 [Anas platyrhynchos]
Length=452

 Score =   211 bits (538),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 205/391 (52%), Gaps = 28/391 (7%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCA  366
             Q    ++ ++ D+  +   G  +A  H D + YTG  G A   L+ ++ T N+  L+   
Sbjct  67    QFTKRIQTKIKDLLQQMEEGLKTADPH-DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSL  125

Query  367   DIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALP  546
             D V           R +TFLCG  G  A+GAV  +   +  +    +    ++ Q     
Sbjct  126   DYVKRILRNLNG--RRVTFLCGDAGPLAVGAVVYHKLKNDSESKECVTRLLQL-QRTVTS  182

Query  547   VGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDN  726
                E     +  +LLYGRAG+L+A L++   +G + VP   +  V++AI+E G+  S + 
Sbjct  183   TDAE-----LPDELLYGRAGYLYALLYLNTEIGPDTVPQSVIKEVIDAIIESGKNFSKEE  237

Query  727   ---SMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS----EDGVEDVKGTLRYMMNNRF  885
                  CPL+Y+WH  +Y GAAHG+AGI  +L+  P++    E   E VK ++ Y+ + +F
Sbjct  238   RKTERCPLLYQWHRKQYVGAAHGVAGIYYMLMQ-PIANVDQETLTELVKPSIDYVRHKKF  296

Query  886   PHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGL  1065
               SGNYP S  N  D+LV WCHGA G+   L +A + F  D+  +D A+E  +V+W+ GL
Sbjct  297   -RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKTFKEDKYLKD-AMECSDVIWQRGL  354

Query  1066  VKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADH  1242
             ++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  G+ G    D 
Sbjct  355   LRKGYGICHGTAGNGYSFLSLYNLTQDKKYLYRACKFAEWC------LEYGAHGCRIPDR  408

Query  1243  AYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              YSLF+G+AG      D+  P  SRFP +E+
Sbjct  409   PYSLFEGMAGAIHFLSDIAVPETSRFPAFEL  439



>ref|XP_009863709.1| PREDICTED: lanC-like protein 2 [Apaloderma vittatum]
Length=370

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 195/365 (53%), Gaps = 29/365 (8%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG--PEEGGFGMSYDLLYGRAGFLWAAL  624
             +GAV  +   +  +    +    ++ +    P G  P+E        LLYGRAG+L+A L
Sbjct  70    VGAVVYHKLKNDSESKECVAKLLQLQRTVISPDGELPDE--------LLYGRAGYLYALL  121

Query  625   FIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAG  795
             ++   +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AG
Sbjct  122   YLNTEIGPDTVPQSVVKEVIDAIIESGKNFSREERKTDRCPLLYQWHRKQYVGAAHGVAG  181

Query  796   ILNVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATG  963
             I  +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G
Sbjct  182   IYYMLMQ-PVANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPG  239

Query  964   IGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTG  1140
             +   L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT 
Sbjct  240   VIHMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQ  298

Query  1141  ESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRF  1320
             +  Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+F
Sbjct  299   DKKYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQF  352

Query  1321  PGYEI  1335
             P +E+
Sbjct  353   PAFEL  357



>gb|KFU97310.1| LanC-like 2, partial [Pterocles gutturalis]
Length=377

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 201/391 (51%), Gaps = 32/391 (8%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  372
             Q    +KD +  M     G       D + YTG  G A   L+ ++ T N+  L+   D 
Sbjct  9     QIQTKIKDLLQQM---EEGLKTADPHDCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDY  65

Query  373   VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  552
             V           R +TFLCG  G  A+GAV  +   +  +    +    ++ +    P  
Sbjct  66    VKRILRNLNG--RRVTFLCGDAGPLAVGAVVYHKLKNDSESKECIAKLLQLQRTVINPDA  123

Query  553   --PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSD-  723
               P+E        LLYGRAG+L+A L++   +G + VP   +  V++AI+E G+  S + 
Sbjct  124   ELPDE--------LLYGRAGYLYALLYLNTEIGPDTVPQSVIKEVIDAIIESGKNFSKEE  175

Query  724   --NSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS----EDGVEDVKGTLRYMMNNRF  885
                  CPL+Y+WH  +Y GAAHG+AGI  +L+  P++    E   E VK ++ Y+ + +F
Sbjct  176   RKTDRCPLLYQWHRKQYVGAAHGVAGIYYMLMQ-PIANVDQETLTELVKPSIDYVRHKKF  234

Query  886   PHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGL  1065
               SGNYP S  N  D+LV WCHGA G+   L +A + F  D+  +D A++  +V+W+ GL
Sbjct  235   -RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGL  292

Query  1066  VKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADH  1242
             ++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  G+ G    D 
Sbjct  293   LRKGYGICHGTAGNGYSFLSLYNLTQDKKYLYRACKFAEWC------LEYGAHGCRIPDR  346

Query  1243  AYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              YSLF+G+AG      D+  P  S+FP +E+
Sbjct  347   PYSLFEGMAGAIHFLSDISVPETSQFPAFEL  377



>gb|KFP85016.1| LanC-like 2, partial [Apaloderma vittatum]
Length=377

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 195/365 (53%), Gaps = 29/365 (8%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  32    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  89

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG--PEEGGFGMSYDLLYGRAGFLWAAL  624
             +GAV  +   +  +    +    ++ +    P G  P+E        LLYGRAG+L+A L
Sbjct  90    VGAVVYHKLKNDSESKECVAKLLQLQRTVISPDGELPDE--------LLYGRAGYLYALL  141

Query  625   FIKQHLGSEAVPNETLMPVVEAILEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAG  795
             ++   +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AG
Sbjct  142   YLNTEIGPDTVPQSVVKEVIDAIIESGKNFSREERKTDRCPLLYQWHRKQYVGAAHGVAG  201

Query  796   ILNVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATG  963
             I  +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G
Sbjct  202   IYYMLMQ-PVANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPG  259

Query  964   IGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTG  1140
             +   L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT 
Sbjct  260   VIHMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQ  318

Query  1141  ESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRF  1320
             +  Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+F
Sbjct  319   DKKYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQF  372

Query  1321  PGYEI  1335
             P +E+
Sbjct  373   PAFEL  377



>gb|KFO54122.1| LanC-like 1, partial [Corvus brachyrhynchos]
Length=373

 Score =   209 bits (532),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 135/371 (36%), Positives = 196/371 (53%), Gaps = 27/371 (7%)
 Frame = +1

Query  244   RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  423
             RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  23    RGLKSADPHDCTAYTGWTGIALLYLHLYDVYGDPAYLQVAHEYVKK--SLRCMTRRSITF  80

Query  424   LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  603
             LCG  G  A+ AV  +   +Q++ + Y+     +   KA P  P+E        LLYGR 
Sbjct  81    LCGDAGPLAVAAVIYHKLQNQKQAEDYIIRLLHL--HKADPRLPDE--------LLYGRM  130

Query  604   GFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMC---PLMYRWHGTRYWG  774
             G+L A +F+ +H G E +P   +  V EA++  G + +   +     PLMY W+   Y G
Sbjct  131   GYLSALIFVNKHFGEEKIPQSHIQQVCEAVVASGESLAKKRNFTAKSPLMYEWYQEYYVG  190

Query  775   AAHGLAGILNVLLH--FPLSEDGVED-VKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQW  945
             AAHGLAGI   L+   F +S+  + + VK ++ Y+   +FP SGNYP   G+ RD LV W
Sbjct  191   AAHGLAGIYYYLMQPGFGVSQVKLHNTVKPSVDYVCQLKFP-SGNYPPCIGDTRDLLVHW  249

Query  946   CHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLS  1122
             CHGA G+   L +A +VF  ++++ + A++  EV+W+ GL+KK  GL  GTAGNAYA L+
Sbjct  250   CHGAPGVIYMLVQAYKVF-GEQQYLNDALQCAEVIWQHGLLKKGYGLCHGTAGNAYAFLA  308

Query  1123  LYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIA  1302
             LY LT    Y  RA  F  +       +  G  G    D  +SLF+G+AG      DL+ 
Sbjct  309   LYNLTQNMKYLYRACKFAEWC------LSYGQHGCRTPDTPFSLFEGMAGTIYFLADLLV  362

Query  1303  PHNSRFPGYEI  1335
             P  ++FP +E+
Sbjct  363   PTKAKFPAFEL  373



>gb|KFV83634.1| LanC-like 2, partial [Struthio camelus australis]
Length=377

 Score =   209 bits (532),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 195/363 (54%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  32    DCSAYTGWTGIALLYLQLYRITKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  89

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   ++ +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  90    VGAVVYHKLKNESESKECVAKLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  143

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  144   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  203

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  204   YMLMQ-PVANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  261

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A+E  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  262   HMLMQAYKTFKEDKYLKD-AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  320

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  ++FP 
Sbjct  321   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETAQFPA  374

Query  1327  YEI  1335
             +E+
Sbjct  375   FEL  377



>ref|XP_009896607.1| PREDICTED: lanC-like protein 2 [Picoides pubescens]
Length=370

 Score =   209 bits (531),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLSG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNYSESKECVAKLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVVKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PVANVDQETLTELVKPSIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_008919586.1| PREDICTED: lanC-like protein 2 [Manacus vitellinus]
Length=402

 Score =   209 bits (533),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 130/363 (36%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  44    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  101

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  102   VGAVVYHKLKNDSESKECVAKLLQL-QRTVISTEAE-----LPDELLYGRAGYLYALLYL  155

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSM---CPLMYRWHGTRYWGAAHGLAGIL  801
                +G   VP   +  VV+AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  156   NTEIGPGTVPQSVIKEVVDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  215

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  216   YMLMQ-PIANVDQETLAELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  273

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A +VF  D+  +D A+E  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  274   HMLMQAYKVFKEDKYLKD-AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  332

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  333   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  386

Query  1327  YEI  1335
             +E+
Sbjct  387   FEL  389



>ref|XP_009677694.1| PREDICTED: lanC-like protein 2 [Struthio camelus australis]
Length=370

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 195/363 (54%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRITKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   ++ +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNESESKECVAKLLQL-QRTVISTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PVANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A+E  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  ++FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETAQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_009566764.1| PREDICTED: lanC-like protein 2 [Cuculus canorus]
Length=370

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q        E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECIAKLLQL-QRTVTSTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  VV+AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVVKEVVDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PIANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A ++F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKIFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_010085360.1| PREDICTED: lanC-like protein 2 [Pterocles gutturalis]
Length=370

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/365 (35%), Positives = 194/365 (53%), Gaps = 29/365 (8%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG--PEEGGFGMSYDLLYGRAGFLWAAL  624
             +GAV  +   +  +    +    ++ +    P    P+E        LLYGRAG+L+A L
Sbjct  70    VGAVVYHKLKNDSESKECIAKLLQLQRTVINPDAELPDE--------LLYGRAGYLYALL  121

Query  625   FIKQHLGSEAVPNETLMPVVEAILEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAG  795
             ++   +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AG
Sbjct  122   YLNTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAG  181

Query  796   ILNVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATG  963
             I  +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G
Sbjct  182   IYYMLMQ-PIANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPG  239

Query  964   IGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTG  1140
             +   L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT 
Sbjct  240   VIHMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQ  298

Query  1141  ESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRF  1320
             +  Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+F
Sbjct  299   DKKYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQF  352

Query  1321  PGYEI  1335
             P +E+
Sbjct  353   PAFEL  357



>ref|XP_009273304.1| PREDICTED: lanC-like protein 2 [Aptenodytes forsteri]
Length=399

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/363 (36%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  41    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  98

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  99    VGAVVYHKLKNDSESKECVAKLLQL-QRAVVSTDAE-----LPDELLYGRAGYLYALLYL  152

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  VV+AI+E GR  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  153   NTEIGPDTVPQSVIKEVVDAIIESGRNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  212

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  213   YMLMQ-PVANVDQETLAELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  270

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  271   HMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  329

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  330   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  383

Query  1327  YEI  1335
             +E+
Sbjct  384   FEL  386



>ref|XP_010396952.1| PREDICTED: lanC-like protein 2 [Corvus cornix cornix]
Length=370

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/373 (35%), Positives = 200/373 (54%), Gaps = 26/373 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   + +  E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECVAKLLQL-QRTVISMDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PIANVDQETLAELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDR  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LDYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI*TLKPKHNPI  1365
             +E+  L+ + N +
Sbjct  355   FEL-RLQRRENKV  366



>ref|XP_010162821.1| PREDICTED: lanC-like protein 2 [Caprimulgus carolinensis]
Length=370

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTRNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECIAKLLQL-QRTVVSTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTERCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PIAKVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>gb|KFW01635.1| LanC-like 2, partial [Fulmarus glacialis]
Length=377

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 132/391 (34%), Positives = 207/391 (53%), Gaps = 28/391 (7%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCA  366
             Q +  ++ ++ D+  +   G  +A  H D + YTG  G A   L+ ++ T N+  L+   
Sbjct  5     QFSKRIQTKIKDLLQQMEEGLKTADPH-DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSL  63

Query  367   DIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALP  546
             D V           R +TFLCG  G  A+GAV  +   +  +    +    ++ Q   + 
Sbjct  64    DYVKRILRNLNG--RRVTFLCGDAGPLAVGAVVYHKLKNDSESKECVAKLLQL-QRTVIS  120

Query  547   VGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSD-  723
                E     +  +LLYGRAG+L+A L++   +G + VP   +  V++AI+E G+  S + 
Sbjct  121   TDAE-----LPDELLYGRAGYLYALLYLNTEIGPDTVPQSVIKEVIDAIIESGKNFSKEE  175

Query  724   --NSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS----EDGVEDVKGTLRYMMNNRF  885
                  CPL+Y+WH  +Y GAAHG+AGI  +L+  P++    E   E VK ++ Y+ + +F
Sbjct  176   RKTDRCPLLYQWHRKQYVGAAHGVAGIYYMLMQ-PVANVDQETLAELVKPSIDYVRHKKF  234

Query  886   PHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGL  1065
               SGNYP S  N  D+LV WCHGA G+   L +A + F  D+  +D A++  +V+W+ GL
Sbjct  235   -RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGL  292

Query  1066  VKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADH  1242
             ++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  G+ G    D 
Sbjct  293   LRKGYGICHGTAGNGYSFLSLYNLTQDKKYLYRACKFAEWC------LEYGAHGCRIPDR  346

Query  1243  AYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              YSLF+G+AG      D+  P  S+FP +E+
Sbjct  347   PYSLFEGMAGAIHFLSDISVPETSQFPAFEL  377



>ref|XP_004602091.1| PREDICTED: lanC-like protein 2 [Sorex araneus]
Length=396

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 137/401 (34%), Positives = 207/401 (52%), Gaps = 37/401 (9%)
 Frame = +1

Query  178   AETFLQA-AVSLKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQ  348
             +E  +Q+    +++++ D+  +   G  +A  H D + YTG  G A   L+  + T ++ 
Sbjct  5     SEKIIQSFTRRIQNKIKDLLQQMEEGLKTADPH-DCSAYTGWTGIALLYLQLHRVTSDQT  63

Query  349   DLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFE--  522
              L    D V           R +TFLCG  G  A+GAVA +      +    +    +  
Sbjct  64    YLLRSLDYVKRTLRNLSG--RRVTFLCGDAGPLAVGAVAYHKLKSDTEAQECVTRLLQLQ  121

Query  523   ---VAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAI  693
                V ++  LP            +LLYGRAG+L+A L++   +G   V    +  VV AI
Sbjct  122   RAVVCRDSDLPD-----------ELLYGRAGYLYALLYLNSEMGPGTVSESAIKEVVTAI  170

Query  694   LEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLSEDG---VEDVKG  855
             +E G++ S +      CPL+Y+WHG +Y GAAHG+ GI  +L+      D     E VK 
Sbjct  171   IESGKSLSREERKTERCPLLYQWHGKQYVGAAHGMTGIYYMLMQPEAKVDQETLTELVKP  230

Query  856   TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  1035
             ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  231   SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVSHMLMQAYKVFKEEKYLKD-AME  288

Query  1036  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  1212
               +V+W+ GL++K  G+  GTAGN Y+ LSLYRLT +  Y  RA  F  +       +  
Sbjct  289   CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC------LDY  342

Query  1213  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
             G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  343   GTHGCRIPDRPYSLFEGMAGTIHFLSDILVPETSRFPAFEL  383



>ref|XP_010179314.1| PREDICTED: lanC-like protein 2 [Mesitornis unicolor]
Length=370

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRTLRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECVARLLQL-QRTVVNTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NSEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PIANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HVLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>gb|KFZ55043.1| LanC-like 2, partial [Caprimulgus carolinensis]
Length=377

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  32    DCSAYTGWTGIALLYLQLYRVTRNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  89

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  90    VGAVVYHKLKNDSESKECIAKLLQL-QRTVVSTDAE-----LPDELLYGRAGYLYALLYL  143

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSD---NSMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  144   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTERCPLLYQWHRKQYVGAAHGVAGIY  203

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  204   YMLMQ-PIAKVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  261

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  262   HMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  320

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  321   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  374

Query  1327  YEI  1335
             +E+
Sbjct  375   FEL  377



>ref|XP_009463056.1| PREDICTED: lanC-like protein 2 [Nipponia nippon]
Length=370

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECIAKLLQL-QRMVISTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PIANVDQETLTELVKPSVDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_005287377.1| PREDICTED: lanC-like protein 2 isoform X4 [Chrysemys picta bellii]
Length=370

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 195/363 (54%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T +++ L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKDQKYLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +      +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKIDSESKECITKLLQL-QRTIISTDSE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  VV+AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVIKEVVDAIIESGKNFSKEERKTERCPLLYQWHRKQYIGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P+S    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PVSNVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKSFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTEDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D++ P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_010406143.1| PREDICTED: lanC-like protein 1 [Corvus cornix cornix]
Length=400

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 135/371 (36%), Positives = 196/371 (53%), Gaps = 27/371 (7%)
 Frame = +1

Query  244   RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  423
             RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  50    RGLKSADPHDCTAYTGWTGIALLYLHLYDVYGDPAYLQVAHEYVKK--SLRCMTRRSITF  107

Query  424   LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  603
             LCG  G  A+ AV  +   +Q++ + Y+     +   KA P  P+E        LLYGR 
Sbjct  108   LCGDAGPLAVAAVIYHKLQNQKQAEDYIIRLLHL--HKADPRLPDE--------LLYGRM  157

Query  604   GFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDNSMC---PLMYRWHGTRYWG  774
             G+L A +F+ +H G E +P   +  V EA++  G + +   +     PLMY W+   Y G
Sbjct  158   GYLSALIFVNKHFGEEKIPQSHIQQVCEAVVASGESLAKKRNFTAKSPLMYEWYQEYYVG  217

Query  775   AAHGLAGILNVLLH--FPLSEDGVED-VKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQW  945
             AAHGLAGI   L+   F +S+  + + VK ++ Y+   +FP SGNYP   G+ RD LV W
Sbjct  218   AAHGLAGIYYYLMQPGFGVSQVKLHNTVKPSVDYVCQLKFP-SGNYPPCIGDTRDLLVHW  276

Query  946   CHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLS  1122
             CHGA G+   L +A +VF  ++++ + A++  EV+W+ GL+KK  GL  GTAGNAYA L+
Sbjct  277   CHGAPGVIYMLVQAYKVF-GEQQYLNDALQCAEVIWQHGLLKKGYGLCHGTAGNAYAFLA  335

Query  1123  LYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIA  1302
             LY LT    Y  RA  F  +       +  G  G    D  +SLF+G+AG      DL+ 
Sbjct  336   LYNLTQNMKYLYRACKFAEWC------LSYGQHGCRTPDTPFSLFEGMAGTIYFLADLLV  389

Query  1303  PHNSRFPGYEI  1335
             P  ++FP +E+
Sbjct  390   PTKAKFPAFEL  400



>ref|XP_005658651.1| PREDICTED: lanC-like protein 2-like [Sus scrofa]
Length=431

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 132/367 (36%), Positives = 193/367 (53%), Gaps = 33/367 (9%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T ++  L    D V           R +TFLCG  G  A
Sbjct  38    DCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNG--RRVTFLCGDAGPLA  95

Query  451   LGAVAANYCGDQQKRDSYLDYFFE-----VAQEKALPVGPEEGGFGMSYDLLYGRAGFLW  615
             +GAV  +      +    +    +     V ++  LP            +LL+GRAG+L+
Sbjct  96    VGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPD-----------ELLFGRAGYLY  144

Query  616   AALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHG  786
             A L++   +G  AV    +  VV+AI++ G+  S +      CPL+Y+WH  +Y GAAHG
Sbjct  145   ALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAAHG  204

Query  787   LAGILNVLLHFPLSEDG---VEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGA  957
             +AGI  +L+      D     E VK ++ YM + RF  SGNYP S  N  D+LV WCHGA
Sbjct  205   MAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGA  263

Query  958   TGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRL  1134
              G+  TL +A +VF  ++  RD A+E  +V+W+ GL++K  G+  GTAGN Y+ LSLYRL
Sbjct  264   PGVIHTLMQAYKVFKEEKYLRD-AVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRL  322

Query  1135  TGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNS  1314
             T +  Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D++AP  +
Sbjct  323   TQDKKYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETA  376

Query  1315  RFPGYEI  1335
             RFP +E+
Sbjct  377   RFPAFEL  383



>gb|KGL77828.1| LanC-like 2, partial [Tinamus guttatus]
Length=377

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 204/391 (52%), Gaps = 28/391 (7%)
 Frame = +1

Query  193   QAAVSLKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCA  366
             Q    ++ ++ D+  +   G  +A  H D + YTG  G A   L+ ++ T N+  L+   
Sbjct  5     QFTKRIQTKIKDLLQQMEEGLKTADPH-DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSL  63

Query  367   DIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALP  546
             D V           R +TFLCG  G  A+GAV  +      +    +    ++ Q   + 
Sbjct  64    DYVKRILRNLNG--RRVTFLCGDAGPLAVGAVVYHKLKIDNESKECVAKLLQL-QRAVIS  120

Query  547   VGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEAVPNETLMPVVEAILEGGRAGSSD-  723
                E     +  +LLYGRAG+L+A L++   +G + +P   +  V+EAILE G+  S + 
Sbjct  121   TDAE-----LPDELLYGRAGYLYALLYLNTEIGPDTIPQSAIKEVIEAILESGKNFSKEE  175

Query  724   --NSMCPLMYRWHGTRYWGAAHGLAGILNVLLHFPLS----EDGVEDVKGTLRYMMNNRF  885
                  CPL+Y+WH  +Y GAAHG+AGI  +L+  P++    E   E VK ++ Y+ + +F
Sbjct  176   RKTDRCPLLYQWHRKQYVGAAHGVAGIYYMLMQ-PIANVDQETLTELVKPSIDYVRHKKF  234

Query  886   PHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEVVWKSGL  1065
               SGNYP S  N  D+LV WCHGA G+   L +A + F  D+  +D A+E  +V+W+ GL
Sbjct  235   -RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKTFKEDKYLKD-AMECSDVIWQRGL  292

Query  1066  VKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAGSQGDGAADH  1242
             ++K  G+  G AGN Y+ LSLY LT +  Y  RA  F  +       +  G+ G    D 
Sbjct  293   LRKGYGICHGAAGNGYSFLSLYNLTQDKKYLYRACKFAEWC------LEYGAHGCRIPDR  346

Query  1243  AYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  1335
              YSLF+G+AG      D+  P  S+FP +E+
Sbjct  347   PYSLFEGMAGAIHFLSDISVPETSQFPAFEL  377



>ref|XP_010213784.1| PREDICTED: lanC-like protein 2 [Tinamus guttatus]
Length=370

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 192/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +      +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKIDNESKECVAKLLQL-QRAVISTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + +P   +  V+EAILE G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTIPQSAIKEVIEAILESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PIANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A+E  +V+W+ GL++K  G+  G AGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AMECSDVIWQRGLLRKGYGICHGAAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_010148638.1| PREDICTED: lanC-like protein 2 [Eurypyga helias]
Length=370

 Score =   207 bits (527),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTRNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  69

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  70    VGAVVYHKLKNDSESKECVAKLLQL-QRTVVSTDAE-----LPDELLYGRAGYLYALLYL  123

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  124   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  183

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  184   YMLMQ-PIANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  241

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  242   HMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDK  300

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  301   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  354

Query  1327  YEI  1335
             +E+
Sbjct  355   FEL  357



>ref|XP_009092160.1| PREDICTED: lanC-like protein 2 [Serinus canaria]
Length=399

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 194/363 (53%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  41    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  98

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   +    E     +  +LLYGRAG+L+A L++
Sbjct  99    VGAVVYHKLKNSSESQECVAKLLQL-QRTVISTDSE-----LPDELLYGRAGYLYALLYL  152

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  153   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  212

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  213   YMLMQ-PIANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  270

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D A++  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  271   HMLMQAYKTFKEDKYLKD-AMDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDR  329

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  330   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  383

Query  1327  YEI  1335
             +E+
Sbjct  384   FEL  386



>ref|XP_005041412.1| PREDICTED: lanC-like protein 2 [Ficedula albicollis]
Length=455

 Score =   209 bits (533),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 195/363 (54%), Gaps = 25/363 (7%)
 Frame = +1

Query  271   DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  450
             D + YTG  G A   L+ ++ T N+  L+   D V           R +TFLCG  G  A
Sbjct  97    DCSAYTGWTGIALLYLQLYRVTKNQSHLQRSLDYVKRILRNLNG--RRVTFLCGDAGPLA  154

Query  451   LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  630
             +GAV  +   +  +    +    ++ Q   + +  E     +  +LLYGRAG+L+A L++
Sbjct  155   VGAVVYHKLKNDTESKECVAKLLQL-QRSVISMDSE-----LPDELLYGRAGYLYALLYL  208

Query  631   KQHLGSEAVPNETLMPVVEAILEGGRAGSSDN---SMCPLMYRWHGTRYWGAAHGLAGIL  801
                +G + VP   +  V++AI+E G+  S +      CPL+Y+WH  +Y GAAHG+AGI 
Sbjct  209   NTEIGPDTVPQSVIKEVIDAIIESGKNFSKEERKTDRCPLLYQWHRKQYVGAAHGVAGIY  268

Query  802   NVLLHFPLS----EDGVEDVKGTLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIG  969
              +L+  P++    E   E VK ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+ 
Sbjct  269   YMLMQ-PIANVDQETLTELVKPSIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVI  326

Query  970   ITLCKASQVFPNDREFRDAAIEAGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGES  1146
               L +A + F  D+  +D AI+  +V+W+ GL++K  G+  GTAGN Y+ LSLY LT + 
Sbjct  327   HMLMQAYKTFKEDKYLKD-AIDCSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYNLTQDR  385

Query  1147  IYQERARAFGSFLYHNAGDIMAGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  1326
              Y  RA  F  +       +  G+ G    D  YSLF+G+AG      D+  P  S+FP 
Sbjct  386   KYLYRACKFAEWC------LEYGAHGCRIPDRPYSLFEGMAGAIHFLSDISVPETSQFPA  439

Query  1327  YEI  1335
             +E+
Sbjct  440   FEL  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5429243929724