BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1759

Length=1864
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  886   0.0     Sesamum indicum [beniseed]
emb|CDP11183.1|  unnamed protein product                                885   0.0     Coffea canephora [robusta coffee]
gb|KHG17040.1|  Adenosylhomocysteinase                                  884   0.0     Gossypium arboreum [tree cotton]
ref|XP_012071085.1|  PREDICTED: adenosylhomocysteinase 1                884   0.0     Jatropha curcas
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  883   0.0     Gossypium arboreum [tree cotton]
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             882   0.0     Nelumbo nucifera [Indian lotus]
gb|KJB72024.1|  hypothetical protein B456_011G154000                    881   0.0     Gossypium raimondii
gb|KJB37873.1|  hypothetical protein B456_006G223900                    881   0.0     Gossypium raimondii
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  880   0.0     Nelumbo nucifera [Indian lotus]
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             880   0.0     Setaria italica
gb|KJB72028.1|  hypothetical protein B456_011G154000                    879   0.0     Gossypium raimondii
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       879   0.0     Gentiana triflora
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                878   0.0     Eucalyptus grandis [rose gum]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                878   0.0     Erythranthe guttata [common monkey flower]
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  878   0.0     
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             877   0.0     Phoenix dactylifera
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      877   0.0     Gossypium hirsutum [American cotton]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             877   0.0     Setaria italica
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             877   0.0     Sesamum indicum [beniseed]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    876   0.0     Catharanthus roseus [chatas]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             876   0.0     Sesamum indicum [beniseed]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             876   0.0     Citrus sinensis [apfelsine]
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  875   0.0     Pyrus x bretschneideri [bai li]
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               875   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             875   0.0     Nicotiana sylvestris
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   875   0.0     Citrus sinensis [apfelsine]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                875   0.0     Erythranthe guttata [common monkey flower]
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  874   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                874   0.0     Cucumis melo [Oriental melon]
gb|AGT16642.1|  Adenosylhomocysteinase                                  874   0.0     Saccharum hybrid cultivar R570
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             874   0.0     
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  873   0.0     Malus domestica [apple tree]
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             873   0.0     
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             873   0.0     Arabidopsis lyrata subsp. lyrata
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  872   0.0     Malus domestica [apple tree]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                872   0.0     Erythranthe guttata [common monkey flower]
ref|XP_010097949.1|  hypothetical protein L484_026840                   872   0.0     Morus notabilis
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             872   0.0     Populus euphratica
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             872   0.0     Pyrus x bretschneideri [bai li]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             872   0.0     Prunus persica
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  871   0.0     Nelumbo nucifera [Indian lotus]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             871   0.0     Nicotiana tomentosiformis
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   871   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       871   0.0     Prunus mume [ume]
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   871   0.0     Ricinus communis
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             871   0.0     Citrus clementina [clementine]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             871   0.0     Capsella rubella
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             871   0.0     Glycine max [soybeans]
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  871   0.0     Vitis vinifera
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   871   0.0     Populus tomentosa [Chinese white poplar]
gb|EPS72602.1|  adenosylhomocysteinase                                  871   0.0     Genlisea aurea
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase 1                871   0.0     
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   870   0.0     Populus tomentosa [Chinese white poplar]
gb|KJB28098.1|  hypothetical protein B456_005G027700                    870   0.0     Gossypium raimondii
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             870   0.0     Musa acuminata subsp. malaccensis [pisang utan]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   870   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   870   0.0     Populus tomentosa [Chinese white poplar]
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    870   0.0     Medicago sativa [alfalfa]
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             870   0.0     Elaeis guineensis
ref|NP_001148534.1|  adenosylhomocysteinase                             870   0.0     
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   869   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   869   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   869   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   869   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  869   0.0     Eucalyptus grandis [rose gum]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     869   0.0     Populus tomentosa [Chinese white poplar]
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    869   0.0     Arabis alpina [alpine rockcress]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    869   0.0     Arabis alpina [alpine rockcress]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   869   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   869   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   869   0.0     Populus tomentosa [Chinese white poplar]
ref|NP_193130.1|  adenosylhomocysteinase 1                              869   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     869   0.0     Nicotiana tabacum [American tobacco]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             868   0.0     Musa acuminata subsp. malaccensis [pisang utan]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   868   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   868   0.0     Populus tomentosa [Chinese white poplar]
gb|ACN34730.1|  unknown                                                 868   0.0     Zea mays [maize]
gb|AAM62888.1|  adenosylhomocysteinase                                  868   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                868   0.0     
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             868   0.0     Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       868   0.0     Nicotiana benthamiana
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     868   0.0     Nicotiana tabacum [American tobacco]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                868   0.0     Tarenaya hassleriana [spider flower]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       868   0.0     
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           868   0.0     Tarenaya hassleriana [spider flower]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   868   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   868   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   868   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   868   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   868   0.0     Populus tomentosa [Chinese white poplar]
ref|NP_001289538.1|  adenosylhomocysteinase                             868   0.0     Nicotiana sylvestris
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            867   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    867   0.0     
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   867   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   867   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   867   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   867   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   867   0.0     Populus tomentosa [Chinese white poplar]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            867   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             867   0.0     Cicer arietinum [garbanzo]
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  867   0.0     Solanum lycopersicum
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   867   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   867   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_003601687.1|  Adenosylhomocysteinase                             867   0.0     Medicago truncatula
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   866   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             866   0.0     Vitis vinifera
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            866   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             866   0.0     
gb|AEI54335.1|  adenosylhomocysteinase                                  866   0.0     Glycine max [soybeans]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   865   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   865   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   865   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   865   0.0     Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              865   0.0     Populus tomentosa [Chinese white poplar]
gb|EMT01272.1|  Adenosylhomocysteinase                                  865   0.0     
ref|XP_006373090.1|  adenosylhomocysteinase family protein              865   0.0     Populus trichocarpa [western balsam poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     865   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   865   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   865   0.0     Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   865   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     865   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  864   0.0     Populus euphratica
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     864   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     864   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     864   0.0     Populus tomentosa [Chinese white poplar]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       864   0.0     Gentiana triflora
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   864   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     864   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     864   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     864   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    864   0.0     
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             864   0.0     Solanum tuberosum [potatoes]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     864   0.0     Cucumis sativus [cucumbers]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     863   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     863   0.0     Populus tomentosa [Chinese white poplar]
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      863   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                863   0.0     Tarenaya hassleriana [spider flower]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           863   0.0     Brassica rapa
emb|CDY01177.1|  BnaA04g06420D                                          863   0.0     
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     863   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     863   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     863   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     863   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     863   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     863   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     863   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_002300147.1|  adenosylhomocysteinase family protein              863   0.0     Populus trichocarpa [western balsam poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     862   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     862   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     862   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     862   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     862   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     862   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     862   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             862   0.0     Phaseolus vulgaris [French bean]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             862   0.0     Eutrema salsugineum [saltwater cress]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    862   0.0     Linum usitatissimum
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     862   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     862   0.0     Populus tomentosa [Chinese white poplar]
emb|CDY50423.1|  BnaCnng19320D                                          861   0.0     Brassica napus [oilseed rape]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  861   0.0     Phoenix dactylifera
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     861   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             861   0.0     Solanum lycopersicum
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                861   0.0     Brassica rapa
emb|CDY47309.1|  BnaAnng08830D                                          861   0.0     Brassica napus [oilseed rape]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     860   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     860   0.0     Populus tomentosa [Chinese white poplar]
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               860   0.0     Capsicum annuum
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     860   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     860   0.0     Populus tomentosa [Chinese white poplar]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             860   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        860   0.0     
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     860   0.0     Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     860   0.0     Populus tomentosa [Chinese white poplar]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             860   0.0     Oryza brachyantha
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    860   0.0     Mesembryanthemum crystallinum
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  858   0.0     Beta vulgaris subsp. vulgaris [field beet]
ref|NP_189023.1|  adenosylhomocysteinase 2                              858   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             858   0.0     Phoenix dactylifera
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     858   0.0     Populus tomentosa [Chinese white poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        858   0.0     Trifolium pratense [peavine clover]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     857   0.0     Populus tomentosa [Chinese white poplar]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    857   0.0     Triticum aestivum [Canadian hard winter wheat]
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  857   0.0     Fragaria vesca subsp. vesca
gb|AAM19782.1|  AT3g23810/MYM9_15                                       857   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        857   0.0     Kalanchoe daigremontiana
ref|XP_003629610.1|  Adenosylhomocysteinase                             857   0.0     Medicago truncatula
ref|XP_006848518.1|  PREDICTED: adenosylhomocysteinase 1                856   0.0     Amborella trichopoda
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    856   0.0     Petroselinum crispum
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             856   0.0     Elaeis guineensis
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     856   0.0     Populus tomentosa [Chinese white poplar]
ref|NP_001067845.2|  Os11g0455500                                       856   0.0     
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     856   0.0     Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             855   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             855   0.0     Glycine max [soybeans]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       855   0.0     Nicotiana suaveolens
emb|CDP15078.1|  unnamed protein product                                855   0.0     Coffea canephora [robusta coffee]
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     855   0.0     Populus tomentosa [Chinese white poplar]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    854   0.0     Lupinus luteus
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    854   0.0     Lupinus luteus
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    854   0.0     Phalaenopsis sp.
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           853   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                853   0.0     Brassica rapa
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    853   0.0     Arabis alpina [alpine rockcress]
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                852   0.0     Brassica rapa
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    852   0.0     Pinus pinaster [cluster pine]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    852   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                851   0.0     Camelina sativa [gold-of-pleasure]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        851   0.0     Cicer arietinum [garbanzo]
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             850   0.0     Selaginella moellendorffii
gb|ABR16547.1|  unknown                                                 849   0.0     Picea sitchensis
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                849   0.0     Solanum tuberosum [potatoes]
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             849   0.0     Phaseolus vulgaris [French bean]
gb|ABK24229.1|  unknown                                                 848   0.0     Picea sitchensis
gb|ABK25129.1|  unknown                                                 848   0.0     Picea sitchensis
gb|ABR17322.1|  unknown                                                 848   0.0     Picea sitchensis
gb|ACN40278.1|  unknown                                                 847   0.0     Picea sitchensis
gb|ABR16573.1|  unknown                                                 847   0.0     Picea sitchensis
gb|ABR16138.1|  unknown                                                 846   0.0     Picea sitchensis
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             844   0.0     Cucumis melo [Oriental melon]
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             843   0.0     Cucumis sativus [cucumbers]
ref|NP_001234012.1|  adenosylhomocysteinase                             842   0.0     
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    841   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDY58805.1|  BnaC08g46780D                                          833   0.0     Brassica napus [oilseed rape]
emb|CDX85127.1|  BnaC07g07790D                                          832   0.0     
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           831   0.0     Brassica rapa
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     831   0.0     Eucalyptus grandis [rose gum]
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      828   0.0     Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_001755926.1|  predicted protein                                  828   0.0     
gb|KJB72029.1|  hypothetical protein B456_011G154000                    827   0.0     Gossypium raimondii
ref|XP_001755906.1|  predicted protein                                  827   0.0     
gb|KJB19538.1|  hypothetical protein B456_003G108500                    825   0.0     Gossypium raimondii
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      824   0.0     Petunia x hybrida [garden petunia]
ref|XP_001755929.1|  predicted protein                                  824   0.0     
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     822   0.0     Eucalyptus grandis [rose gum]
dbj|BAA03710.1|  cytokinin binding protein CBP57                        819   0.0     Nicotiana sylvestris
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  820   0.0     Gossypium arboreum [tree cotton]
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                820   0.0     
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             816   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     817   0.0     Phaseolus vulgaris [French bean]
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    805   0.0     Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY50106.1|  BnaC01g43540D                                          804   0.0     Brassica napus [oilseed rape]
emb|CDX77483.1|  BnaA07g06210D                                          801   0.0     
emb|CDY53211.1|  BnaC03g74050D                                          795   0.0     Brassica napus [oilseed rape]
gb|ABR16616.1|  unknown                                                 790   0.0     Picea sitchensis
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   776   0.0     Citrus sinensis [apfelsine]
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                770   0.0     Chlorella variabilis
gb|KJB72027.1|  hypothetical protein B456_011G154000                    767   0.0     Gossypium raimondii
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              764   0.0     Volvox carteri f. nagariensis
gb|EMS57266.1|  Adenosylhomocysteinase                                  770   0.0     Triticum urartu
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  756   0.0     Chlamydomonas reinhardtii
ref|NP_001031628.1|  adenosylhomocysteinase 1                           754   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       751   0.0     Chlamydomonas sp. ICE-L
gb|KIZ05177.1|  adenosylhomocysteinase                                  769   0.0     Monoraphidium neglectum
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       747   0.0     Dunaliella salina
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     742   0.0     Helicosporidium sp. ATCC 50920
ref|XP_011397211.1|  Adenosylhomocysteinase                             736   0.0     Auxenochlorella protothecoides
gb|ABR16332.1|  unknown                                                 727   0.0     Picea sitchensis
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             722   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_005708566.1|  adenosylhomocysteinase                             716   0.0     Galdieria sulphuraria
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  714   0.0     Coccomyxa subellipsoidea C-169
ref|XP_003057172.1|  adenosylhomocysteinase                             712   0.0     Micromonas pusilla CCMP1545
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    709   0.0     Ostreococcus tauri
gb|KJB37872.1|  hypothetical protein B456_006G223900                    705   0.0     Gossypium raimondii
ref|XP_002505983.1|  adenosylhomocysteinase                             707   0.0     Micromonas commoda
ref|XP_001419579.1|  predicted protein                                  704   0.0     Ostreococcus lucimarinus CCE9901
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      703   0.0     Polytomella sp. Pringsheim 198.80
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                691   0.0     Bathycoccus prasinos
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                     678   0.0     Eucalyptus grandis [rose gum]
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   675   0.0     
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             675   0.0     Guillardia theta CCMP2712
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   673   0.0     
ref|XP_008611237.1|  adenosylhomocysteinase                             671   0.0     Saprolegnia diclina VS20
gb|EPT27008.1|  adenosylhomocysteinase, putative                        675   0.0     Toxoplasma gondii ME49
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                671   0.0     Chondrus crispus [carageen]
gb|KFH13893.1|  putative adenosylhomocysteinase                         674   0.0     Toxoplasma gondii MAS
gb|KFG42936.1|  putative adenosylhomocysteinase                         674   0.0     Toxoplasma gondii p89
gb|EPR62066.1|  putative adenosylhomocysteinase                         674   0.0     Toxoplasma gondii GT1
gb|KFG55060.1|  putative adenosylhomocysteinase                         674   0.0     Toxoplasma gondii FOU
gb|ESS32583.1|  putative adenosylhomocysteinase                         673   0.0     
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  669   0.0     
ref|XP_008872075.1|  adenosylhomocysteinase 2                           667   0.0     
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                     662   0.0     
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     662   0.0     
gb|KCW60456.1|  hypothetical protein EUGRSUZ_H03176                     660   0.0     
ref|NP_001031627.1|  adenosylhomocysteinase 1                           655   0.0     
ref|XP_002177758.1|  adenosylhomocysteinase                             659   0.0     
ref|XP_009833581.1|  adenosylhomocysteinase 2                           657   0.0     
emb|CCA20123.1|  unnamed protein product                                656   0.0     
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    655   0.0     
ref|XP_008893590.1|  adenosylhomocysteinase                             655   0.0     
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             652   0.0     
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    646   0.0     
ref|XP_002902721.1|  adenosylhomocysteinase                             646   0.0     
ref|XP_009493630.1|  adenosylhomocysteinase 1                           645   0.0     
emb|CCI50303.1|  unnamed protein product                                644   0.0     
gb|EJY87176.1|  Adenosylhomocysteinase                                  642   0.0     
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              637   0.0     
ref|XP_002788757.1|  conserved hypothetical protein                     636   0.0     
ref|XP_002765933.1|  conserved hypothetical protein                     635   0.0     
ref|XP_005790915.1|  S-adenosyl-L-homocysteine hydrolase                635   0.0     
ref|WP_028061676.1|  hypothetical protein                               624   0.0     
ref|XP_005786995.1|  S-adenosyl-L-homocysteine hydrolase                624   0.0     
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase                624   0.0     
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                624   0.0     
ref|XP_005535237.1|  S-adenosyl-L-homocysteine hydrolase                625   0.0     
ref|WP_020576907.1|  S-adenosyl-L-homocysteine hydrolase                623   0.0     
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644              622   0.0     
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase                622   0.0     
gb|KHN12344.1|  Adenosylhomocysteinase                                  617   0.0     
emb|CBJ28078.1|  S-Adenosyl homocysteine hydrolase                      619   0.0     
ref|WP_030543976.1|  adenosylhomocysteinase                             619   0.0     
ref|WP_012919256.1|  S-adenosyl-L-homocysteine hydrolase                617   0.0     
ref|WP_011292928.1|  S-adenosyl-L-homocysteine hydrolase                617   0.0     
ref|WP_020389898.1|  S-adenosyl-L-homocysteine hydrolase                616   0.0     
ref|WP_017538521.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    616   0.0     
ref|WP_018502367.1|  S-adenosyl-L-homocysteine hydrolase                616   0.0     
ref|WP_015796151.1|  S-adenosyl-L-homocysteine hydrolase                616   0.0     
ref|WP_012157556.1|  S-adenosyl-L-homocysteine hydrolase                615   0.0     
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase                615   0.0     
ref|WP_004953444.1|  S-adenosyl-L-homocysteine hydrolase                614   0.0     
ref|WP_027006534.1|  hypothetical protein                               613   0.0     
gb|AGV54286.1|  adenosylhomocysteinase                                  613   0.0     
ref|WP_018386384.1|  S-adenosyl-L-homocysteine hydrolase                613   0.0     
gb|EMS57067.1|  Adenosylhomocysteinase                                  610   0.0     
ref|WP_030260730.1|  MULTISPECIES: hypothetical protein                 612   0.0     
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)            610   0.0     
ref|WP_030742429.1|  adenosylhomocysteinase                             612   0.0     
ref|WP_018636612.1|  S-adenosyl-L-homocysteine hydrolase                611   0.0     
ref|WP_030837066.1|  adenosylhomocysteinase                             612   0.0     
gb|EWM21100.1|  s-adenosyl homocysteine hydrolase                       615   0.0     
ref|WP_041448694.1|  adenosylhomocysteinase                             611   0.0     
gb|ABS24379.1|  adenosylhomocysteinase                                  611   0.0     
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    610   0.0     
ref|WP_030245490.1|  hypothetical protein                               610   0.0     
ref|WP_014061185.1|  S-adenosyl-L-homocysteine hydrolase                610   0.0     
ref|WP_014177043.1|  S-adenosyl-L-homocysteine hydrolase                610   0.0     
ref|WP_045702128.1|  hypothetical protein                               610   0.0     
ref|WP_043474120.1|  adenosylhomocysteinase                             609   0.0     
gb|AGP57357.1|  S-adenosyl-L-homocysteine hydrolase                     609   0.0     
ref|WP_023840013.1|  MULTISPECIES: adenosylhomocysteinase               609   0.0     
ref|WP_037954273.1|  adenosylhomocysteinase                             609   0.0     
ref|WP_031509769.1|  adenosylhomocysteinase                             609   0.0     
ref|WP_019886836.1|  S-adenosyl-L-homocysteine hydrolase                608   0.0     
ref|WP_027734715.1|  adenosylhomocysteinase                             608   0.0     
ref|WP_017945881.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    608   0.0     
ref|WP_028062632.1|  hypothetical protein                               608   0.0     
ref|WP_006348984.1|  S-adenosyl-L-homocysteine hydrolase                608   0.0     
ref|WP_013421278.1|  S-adenosyl-L-homocysteine hydrolase                608   0.0     
ref|WP_006538559.1|  S-adenosyl-L-homocysteine hydrolase                608   0.0     
ref|XP_001023087.1|  adenosylhomocysteinase family protein              607   0.0     
ref|WP_037910293.1|  adenosylhomocysteinase                             608   0.0     
ref|WP_019878251.1|  S-adenosyl-L-homocysteine hydrolase                608   0.0     
ref|WP_030289952.1|  MULTISPECIES: hypothetical protein                 607   0.0     
ref|WP_009717416.1|  S-adenosyl-L-homocysteine hydrolase                608   0.0     
ref|WP_034088535.1|  hypothetical protein                               607   0.0     
ref|WP_026910859.1|  S-adenosyl-L-homocysteine hydrolase                607   0.0     
ref|WP_011438808.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    607   0.0     
ref|XP_004025117.1|  hypothetical protein IMG5_191490                   607   0.0     
ref|WP_020252885.1|  hypothetical protein                               606   0.0     
ref|WP_035863223.1|  S-adenosyl-L-homocysteine hydrolase                607   0.0     
dbj|GAO04349.1|  adenosylhomocysteinase                                 607   0.0     
ref|WP_030891029.1|  adenosylhomocysteinase                             607   0.0     
ref|WP_030889521.1|  MULTISPECIES: adenosylhomocysteinase               607   0.0     
ref|WP_030264019.1|  hypothetical protein                               606   0.0     
ref|WP_036944508.1|  hypothetical protein                               605   0.0     
ref|WP_045941557.1|  hypothetical protein                               606   0.0     
ref|WP_033255593.1|  S-adenosyl-L-homocysteine hydrolase                606   0.0     
ref|WP_033354750.1|  hypothetical protein                               606   0.0     
ref|WP_045876854.1|  S-adenosyl-L-homocysteine hydrolase                606   0.0     
ref|WP_018846770.1|  S-adenosyl-L-homocysteine hydrolase                606   0.0     
ref|WP_017625947.1|  S-adenosyl-L-homocysteine hydrolase                605   0.0     
ref|WP_009996356.1|  S-adenosyl-L-homocysteine hydrolase                605   0.0     
ref|WP_030700076.1|  adenosylhomocysteinase                             605   0.0     
gb|AHG90399.1|  Adenosylhomocysteinase                                  606   0.0     
ref|WP_030977071.1|  adenosylhomocysteinase                             605   0.0     
ref|WP_023417428.1|  S-adenosyl-L-homocysteine hydrolase                605   0.0     
ref|XP_001423621.1|  hypothetical protein                               605   0.0     
ref|WP_031068303.1|  adenosylhomocysteinase                             605   0.0     
ref|WP_014804737.1|  S-adenosyl-L-homocysteine hydrolase                605   0.0     
ref|WP_023421854.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    605   0.0     
gb|AJD20014.1|  S-adenosyl-L-homocysteine hy-drolase                    605   0.0     
ref|WP_012631604.1|  S-adenosyl-L-homocysteine hydrolase                605   0.0     
ref|WP_012524242.1|  S-adenosyl-L-homocysteine hydrolase                605   0.0     
ref|WP_044574415.1|  adenosylhomocysteinase                             605   0.0     
ref|WP_030461911.1|  S-adenosyl-L-homocysteine hydrolase                604   0.0     
ref|WP_033218411.1|  S-adenosyl-L-homocysteine hydrolase                604   0.0     
ref|WP_030276178.1|  hypothetical protein                               604   0.0     
ref|WP_014136057.1|  S-adenosyl-L-homocysteine hydrolase                604   0.0     
ref|WP_003950444.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    604   0.0     
ref|WP_030398087.1|  MULTISPECIES: hypothetical protein                 604   0.0     
ref|WP_022926989.1|  S-adenosyl-L-homocysteine hydrolase                604   0.0     
ref|WP_030509358.1|  S-adenosyl-L-homocysteine hydrolase                603   0.0     
ref|WP_027290196.1|  adenosylhomocysteinase                             603   0.0     
ref|WP_043914237.1|  S-adenosyl-L-homocysteine hydrolase                603   0.0     
gb|EFG07180.1|  Adenosylhomocysteinase                                  605   0.0     
ref|WP_010642861.1|  S-adenosyl-L-homocysteine hydrolase                603   0.0     
ref|WP_031077053.1|  hypothetical protein                               603   0.0     
ref|WP_030350966.1|  adenosylhomocysteinase                             603   0.0     
ref|WP_035848617.1|  hypothetical protein                               603   0.0     
ref|WP_030927023.1|  adenosylhomocysteinase                             603   0.0     
ref|WP_019356875.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    603   0.0     
ref|WP_031519542.1|  adenosylhomocysteinase                             603   0.0     
ref|WP_027756462.1|  adenosylhomocysteinase                             603   0.0     
ref|WP_030920540.1|  S-adenosyl-L-homocysteine hydrolase                603   0.0     
ref|WP_033342518.1|  hypothetical protein                               602   0.0     
ref|WP_027139388.1|  hypothetical protein                               603   0.0     
ref|WP_041129509.1|  adenosylhomocysteinase                             602   0.0     
ref|WP_041939978.1|  S-adenosyl-L-homocysteine hydrolase                602   0.0     
ref|WP_035857732.1|  hypothetical protein                               602   0.0     
ref|WP_028810729.1|  adenosylhomocysteinase                             602   0.0     
ref|WP_023588381.1|  S-adenosyl-L-homocysteine hydrolase                602   0.0     
ref|WP_016472770.1|  MULTISPECIES: adenosylhomocysteinase               602   0.0     
ref|WP_034269570.1|  hypothetical protein                               602   0.0     
ref|WP_030310801.1|  hypothetical protein                               602   0.0     
ref|WP_030250255.1|  MULTISPECIES: adenosylhomocysteinase               602   0.0     
ref|WP_037699778.1|  adenosylhomocysteinase                             602   0.0     
ref|WP_010472770.1|  S-adenosyl-L-homocysteine hydrolase                602   0.0     
ref|WP_037575816.1|  hypothetical protein                               602   0.0     
ref|WP_030572588.1|  adenosylhomocysteinase                             602   0.0     
ref|WP_006801116.1|  S-adenosyl-L-homocysteine hydrolase                601   0.0     
ref|WP_009741556.1|  S-adenosyl-L-homocysteine hydrolase                601   0.0     
ref|WP_019629152.1|  S-adenosyl-L-homocysteine hydrolase                601   0.0     
ref|WP_030365247.1|  adenosylhomocysteinase                             601   0.0     
ref|XP_011129374.1|  adenosylhomocysteinase                             603   0.0     
ref|WP_033824956.1|  hypothetical protein                               601   0.0     
ref|WP_031126383.1|  adenosylhomocysteinase                             601   0.0     
ref|WP_003957148.1|  S-adenosyl-L-homocysteine hydrolase                601   0.0     
gb|ADR18482.1|  adenosylhomocysteinase                                  600   0.0     
ref|WP_018524685.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    601   0.0     
ref|WP_031119192.1|  MULTISPECIES: adenosylhomocysteinase               601   0.0     
ref|WP_028429456.1|  adenosylhomocysteinase                             601   0.0     
ref|WP_027739704.1|  adenosylhomocysteinase                             601   0.0     
emb|CDJ69092.1|  adenosylhomocysteinase, putative                       601   0.0     
ref|WP_033173798.1|  adenosylhomocysteinase                             600   0.0     
ref|WP_015608928.1|  MULTISPECIES: SAHH Adenosylhomocysteinase          600   0.0     
ref|WP_041723781.1|  adenosylhomocysteinase                             600   0.0     
ref|WP_036327944.1|  S-adenosyl-L-homocysteine hydrolase                600   0.0     
ref|WP_010535621.1|  S-adenosyl-L-homocysteine hydrolase                600   0.0     
ref|WP_017595102.1|  S-adenosyl-L-homocysteine hydrolase                600   0.0     
ref|WP_030556303.1|  adenosylhomocysteinase                             600   0.0     
ref|WP_030221825.1|  adenosylhomocysteinase                             600   0.0     
ref|WP_026415696.1|  S-adenosyl-L-homocysteine hydrolase                600   0.0     
ref|WP_030168968.1|  S-adenosyl-L-homocysteine hydrolase                600   0.0     
ref|WP_044886046.1|  S-adenosyl-L-homocysteine hydrolase                600   0.0     
ref|WP_005781763.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    599   0.0     
ref|WP_017618754.1|  S-adenosyl-L-homocysteine hydrolase                599   0.0     
ref|WP_027325990.1|  adenosylhomocysteinase                             599   0.0     
ref|WP_014911909.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    599   0.0     
ref|WP_018103985.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    599   0.0     
ref|WP_027774219.1|  adenosylhomocysteinase                             599   0.0     
ref|WP_033210793.1|  adenosylhomocysteinase                             599   0.0     
ref|WP_018770150.1|  S-adenosyl-L-homocysteine hydrolase                599   0.0     
ref|WP_007511841.1|  S-adenosyl-L-homocysteine hydrolase                598   0.0     
ref|WP_026206556.1|  adenosylhomocysteinase                             599   0.0     
ref|WP_008770078.1|  adenosylhomocysteinase                             599   0.0     
ref|WP_019546896.1|  S-adenosyl-L-homocysteine hydrolase                598   0.0     
ref|WP_030010948.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_042410976.1|  hypothetical protein                               598   0.0     
ref|WP_020541357.1|  S-adenosyl-L-homocysteine hydrolase                598   0.0     
ref|WP_024886447.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_018559695.1|  S-adenosyl-L-homocysteine hydrolase                598   0.0     
ref|WP_028421799.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_029384937.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_030912635.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_038287745.1|  hypothetical protein                               598   0.0     
gb|ADE22275.1|  putative adenosylhomocysteinase                         598   0.0     
ref|WP_030793284.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_016910634.1|  S-adenosyl-L-homocysteine hydrolase                598   0.0     
emb|CDJ37737.1|  adenosylhomocysteinase, putative                       598   0.0     
ref|WP_011419216.1|  S-adenosyl-L-homocysteine hydrolase                598   0.0     
ref|WP_031481220.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_043581849.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_044300351.1|  adenosylhomocysteinase                             597   0.0     
ref|WP_030724754.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_007264450.1|  S-adenosyl-L-homocysteine hydrolase                598   0.0     
ref|WP_043501387.1|  adenosylhomocysteinase                             598   0.0     
ref|WP_021645958.1|  adenosylhomocysteinase                             597   0.0     
ref|WP_032576381.1|  adenosylhomocysteinase                             597   0.0     
ref|WP_045861872.1|  adenosylhomocysteinase                             597   0.0     
ref|WP_026403633.1|  S-adenosyl-L-homocysteine hydrolase                597   0.0     
ref|WP_031136433.1|  adenosylhomocysteinase                             597   0.0     
ref|WP_016268876.1|  adenosylhomocysteinase                             597   0.0     
ref|WP_043620654.1|  S-adenosyl-L-homocysteine hydrolase                597   0.0     
gb|ABI22140.1|  putative adenosylhomocysteinase                         597   0.0     
ref|WP_017596835.1|  S-adenosyl-L-homocysteine hydrolase                597   0.0     
ref|WP_009155258.1|  S-adenosyl-L-homocysteine hydrolase                597   0.0     
ref|WP_008765354.1|  S-adenosyl-L-homocysteine hydrolase                597   0.0     
ref|WP_035801129.1|  hypothetical protein                               597   0.0     
ref|WP_018515534.1|  S-adenosyl-L-homocysteine hydrolase                597   0.0     
ref|WP_032850487.1|  adenosylhomocysteinase                             596   0.0     
ref|WP_019983817.1|  S-adenosyl-L-homocysteine hydrolase                597   0.0     
ref|WP_027744328.1|  adenosylhomocysteinase                             597   0.0     
gb|EFI04196.1|  adenosylhomocysteinase                                  597   0.0     
ref|WP_033326694.1|  adenosylhomocysteinase                             597   0.0     
ref|WP_030735559.1|  adenosylhomocysteinase                             596   0.0     
ref|WP_030221676.1|  adenosylhomocysteinase                             597   0.0     
ref|WP_030763676.1|  MULTISPECIES: adenosylhomocysteinase               596   0.0     
ref|WP_018840781.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    597   0.0     
ref|WP_017608316.1|  S-adenosyl-L-homocysteine hydrolase                596   0.0     



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/481 (94%), Positives = 470/481 (98%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARV+VTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVVVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GFQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKPPHYR
Sbjct  425   KERATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/481 (94%), Positives = 470/481 (98%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGP+QPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPTQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGKLPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPTKYAKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GFQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYR
Sbjct  425   KEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/482 (94%), Positives = 469/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4     SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124   ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIVVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHY
Sbjct  424   WKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_012071085.1| PREDICTED: adenosylhomocysteinase 1 [Jatropha curcas]
 gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/481 (94%), Positives = 469/481 (98%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+ GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAE+GPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTGGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEYGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQLPDPSSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKKYHKMKERLVGVSEETTTGVKRLYQMQVNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVS+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GLQVLTLEDVVSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             +EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYR
Sbjct  425   REKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/482 (94%), Positives = 469/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4     SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124   ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKY RMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYRRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHY
Sbjct  424   WKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/481 (94%), Positives = 469/481 (98%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTSSGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LKADP KY +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKADPMKYHKMKDRLVGVSEETTTGVKRLYQMQAAGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ VLTLEDVV++ADI VTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GIPVLTLEDVVTDADILVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYR
Sbjct  425   KEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/482 (94%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4     SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124   ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTL DVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGLQVLTLGDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHY
Sbjct  424   WKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/482 (94%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4     SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124   ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKY RMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYRRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHY
Sbjct  424   WKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/481 (93%), Positives = 467/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LKADP KY +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKADPMKYHKMKDRLVGVSEETTTGVKRLYQMQAAGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ VLTLEDV++EADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE  P
Sbjct  305   GIPVLTLEDVLAEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLEILP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +G+I+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGVIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQAAYIS+PVEGPYKP HYR
Sbjct  425   KEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSEQAAYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/482 (93%), Positives = 469/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPF GARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFAGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP STDNAEF+IVLTIIRD
Sbjct  124   CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKIPDPESTDNAEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK+DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKSDPKKYRKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+P+EGPYKP HY
Sbjct  424   WKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPIEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/481 (94%), Positives = 467/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4     SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124   ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTL DVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGLQVLTLGDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHY
Sbjct  424   WKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHY  483

Query  1532  R  1534
             R
Sbjct  484   R  484



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/482 (94%), Positives = 471/482 (98%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDPSSTDNAEFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFKKSGKLPDPSSTDNAEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DP+KYT+MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPEKYTKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA M
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQATM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVS+ADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLTLEDVVSDADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVK+ITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKKITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  Y
Sbjct  424   WKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPLAY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/481 (93%), Positives = 469/481 (98%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAE+GP+QPFKGARITGSLHMT
Sbjct  5     VEKTAGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEYGPAQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K G VPDP+STDNAEFQIVLTII+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKVPDPASTDNAEFQIVLTIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LKADPKKY +M++RLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKADPKKYRKMRDRLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVL LEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLPLEDVVSEADIFVTTTGNKDIIMVHHMKKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYR
Sbjct  425   KEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/481 (94%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDPSSTDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPSSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKEDPKKYHKMKERLVGVSEETTTGVKRLYQMQLNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA +LKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAISLKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GFQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT EQ+ YISIPVEGPYKPPHYR
Sbjct  425   NERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQSDYISIPVEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/481 (93%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5     VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G VPDP+STDNAEFQIVL +IRD 
Sbjct  125   LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKVPDPASTDNAEFQIVLGLIRDS  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             +K DPKKY RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   IKVDPKKYRRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ VLTLEDVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GIPVLTLEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKPPHYR
Sbjct  425   KERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPAQAEYISVPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/481 (93%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             V KTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGPSQP KGARI+GSLHMT
Sbjct  5     VGKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPLKGARISGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTER 
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSVAVFAWKGETLQEYWWCTERC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRD 
Sbjct  125   LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLIRDS  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPKKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ VLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GIPVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P EGPYKPPHYR
Sbjct  425   KEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPTEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/482 (94%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4     SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+A DSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIAHDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ Y K G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124   ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEQVYEKTGQLPDPSSTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHY
Sbjct  424   WKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/482 (93%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K G VPDP STDNAEF+IVLTIIRD
Sbjct  124   CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKVPDPESTDNAEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK+DPK+Y +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKSDPKRYRKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  Q+ YIS+P+EGPYKP HY
Sbjct  424   WKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKSQSDYISVPIEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 468/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKYT+MKERLVGVSEETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPKKYTKMKERLVGVSEETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAI+CNIGHFDNEIDMHGLETYP
Sbjct  305   GYQVLTLEDVLSEADIFVTTTGNKDIIMVGHMRKMKNNAIICNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYR
Sbjct  425   NERKSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/481 (93%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQ+HAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPTKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+P+EGPYKP HYR
Sbjct  425   NERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 467/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKYT+MKERLVGVSEETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPKKYTKMKERLVGVSEETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAI+CNIGHFDNEIDM GLETYP
Sbjct  305   GYQVLTLEDVVSEADIFVTTTGNKDIIMVGHMRKMKNNAIICNIGHFDNEIDMQGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYR
Sbjct  425   NERKSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/482 (93%), Positives = 469/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4     SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVS+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLTLEDVVSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HY
Sbjct  424   WKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/482 (93%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RV+VTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVVVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  304   EGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/482 (93%), Positives = 467/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTIIRD
Sbjct  124   CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK+DP KY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKSDPSKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HY
Sbjct  424   WKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/481 (93%), Positives = 468/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYR
Sbjct  425   KEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/482 (93%), Positives = 469/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4     SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDV+S+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HY
Sbjct  424   WKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/481 (93%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  94    VEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  153

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  154   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  213

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ KNGTVPDP+STDNAEFQIVLTIIRDG
Sbjct  214   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKNGTVPDPNSTDNAEFQIVLTIIRDG  273

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+YT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  274   LKTDPKRYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  333

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA +LKQAGARVIVTEIDPICALQALME
Sbjct  334   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAISLKQAGARVIVTEIDPICALQALME  393

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLEDV+SEADIFVTTTGNKDIIMV  MK+MKNNAIVCNIGHFDNEIDM GLE YP
Sbjct  394   GFQVLTLEDVLSEADIFVTTTGNKDIIMVDQMKRMKNNAIVCNIGHFDNEIDMQGLENYP  453

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  454   GVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  513

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ YISIPVEGPYKPPHYR
Sbjct  514   NERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPHYR  573

Query  1535  Y  1537
             Y
Sbjct  574   Y  574



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/481 (93%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP++PF GARI+GSLHMT
Sbjct  5     VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAKPFAGARISGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER 
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL IIRDG
Sbjct  125   LDWGPNGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVLGIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKY +MKERLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPKKYRKMKERLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GL VLTLEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GLPVLTLEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYR
Sbjct  425   KEKTTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/481 (93%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DPK+Y +MKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPKRYHKMKERLVGVSEETTTGVKRLYQMQSSGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYR
Sbjct  425   NERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/482 (93%), Positives = 466/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP STDNAEF+IVLTIIRD
Sbjct  124   CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HY
Sbjct  424   WKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/481 (93%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP +Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPTRYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLE YP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+P QA YIS+PVEGPYKP HYR
Sbjct  425   KEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPAQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/482 (92%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RV+VTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVVVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LEDVV+EADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  304   EGLQVLPLEDVVAEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  Y
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAAY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  108   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  167

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  168   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  227

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  228   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVLSIIKEG  287

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  288   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGC  347

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  348   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  407

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  408   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  467

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  468   GVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  527

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYR
Sbjct  528   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYR  587

Query  1535  Y  1537
             Y
Sbjct  588   Y  588



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/481 (93%), Positives = 467/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKPPHYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/482 (92%), Positives = 466/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHM
Sbjct  4     SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPLKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  304   EGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/481 (92%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDM+QADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  67    VEKTTSGREYKVKDMTQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  126

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  127   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  186

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  187   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKLPDPSSTDNAEFQIVLTIIRDG  246

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  247   LKTDPKRYAKMKERLVGVSEETTTGVKRLYQMQLNGTLLFPAINVNDSVTKSKFDNLYGC  306

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA +LKQAGARVIVTEIDPICALQALME
Sbjct  307   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAISLKQAGARVIVTEIDPICALQALME  366

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  367   GFQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  426

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  427   GVKRITIKPQTDRWVFPDTKSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  486

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIPVEGPYKPPHYR
Sbjct  487   NERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPVEGPYKPPHYR  546

Query  1535  Y  1537
             Y
Sbjct  547   Y  547



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/482 (93%), Positives = 464/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG+ +LTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGIPLLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ TGKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT EQA YIS+PVEGPYKP HY
Sbjct  424   WNERTTGKYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/482 (92%), Positives = 466/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ S TLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASSTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  304   EGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
              GVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   AGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/482 (92%), Positives = 466/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  304   EGLQVLPLEDVVSEADIFVTTTGNKDIIMVEHMRKMKNNAIVCNIGHFDNEIDMHGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             V+KTSSGREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VDKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEE+ K G  PDPSST+NAEFQIVLT+I+DG
Sbjct  125   LDWGPSGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKFPDPSSTNNAEFQIVLTLIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKY +M+ERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKKYHKMQERLVGVSEETTTGVKRLYQMQSAGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ V TLEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GIPVQTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLADGRLMNLGCATGHPSFVMSCSFTNQVIAQIELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYR
Sbjct  425   KEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 467/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYR
Sbjct  425   KEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/481 (92%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/482 (92%), Positives = 465/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LED VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  304   EGLQVLPLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/481 (93%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPTSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVL LEDVVSEADIFVTTTGNKDI+MV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GYQVLPLEDVVSEADIFVTTTGNKDIVMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             +EK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   REKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/482 (92%), Positives = 469/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +V+K++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4     SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDV+S+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEID+ GLETY
Sbjct  304   EGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDVLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HY
Sbjct  424   WKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/481 (93%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMTKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/481 (93%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP +Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPTRYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYR
Sbjct  425   KEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/481 (93%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP QPFKGA+ITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPQQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKGRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ V T+EDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GIPVQTIEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYR
Sbjct  425   KEKASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+L KL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLAKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT++GRE+KVKDMSQADFGRLE+ELAEVEMPGLM+ R+EFGPSQPFKGARITGSLHMT
Sbjct  87    VEKTTAGREFKVKDMSQADFGRLEIELAEVEMPGLMSSRSEFGPSQPFKGARITGSLHMT  146

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  147   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  206

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAE EY K G +PDP+STDNAEFQ+VL +IRDG
Sbjct  207   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEAEYEKTGKLPDPNSTDNAEFQLVLGLIRDG  266

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+YT+MKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  267   LKTDPKRYTKMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGC  326

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGK+ VVCGYGDVGKGCAAALKQAGARV+VTEIDPICALQALME
Sbjct  327   RHSLPDGLMRATDVMIAGKIGVVCGYGDVGKGCAAALKQAGARVVVTEIDPICALQALME  386

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  387   GFQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYP  446

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GV+RITIKPQTDR+VFP+TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  447   GVERITIKPQTDRYVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  506

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+ VEGPYKP HYR
Sbjct  507   KERSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVAVEGPYKPAHYR  566

Query  1535  Y  1537
             Y
Sbjct  567   Y  567



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/481 (93%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DPK+Y +MKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPKRYHKMKERLVGVSEETTTGVKRLYQMQSSGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLED VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YP
Sbjct  305   GLQVLTLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYR
Sbjct  425   NERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/481 (92%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/482 (91%), Positives = 463/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +V+KTS GREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4     SVDKTSGGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSASVFAWKGETLQEYWWCTEK  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             +LDWG GGGPDLIVDDGGD T+LIHEGVKAEE Y K G VPDP+S+DNAEFQIVLTII+D
Sbjct  124   SLDWGAGGGPDLIVDDGGDVTMLIHEGVKAEEAYEKTGKVPDPTSSDNAEFQIVLTIIKD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GL A+PKKYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLTANPKKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDV+S ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGLQVLTLEDVLSTADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK+TGKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT +QA YIS+P+EGPYKPPHY
Sbjct  424   WTEKSTGKYEKKVYVLPKHLDEKVAALHLVKLGAKLTKLTKDQADYISVPIEGPYKPPHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHMT
Sbjct  5     VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIE+LTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER 
Sbjct  65    IQTAVLIESLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRDG
Sbjct  125   LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVLGLIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKY RMKERLVGVSEETTTGVKRLYQMQ SG+LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPKKYRRMKERLVGVSEETTTGVKRLYQMQASGSLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ VLTLEDVVSE DIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GIPVLTLEDVVSEVDIFVTTTGNKDIIMVEHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYR
Sbjct  425   KERETGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLL+HEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLVHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/481 (92%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK R+VGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYQKMKTRIVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQ GARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQGGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV+SEADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GLQVLTLEDVISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELW
Sbjct  365   GVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK +GKYEKKVYVLPKHLDEKVAALHLG+LGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   KEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGAKLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/481 (92%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGPSQPFKGARI+GSLHMT
Sbjct  5     VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPFKGARISGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDN+EFQIVL +IRD 
Sbjct  125   LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPTSTDNSEFQIVLGLIRDS  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPKKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ V+TLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE YP
Sbjct  305   GIPVITLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLENYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYR
Sbjct  425   KERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/482 (93%), Positives = 464/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP STDNAEF+IVLTIIRD
Sbjct  124   CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HY
Sbjct  424   WKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAW+GETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWEGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYYKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/481 (92%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVAPLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM++MKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITI+PQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIEPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/482 (92%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DP++Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPQRYHKMKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL L+DVVSEADIFVTTTGNKDIIMV  MKKMKNNAIVCNIGHFDNEIDMHGLE +
Sbjct  304   EGLQVLPLQDVVSEADIFVTTTGNKDIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLENF  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK++GKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHY
Sbjct  424   WKEKSSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMK+NAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKSNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGTGGGPDLIVDDGGDATLLIHEGVKAEEVFEKTGQVPDPNSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYRKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ YISIP++GPYKPPHYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYISIPIQGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQA+FGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQANFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFD+LYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDSLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   SEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             +
Sbjct  485   H  485



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYR
Sbjct  425   NEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/481 (92%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VLTII++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVLTIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/481 (93%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPF GARITGSLHMT
Sbjct  5     VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFAGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER 
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEE+ K G +PDP+STDNAEFQIVL IIRDG
Sbjct  125   LDWGPTGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKLPDPASTDNAEFQIVLGIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKY RMK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPKKYRRMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GL VLTLEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLPVLTLEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMQGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             G+KRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GIKRITIKPQTDRWVFPETSTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYR
Sbjct  425   KERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPVEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+  +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDISSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGV+AEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVRAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM++MKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/482 (92%), Positives = 464/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG  GGPDLIVDDGGDATLLIHEGVKAEE+Y K G +PDP STDNAEF+IVLTIIRD
Sbjct  124   CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEDYEKTGKIPDPESTDNAEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HY
Sbjct  424   WKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q  Y+SIP+EGPYKPPHYR
Sbjct  425   NEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQXDYVSIPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/480 (93%), Positives = 459/480 (96%), Gaps = 0/480 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK D KKYTRMK RLVGVSEETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDRKKYTRMKNRLVGVSEETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVV EADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YP
Sbjct  305   GLQVLTLEDVVCEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMCGLENYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK TGKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ EQA YIS+PVEGPYKP HYR
Sbjct  425   NEKATGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSKEQADYISVPVEGPYKPAHYR  484



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/482 (93%), Positives = 465/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRD
Sbjct  124   CLDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK D +KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDARKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG+Q+LTLEDVVS+ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETY
Sbjct  304   EGIQILTLEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  Y
Sbjct  424   WKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVEGPYKPSAY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/481 (92%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VLTII++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVLTIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVS  DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSNVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/479 (92%), Positives = 465/479 (97%), Gaps = 0/479 (0%)
 Frame = +2

Query  101   KTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQ  280
             KT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQ
Sbjct  1     KTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQ  60

Query  281   TAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALD  460
             TAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALD
Sbjct  61    TAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALD  120

Query  461   WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLK  640
             WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VLTIIRDGLK
Sbjct  121   WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVLTIIRDGLK  180

Query  641   ADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRH  820
              DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRH
Sbjct  181   TDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRH  240

Query  821   SLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL  1000
             SLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQA MEGL
Sbjct  241   SLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATMEGL  300

Query  1001  QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGV  1180
             QVLTLEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGV
Sbjct  301   QVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGV  360

Query  1181  KRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE  1360
             KRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE
Sbjct  361   KRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE  420

Query  1361  KNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             K+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYRY
Sbjct  421   KSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  479



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVLQIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L  DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LPVDPKKYHKMKERLVGVSEETTTGVKRLYQMQVNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G Q+LTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GFQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKPPHYR
Sbjct  425   KEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISVPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYHKMKDRLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LED VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  304   EGLQVLPLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHY  483

Query  1532  R  1534
             R
Sbjct  484   R  484



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/481 (92%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPS TDN EFQIVL II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGQVPDPSCTDNPEFQIVLQIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +M+ERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYRKMRERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G Q+LTLED+VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GFQILTLEDIVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYR
Sbjct  425   KEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSTDQADYISVPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEI MHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIGMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQ HAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQGHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWW TERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWSTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY ++KERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKVKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKH DEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHFDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+ P KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSGPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/481 (92%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHL+EKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYR
Sbjct  425   NEKASGKYEKKVYVLPKHLNEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/482 (92%), Positives = 465/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSC IFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCXIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP STDN EF+IVLTIIRD
Sbjct  124   CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKIPDPESTDNPEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK D +KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDARKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQ+LTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETY
Sbjct  304   EGLQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKE++TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YISIP+EGPYKP HY
Sbjct  424   WKERSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISIPIEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG 
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGR  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ ELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQPELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDAT LIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATPLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAALIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLD KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDGKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/481 (92%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSF NQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFINQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYR
Sbjct  425   NEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y KNG +PDPSSTDNAEFQI+LTIIRDG
Sbjct  125   LDWGPTGGPDLIVDDGGDVTLLIHEGVKAEELYEKNGQLPDPSSTDNAEFQIILTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKDRIVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALKQ GARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKQGGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLED +SEADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GLQVLTLEDAISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELW
Sbjct  365   GVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK +GKYEKKVYVLPKHLDEKVAALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   KEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDPSSTDN EFQ+VLTII++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPSSTDNVEFQLVLTIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVL LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLPLEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLED VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITI PQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITILPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMFCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVD GGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDGGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWG GGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTIIRDG
Sbjct  125   LDWGTGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYQKMKTRIVGVSEETTTGVKRLYQMQATGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQ GARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQGGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV+SEADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GLQVLTLEDVISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELW
Sbjct  365   GVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK +GKYEKKVYVLPKHLDEKVAALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   KEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIR G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRGG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGAR+IVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARMIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/481 (93%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP QPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPQQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY ++G +PDP+STDNAEFQIVL II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYERSGKLPDPASTDNAEFQIVLGIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L  DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLF AINVNDSVTKSKFDNLYGC
Sbjct  185   LSVDPCKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFAAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGA+VIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGAQVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ VLTLEDVVS+ADIFVTTTGNKDIIMV HMK+MKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GIPVLTLEDVVSKADIFVTTTGNKDIIMVHHMKQMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET +GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+PEQAAYIS+PVEGPYKP HYR
Sbjct  425   KEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPEQAAYISVPVEGPYKPTHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/481 (92%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPETK  II+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETKAEIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYR
Sbjct  425   NEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 467/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  27    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  86

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  87    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  146

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  147   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  206

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  207   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYGC  266

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  267   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  326

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  327   GLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  386

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  387   GVKRITIKPQTDRWVFPDTKSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  446

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYR
Sbjct  447   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYR  506

Query  1535  Y  1537
             Y
Sbjct  507   Y  507



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP +Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPTRYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YP
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL LW
Sbjct  365   GVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLGLW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK+ GKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYR
Sbjct  425   KEKSIGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGS HMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSFHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEV WCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVPWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDW PGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWSPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHG ET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGPETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTL FPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLPFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPVTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGLSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKV+VLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVHVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLL PAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLLPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGL RATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLTRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/482 (92%), Positives = 463/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLEL+LAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRD
Sbjct  124   CLDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK D  KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDAHKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG+Q+LTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETY
Sbjct  304   EGIQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  Y
Sbjct  424   WNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAAY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGR YKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGRAYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGILVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LD GPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDRGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             G KRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GAKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPG M+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGSMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTT VKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTVVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGR YKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGRGYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPKKYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLE+VVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLENVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GV+RITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVRRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+L LGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLRLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEVELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LT+L+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTELSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             V+KT++GREYKVKDMSQADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VDKTTTGREYKVKDMSQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARD AAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAATIARDCAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGD TLLIHEGVKAEEE+  +GT+PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDTTLLIHEGVKAEEEFKTSGTMPDPNSTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP KYT+MKER+VGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPTKYTKMKERIVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVFGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV+SEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVK+ITIKPQTDR+VFP+T +GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKKITIKPQTDRWVFPDTNSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPLHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125   LDWGPSGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L++DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LRSDPMKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLTLEDVASEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK + KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKTSSKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGA VIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGASVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y  MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHEMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV CGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVACGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VLTII++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVLTIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP +YT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLRYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVL LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLPLEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYR
Sbjct  425   NERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G  PDP STDN EFQ+VLTII+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKFPDPHSTDNVEFQLVLTIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVL LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLPLEDVVSEIDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK +GKYEKKVYVLPKHLDEKVAALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   KEKASGKYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/481 (92%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT++GRE KVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTAAGRENKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DPK+Y +MKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPKRYHKMKERLVGVSEETTTGVKRLYQMQSSGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLED VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE  P
Sbjct  305   GLQVLTLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENCP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYR
Sbjct  425   NERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP+QPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPAQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTS GREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5     VEKTSGGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MK RLVGVSEETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKGRLVGVSEETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA+ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAMME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKPPHYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVLQIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLED+VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GFQVLTLEDIVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P++GPYKPPHYR
Sbjct  425   KEKGTGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIDGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPGHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/481 (92%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQA+ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVVVVCGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAMME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP++K+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDSKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDS TKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSATKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDL VDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLTVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGH DNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHLDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDA LLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDAALLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFD+EIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDSEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSEDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDG MRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGFMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G  PDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGASPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DPKKY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPKKYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVISEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++P+EGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPIEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQAL E
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALTE  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSC FTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCLFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ  GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQIDGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIA KVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIASKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFT+QVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTDQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDS TKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSATKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIM  HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMADHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL LW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLVLW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYV PKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVSPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/482 (91%), Positives = 464/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII+D
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPTSTDNAEFQIVLTIIKD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK+DP +Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKSDPTRYRKMKQRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVS+ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGLQVLTLEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+ VEGPYKP HY
Sbjct  424   WNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVAVEGPYKPTHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G  PDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQFPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             V+KT++GREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  81    VDKTTTGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  140

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  141   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  200

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTIIRDG
Sbjct  201   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKIPDPASTDNAEFQIVLTIIRDG  260

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKY +M++RLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  261   LKTDPKKYRKMRDRLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGC  320

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  321   RHSLPDGLMRATDVMIAGKVAVVLGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  380

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLED V+EADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM+GLET+P
Sbjct  381   GLQVLTLEDCVAEADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMNGLETFP  440

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  441   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  500

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP  YR
Sbjct  501   NERASGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAQYR  560

Query  1535  Y  1537
             Y
Sbjct  561   Y  561



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINV+DSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVSDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLH T
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHTT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPG GPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGAGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQEAGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQA+ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVVVVCGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAMME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR+E+GPSQPFKGARI+GSLHMT
Sbjct  5     VEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRSEYGPSQPFKGARISGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             L+WGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRD 
Sbjct  125   LEWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLIRDS  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK +PKKY +MKERLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVNPKKYHKMKERLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ VLTLEDVVSEADIFVTTTGNKDI+MV HM+KMKNNAIVCNIGHFDNEIDMHGLE +P
Sbjct  305   GIPVLTLEDVVSEADIFVTTTGNKDILMVGHMRKMKNNAIVCNIGHFDNEIDMHGLENFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YI++P+EGPYKP HYR
Sbjct  425   KERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYINVPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLF AINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFLAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G  PDP+STDN EFQ+VLTII+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKFPDPNSTDNVEFQLVLTIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVL LEDVVS  DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLPLEDVVSGIDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGILVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK +GKYEKKVYVLPKHLDEKVAALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   KEKASGKYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQA+ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVVVVCGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAMME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/482 (91%), Positives = 465/482 (96%), Gaps = 1/482 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA+ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAMME  304

Query  995   GLQVLTLE-DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             GLQVLTLE DVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+
Sbjct  305   GLQVLTLEDDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETF  364

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  365   PGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  424

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HY
Sbjct  425   WNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHY  484

Query  1532  RY  1537
             RY
Sbjct  485   RY  486



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDS TKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSATKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCG+GDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGHGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GV+RITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVRRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEET TGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETATGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNE+DM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEVDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGH SFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHSSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGTVPDPSSTDN EFQ+VL II++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPSSTDNVEFQLVLGIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP +YT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPLRYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA + GYGDVGKGCAAA+KQAGARVIV+EIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAFIAGYGDVGKGCAAAMKQAGARVIVSEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVL LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLPLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +G+I+LAEGRLMNLGCA GHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGVIVLAEGRLMNLGCAAGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVL ETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLTETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL LW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLVLW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCS NIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSRNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C AEFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVAEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT PDP+STDN EFQIVL IIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVLAIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV+ EADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVLPEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAGVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVT TGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTATGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKV+DMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVEDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K+AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKRAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTG+KDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGSKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/482 (92%), Positives = 461/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWW TER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWGTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K G VP+P STDNAEF+IVLTIIRD
Sbjct  124   CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKVPNPDSTDNAEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK+DP KY +MKERLVG S  TTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKSDPSKYRKMKERLVGGSAGTTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  QA YIS+PVEGPYKP HY
Sbjct  424   WNEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 457/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNGT+PDP+STDN EFQ+VL +IRD 
Sbjct  125   LDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVLGLIRDS  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPKRYHKMKTRLVGVSEETTTGVKRLYQMQATGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G Q+LTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YP
Sbjct  305   GFQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDRFVFPET TGII+LAEGRLM LGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRFVFPETNTGIIVLAEGRLMKLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/482 (90%), Positives = 461/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGA+ITGSLHM
Sbjct  6     SVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGAKITGSLHM  65

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  66    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  125

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VL +I++
Sbjct  126   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKIPDPTSTDNVEFQLVLGLIKE  185

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
              LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  186   SLKVDPKRYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  245

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQALM
Sbjct  246   CRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQALM  305

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG Q+LTLEDV++E DIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETY
Sbjct  306   EGFQILTLEDVLAEGDIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETY  365

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PG+KRITIKPQTDRFVFPETK+G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  366   PGIKRITIKPQTDRFVFPETKSGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  425

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT +Q+ Y+SIPVEGPYKP HY
Sbjct  426   WNEKASGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLTKDQSDYLSIPVEGPYKPAHY  485

Query  1532  RY  1537
             RY
Sbjct  486   RY  487



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 459/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDN EFQIVL +IRD 
Sbjct  125   LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPTSTDNVEFQIVLGLIRDS  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             +K +P KY RMKERLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   IKVNPSKYRRMKERLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ V TL+DVVSEADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct  305   GIPVRTLKDVVSEADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMHGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYR
Sbjct  425   KERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAE EMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEAEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKQRLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/482 (91%), Positives = 458/482 (95%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             TVEKT++GREYKVKD+SQADFGRLE+ELAE+EMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4     TVEKTTAGREYKVKDLSQADFGRLEIELAEIEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGEVPDPSSTDNVEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DP++Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPQRYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAVALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG QVLTLEDVVS ADIFVTTTGNKDIIMV  MKKMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGFQVLTLEDVVSYADIFVTTTGNKDIIMVDDMKKMKNNAIVCNIGHFDNEIDMSGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR++FPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWLFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+IT SLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITDSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKR YQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRSYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTL DVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLVDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/482 (91%), Positives = 461/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+ QADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4     SVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
              LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRD
Sbjct  124   CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK D  KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDASKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG+Q+LTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETY
Sbjct  304   EGIQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIP+EGPYK   Y
Sbjct  424   WNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPIEGPYKLRLY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/482 (90%), Positives = 464/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK SSGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKHSSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRVEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDP+STDNAEFQIVL+II++
Sbjct  124   ALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIFEKTGQLPDPTSTDNAEFQIVLSIIKE  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ SG+LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYRKMKDRIVGVSEETTTGVKRLYQMQNSGSLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL +EDVVS+ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDMHGLET+
Sbjct  304   EGLQVLPIEDVVSDADIFVTTTGNKDIIMLEHMRKMKNNAIVCNIGHFDNEIDMHGLETF  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGV+RITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVQRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+P+EGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPIEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEAIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR+EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRSEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLI DDGGDA++LIHEGVKAEEE+AKNGTVPDP ST N +FQIVLTIIRDG
Sbjct  125   LDWGPSGGPDLIFDDGGDASMLIHEGVKAEEEFAKNGTVPDPHSTTNPDFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP++Y ++K+RLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPQRYHKIKDRLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVS ADIFVTTTGNKD+IMVS MK+MKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSVADIFVTTTGNKDVIMVSDMKRMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT EQA YIS+P+EGPYKP  YR
Sbjct  425   NEKASGKYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISVPIEGPYKPAAYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/482 (91%), Positives = 457/482 (95%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             TVEKT +GREYKV+D+SQADFGRLE+ELAE+EMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4     TVEKTQAGREYKVRDLSQADFGRLEIELAEIEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDNAEFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGEVPDPSSTDNAEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPKRYRKMKDRLVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKV VV GYGDVGKGCA ALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVGVVAGYGDVGKGCAVALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG QVLTL+DVVS ADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGFQVLTLDDVVSYADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMSGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKR+TIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRVTIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_006848518.1| PREDICTED: adenosylhomocysteinase 1 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/481 (91%), Positives = 460/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+ST N EFQIVL II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTTNPEFQIVLGIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LKADPKKY +MK+RLVGVSEETTTGVKRLYQM  +GTLLF AINVNDSVTKSKFDNLYGC
Sbjct  185   LKADPKKYHKMKDRLVGVSEETTTGVKRLYQMHANGTLLFSAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ VLTLEDVVSEADIFVT TGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GIPVLTLEDVVSEADIFVTATGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKR TIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRNTIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKY+K+VYVLPKHLDEKVA+LHLGKLGA LTKL+P+QA YI++P+EGPYKPP YR
Sbjct  425   KEKGTGKYQKQVYVLPKHLDEKVASLHLGKLGAHLTKLSPDQAEYINVPIEGPYKPPQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/482 (90%), Positives = 461/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTER
Sbjct  64    TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVL+IIRD
Sbjct  124   ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK+DP KY +MK+RLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKSDPMKYHKMKDRLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA M
Sbjct  244   CRHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL LEDVVSE DIFVTTTGNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLPLEDVVSEVDIFVTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFP+T  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HY
Sbjct  424   WNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/481 (91%), Positives = 459/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+E+GPSQP KGARI+GSLHMT
Sbjct  5     VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEYGPSQPLKGARISGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTE+ 
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTEQC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRD 
Sbjct  125   LDWGAAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLIRDS  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPKKY +MKERLVGVSEETTTGVKRLYQMQ SG LL PAINVNDSVTKSKFDNLYGC
Sbjct  185   LKVDPKKYHKMKERLVGVSEETTTGVKRLYQMQASGALLIPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVI+TEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIITEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ V+TLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE YP
Sbjct  305   GIPVITLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLENYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYR
Sbjct  425   KERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII  G
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYDKTGAVPDPASTDNAEFQIVLTIITHG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +M ERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMVERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/475 (92%), Positives = 458/475 (96%), Gaps = 0/475 (0%)
 Frame = +2

Query  113   GREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVL  292
             G  +KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMTIQTAVL
Sbjct  41    GGSFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVL  100

Query  293   IETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPG  472
             IETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG G
Sbjct  101   IETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVG  160

Query  473   GGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPK  652
             GGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTIIRDGLK+DP 
Sbjct  161   GGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTIIRDGLKSDPS  220

Query  653   KYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPD  832
             KY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPD
Sbjct  221   KYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPD  280

Query  833   GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT  1012
             GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT
Sbjct  281   GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT  340

Query  1013  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  1192
             LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  341   LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  400

Query  1193  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  1372
             IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  401   IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  460

Query  1373  KYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  461   KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  515



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/482 (91%), Positives = 463/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             TVEKT+SGREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4     TVEKTTSGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+G +PDP+STDNAEFQIVL+II++
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGKLPDPTSTDNAEFQIVLSIIKE  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GL  DP KY +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLSTDPLKYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPICALQA M
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIVTEIDPICALQATM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDVVSEADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPETK+G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETKSGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK TGKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP  Y
Sbjct  424   WNEKGTGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYLSIPIEGPYKPAAY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPK LDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKRLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/481 (90%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDM+QADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMTQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G  PDP+S+DNAEFQIVL+IIRDG
Sbjct  125   LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIFEKTGQFPDPASSDNAEFQIVLSIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKDRIVGVSEETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETCP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRI IKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRINIKPQTDRWVFPDTKRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK +GKYEKKVYVLPKHLDEKVA+LHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   KEKGSGKYEKKVYVLPKHLDEKVASLHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFG LE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGGLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF  +GETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFRVEGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLI+EGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIYEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/482 (92%), Positives = 459/482 (95%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQP KGARITGSLHM
Sbjct  4     SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPLKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGASVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDPSST+NAEFQIVL IIRD
Sbjct  124   ALDWGSEGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTENAEFQIVLGIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DPKKY +MK RLVGVSEETTTGVKRLYQMQ +GTLLF AINVNDSVTKSKFDNLYG
Sbjct  184   GLKVDPKKYHKMKGRLVGVSEETTTGVKRLYQMQANGTLLFSAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKSAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG+ VLTLEDVVS+ADIFVTTTGNKDII+V HMKKMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EGIPVLTLEDVVSKADIFVTTTGNKDIIIVDHMKKMKNNAIVCNIGHFDNEIDMLGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKR+TIKPQTDR++FPE +TGIIILAEGRL NLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRVTIKPQTDRWIFPENETGIIILAEGRLTNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QAAYI++PVEGPYKPPHY
Sbjct  424   WKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSGQAAYINVPVEGPYKPPHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125   LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQ LTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQDLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI+ PVEGPYKP  YR
Sbjct  425   NERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINAPVEGPYKPAQYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  8     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  67

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  68    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  127

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL+II++G
Sbjct  128   LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEG  187

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  188   LKTDPKRYHKMKDRVVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  247

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  248   RHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  307

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  308   GLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHP  367

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  368   GVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  427

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  428   NEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYR  487

Query  1535  Y  1537
             Y
Sbjct  488   Y  488



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKDRVVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/481 (91%), Positives = 458/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5     VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             L+WG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDP+STDNAEFQIVL +IRD 
Sbjct  125   LEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVLGLIRDS  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L  DPKKY RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LSVDPKKYRRMKERLVGVSEETTTGVKRLYQMQYSGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVG GCAAALK AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGLGCAAALKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GL VL LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE++P
Sbjct  305   GLPVLRLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLESFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR VFP+T +GI++LAEGRLMNLGCATGHPSFVMS SFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRRVFPDTNSGILVLAEGRLMNLGCATGHPSFVMSSSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYR
Sbjct  425   KERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/481 (90%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT+PDP+STDN EFQIVL II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVLAIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/481 (91%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPF GARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFTGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             R SLPDGLMRATDVMIAGKVAV+ GYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RPSLPDGLMRATDVMIAGKVAVIWGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/481 (90%), Positives = 460/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G  PDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGVFPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYR
Sbjct  425   NEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/481 (91%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLI DDGGDATLLIHEGVKAEE +AK G +PDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIGDDGGDATLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP  YR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVSYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/480 (90%), Positives = 458/480 (95%), Gaps = 0/480 (0%)
 Frame = +2

Query  98    EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
             EKT SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6     EKTVSGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278   QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
             QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66    QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  637
             DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP+ST N EFQ+VL +I+D +
Sbjct  126   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPASTTNLEFQMVLGLIKDSI  185

Query  638   KADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCR  817
             K DP +Y +MK+RLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct  186   KVDPLRYHKMKDRLVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCR  245

Query  818   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEG  997
             HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQALMEG
Sbjct  246   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIVTEIDPICALQALMEG  305

Query  998   LQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPG  1177
             L VLT+EDVVS ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PG
Sbjct  306   LPVLTIEDVVSTADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPG  365

Query  1178  VKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK  1357
             VK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 
Sbjct  366   VKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWN  425

Query  1358  EKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             EK +GKYEKKVYVLPKHLDEKVAALHL KLGA LTKL+PEQAAYI++PVEGPYKP HYRY
Sbjct  426   EKKSGKYEKKVYVLPKHLDEKVAALHLPKLGAHLTKLSPEQAAYINVPVEGPYKPAHYRY  485



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/481 (90%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT+PDP+STDN EFQIVL II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVLAIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L  DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LPVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/481 (90%), Positives = 462/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT PDP+STDN EFQIVL II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVLAIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+QVLTLEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GIQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/481 (90%), Positives = 456/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT++GREYKVKD+SQADFGRLE+ELAE+EMPGL++ R EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTNTGREYKVKDLSQADFGRLEIELAEIEMPGLISSRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G VPDPSSTDNAEFQIVL+IIR+G
Sbjct  125   LDWGPGGGPDLIVDDGGDVTLLIHEGVKAEELFEKTGEVPDPSSTDNAEFQIVLSIIREG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP++Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPQRYRKMKQRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAVALKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTLEDVVS ADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM GLE YP
Sbjct  305   GFQVLTLEDVVSIADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMAGLENYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+N+GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+  QA YIS+PVEGPYKP HYR
Sbjct  425   NERNSGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLSQSQADYISVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/482 (90%), Positives = 460/482 (95%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHM
Sbjct  4     SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGE LQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGENLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWG GGGPDLIVDDGGDATLLIHEGVKAE+E+ KNGT+PDPSST N EFQIVL I+++
Sbjct  124   ALDWGVGGGPDLIVDDGGDATLLIHEGVKAEKEFEKNGTLPDPSSTTNQEFQIVLGILKE  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GL+ DPK+Y +M ERLVGVSEETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLQVDPKRYHKMMERLVGVSEETTTGVKRLYQMQSNGSLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCA+A+K AGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCASAMKAAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGL+VLTLEDVVS ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGLEVLTLEDVVSVADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPETGTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QAAYI++PVEGPYKP HY
Sbjct  424   WNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSADQAAYINVPVEGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/480 (90%), Positives = 456/480 (95%), Gaps = 0/480 (0%)
 Frame = +2

Query  98    EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
             EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6     EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278   QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
             QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66    QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  637
             DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  638   KADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCR  817
             K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct  186   KVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCR  245

Query  818   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEG  997
             HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQALMEG
Sbjct  246   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIVTEIDPICALQALMEG  305

Query  998   LQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPG  1177
             L VLTLEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PG
Sbjct  306   LPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPG  365

Query  1178  VKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK  1357
             VK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 
Sbjct  366   VKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWN  425

Query  1358  EKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  426   ERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/481 (90%), Positives = 460/481 (96%), Gaps = 1/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VLTII++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVLTIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP +YT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLRYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVL LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLPLEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITI    DR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIS-SNDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  423

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYR
Sbjct  424   NERSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYR  483

Query  1535  Y  1537
             Y
Sbjct  484   Y  484



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/481 (90%), Positives = 458/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMS ADFGR+E+ELAEVEMPGL++CR EFG SQPFKG RITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSLADFGRMEIELAEVEMPGLISCRTEFGSSQPFKGTRITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGD TLLIHEGVKAE+ + K G  PDPSS+DNAEFQIVL+II++G
Sbjct  125   LDWGPDGGPDLIVDDGGDTTLLIHEGVKAEQVFEKTGQSPDPSSSDNAEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK+DPKKY +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKSDPKKYHKMKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA+ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAMME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTL+DVVS ADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLDDVVSVADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKR  IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRTNIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KEK TGKYEKKVYVLPKHLDEKVA+LHLG+LGAKLTKLT EQA YIS+PVEGPYKP HYR
Sbjct  425   KEKGTGKYEKKVYVLPKHLDEKVASLHLGQLGAKLTKLTKEQADYISVPVEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/480 (89%), Positives = 456/480 (95%), Gaps = 0/480 (0%)
 Frame = +2

Query  98    EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
             EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6     EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  278   QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
             QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66    QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  637
             DWGPGGGPDLIVDDGGD TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL +I++ L
Sbjct  126   DWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVLALIKESL  185

Query  638   KADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCR  817
             K DP +Y RMK+R+VGVSEETTTGVKRLYQMQ SG+LLFPAINVNDSVTKSKFDNLYGCR
Sbjct  186   KVDPLRYHRMKDRIVGVSEETTTGVKRLYQMQNSGSLLFPAINVNDSVTKSKFDNLYGCR  245

Query  818   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEG  997
             HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQALMEG
Sbjct  246   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKVAGARVIVTEIDPICALQALMEG  305

Query  998   LQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPG  1177
             L VLTLEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEID+ GLE +PG
Sbjct  306   LPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDIQGLENFPG  365

Query  1178  VKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK  1357
             VK+ITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 
Sbjct  366   VKKITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWN  425

Query  1358  EKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  426   ERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/480 (89%), Positives = 456/480 (95%), Gaps = 0/480 (0%)
 Frame = +2

Query  98    EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
             EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6     EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  278   QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
             QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66    QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  637
             DWGPGGGPDLIVDDGGD TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL +I++ L
Sbjct  126   DWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVLALIKESL  185

Query  638   KADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCR  817
             K DP +Y RMK+R+VGVSEETTTGVKRLYQMQ SG+LLFPAINVNDSVTKSKFDNLYGCR
Sbjct  186   KVDPLRYHRMKDRIVGVSEETTTGVKRLYQMQNSGSLLFPAINVNDSVTKSKFDNLYGCR  245

Query  818   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEG  997
             HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQALMEG
Sbjct  246   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKVAGARVIVTEIDPICALQALMEG  305

Query  998   LQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPG  1177
             L VLTLEDVVS ADIFVTTTGNKDI+M+ HM+KMKNNAIVCNIGHFDNEID+ GLE +PG
Sbjct  306   LPVLTLEDVVSTADIFVTTTGNKDIVMLDHMRKMKNNAIVCNIGHFDNEIDIQGLENFPG  365

Query  1178  VKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK  1357
             VK+ITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 
Sbjct  366   VKKITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWN  425

Query  1358  EKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  426   ERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/480 (90%), Positives = 456/480 (95%), Gaps = 0/480 (0%)
 Frame = +2

Query  98    EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
             EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6     EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278   QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
             QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66    QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  637
             DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  638   KADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCR  817
             K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct  186   KVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCR  245

Query  818   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEG  997
             HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGC+AALK AGARVIVTEIDPICALQALMEG
Sbjct  246   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCSAALKVAGARVIVTEIDPICALQALMEG  305

Query  998   LQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPG  1177
             L VLTLEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PG
Sbjct  306   LPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPG  365

Query  1178  VKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK  1357
             VK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 
Sbjct  366   VKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWN  425

Query  1358  EKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  426   ERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/480 (90%), Positives = 455/480 (95%), Gaps = 0/480 (0%)
 Frame = +2

Query  98    EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
             EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6     EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278   QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
             QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66    QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  637
             DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  638   KADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCR  817
             K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPA NVNDSVTKSKFDNLYGCR
Sbjct  186   KVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPATNVNDSVTKSKFDNLYGCR  245

Query  818   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEG  997
             HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQALMEG
Sbjct  246   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIVTEIDPICALQALMEG  305

Query  998   LQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPG  1177
             L VLTLEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PG
Sbjct  306   LPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPG  365

Query  1178  VKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK  1357
             VK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 
Sbjct  366   VKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWN  425

Query  1358  EKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  426   ERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/480 (89%), Positives = 456/480 (95%), Gaps = 0/480 (0%)
 Frame = +2

Query  98    EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
             EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6     EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278   QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
             QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66    QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  637
             DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  638   KADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCR  817
             K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct  186   KVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCR  245

Query  818   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEG  997
             HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGC+AALK AGARVIVTEIDPICALQALMEG
Sbjct  246   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCSAALKVAGARVIVTEIDPICALQALMEG  305

Query  998   LQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPG  1177
             L VLTLEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PG
Sbjct  306   LPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPG  365

Query  1178  VKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK  1357
             VK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 
Sbjct  366   VKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWN  425

Query  1358  EKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++P+EGPYKP HYRY
Sbjct  426   ERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPIEGPYKPAHYRY  485



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/480 (89%), Positives = 456/480 (95%), Gaps = 0/480 (0%)
 Frame = +2

Query  98    EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
             EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6     EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278   QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
             QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66    QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458   DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  637
             DWGPGGGPDLIV+DGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126   DWGPGGGPDLIVNDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  638   KADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCR  817
             K DP +Y RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct  186   KVDPLRYHRMKERLVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCR  245

Query  818   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEG  997
             HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQALMEG
Sbjct  246   HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIVTEIDPICALQALMEG  305

Query  998   LQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPG  1177
             L VLTLEDVVS ADIFVTTTGNKDIIM+ HM+K+KNNAIVCNIGHFDNEIDM GLET+PG
Sbjct  306   LPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKIKNNAIVCNIGHFDNEIDMQGLETFPG  365

Query  1178  VKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK  1357
             VK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 
Sbjct  366   VKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWN  425

Query  1358  EKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  426   ERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/481 (90%), Positives = 457/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GPSQPFKGA+ITGSLHMT
Sbjct  5     VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K GT+PDPSST N+E QIV TIIRDG
Sbjct  125   LDWGPEGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVFTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA ALKQ GARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAFALKQGGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTL DVVSEADIFVTTTGNKDIIMVS M+KMKNNAIV NIGHFDNEIDM+GLET+P
Sbjct  305   GFQVLTLNDVVSEADIFVTTTGNKDIIMVSDMRKMKNNAIVSNIGHFDNEIDMNGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
              VKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   DVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYR
Sbjct  425   NERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/481 (90%), Positives = 456/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5     VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y K GT+PDPSST N+E QIV TIIRDG
Sbjct  125   LDWGPEGGPDLIVDDGGDVTLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVFTIIRDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DPK+Y +MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPKRYHKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA ALKQ GARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAFALKQGGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QVLTL DVVSEADIFVTTTGNKDIIMVS M+KMKNNAIV NIGHFDNEIDMHGLET+P
Sbjct  305   GFQVLTLNDVVSEADIFVTTTGNKDIIMVSDMRKMKNNAIVSNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
              VKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   DVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYR
Sbjct  425   NERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/481 (89%), Positives = 457/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQP KGA+IT SLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAFLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGTVPDP+STDN EFQ+VLTII++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPTSTDNVEFQLVLTIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP +YT+MKERLVGVSEETTTGVK+LYQM  +G+LLF  INVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPLRYTKMKERLVGVSEETTTGVKKLYQMPANGSLLFLPINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVL LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct  305   GLQVLFLEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+++GKYEKKVYVLPKHLDEKVAALHLGK GAKLTKLT +QA YI +PVEGPYKP HYR
Sbjct  425   NERSSGKYEKKVYVLPKHLDEKVAALHLGKFGAKLTKLTKDQADYIYVPVEGPYKPAHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/467 (91%), Positives = 448/467 (96%), Gaps = 0/467 (0%)
 Frame = +2

Query  137   MSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  316
             MSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMTIQTAVLIETLTALG
Sbjct  1     MSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  60

Query  317   AEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVD  496
             A+VRWCSCNIFSTQDHA AA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  61    AQVRWCSCNIFSTQDHARAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120

Query  497   DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKER  676
             DGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKER
Sbjct  121   DGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKER  180

Query  677   LVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDV  856
             LVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDV
Sbjct  181   LVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDV  240

Query  857   MIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA  1036
             MIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA
Sbjct  241   MIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA  300

Query  1037  DIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRF  1216
             DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+
Sbjct  301   DIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRW  360

Query  1217  VFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYV  1396
             VFPETK GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYV
Sbjct  361   VFPETKAGIIVLAQGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYV  420

Query  1397  LPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             LPKHLDEKVA LHLGKLGA+L KL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  421   LPKHLDEKVALLHLGKLGARLRKLSKDQSDYVSIPIEGPYKPPHYRY  467



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/443 (93%), Positives = 430/443 (97%), Gaps = 0/443 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA+ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAMME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKV  1423
              EK++GKYEKKVYVLPKHLDEKV
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKV  447



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/443 (93%), Positives = 430/443 (97%), Gaps = 0/443 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKV  1423
              EK++GKYEKKVYVLPKHLDEKV
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKV  447



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/443 (92%), Positives = 429/443 (97%), Gaps = 0/443 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA+ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAMME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKV  1423
              EK++GKYEKKVYVLPKHLDEKV
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKV  447



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/444 (92%), Positives = 432/444 (97%), Gaps = 0/444 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DP++Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPQRYHKMKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL L+DVVSEADIFVTTTGNKDIIMV  MKKMKNNAIVCNIGHFDNEIDMHGLE +
Sbjct  304   EGLQVLPLQDVVSEADIFVTTTGNKDIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLENF  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKV  1423
             WKEK++GKY+K+VYVLPKHLDEKV
Sbjct  424   WKEKSSGKYKKEVYVLPKHLDEKV  447



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/443 (92%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA+ME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAMME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMS  FTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSYPFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKV  1423
              EK++GKYEKKVYVLPKHLDEKV
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKV  447



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/482 (87%), Positives = 453/482 (94%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4     SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+RD
Sbjct  124   ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVLTILRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             G+K +P KY +M ERLVGVSEETTTGVKRLYQM ++G+LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GMKENPNKYHKMAERLVGVSEETTTGVKRLYQMMDNGSLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCA+A+K AGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCASAMKAAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG QVL LED V  ADIF TTTGNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGYQVLRLEDCVEYADIFCTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFP+TK G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPDTKRGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK +GKYEKKVYVLPKHLDEKVA LHL KLGA+LTKL+ +QA+YI++PV GPYKP HY
Sbjct  424   WNEKKSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSEDQASYINVPVGGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/452 (94%), Positives = 438/452 (97%), Gaps = 0/452 (0%)
 Frame = +2

Query  182   VEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQD  361
             VEMPGLMACRAEFGP+QPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQD
Sbjct  5     VEMPGLMACRAEFGPAQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQD  64

Query  362   HaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKA  541
             HAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDATLLIHEGVKA
Sbjct  65    HAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDATLLIHEGVKA  124

Query  542   EEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRL  721
             EE Y K G +PDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRL
Sbjct  125   EEVYEKTGQLPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRL  184

Query  722   YQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDV  901
             YQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDV
Sbjct  185   YQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDV  244

Query  902   GKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMV  1081
             GKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL DVVSEADIFVTTTGNKDIIMV
Sbjct  245   GKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLGDVVSEADIFVTTTGNKDIIMV  304

Query  1082  SHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEG  1261
             +HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEG
Sbjct  305   NHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEG  364

Query  1262  RLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlg  1441
             RLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLG
Sbjct  365   RLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLG  424

Query  1442  klgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             KLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  425   KLGANLTKLTKDQADYISVPIEGPYKPPHYRY  456



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/482 (87%), Positives = 454/482 (94%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4     SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+RD
Sbjct  124   ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDAYAKDGTLPDPESTTNAEFKIVLTILRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             G+K +P+KY +M ERLVGVSEETTTGVKRLYQM ++G+LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GMKENPQKYHKMAERLVGVSEETTTGVKRLYQMMDNGSLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCA+A+K AGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCASAMKAAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG QVL LED V  ADIF TTTGNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLET+
Sbjct  304   EGYQVLRLEDCVEYADIFCTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLETF  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFP+TK G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPDTKRGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W E+ +GKYEKKVYVLPKHLDEKVA LHL KLGA+LTKL+ +QA+YI++PV GPYKP HY
Sbjct  424   WNERTSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSDDQASYINVPVGGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/482 (89%), Positives = 466/482 (97%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             TV +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4     TVSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTE+
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTEK  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEG KAEEEY ++G +P+P+ T+NAEF+IVL+II++
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGAKAEEEYERSGKLPNPNETENAEFRIVLSIIKE  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GL  DPK+YTRMK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLLIDPKRYTRMKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKAAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG+ VLTLED+V+EADIFVTTTGNKDIIMVSHMK+MKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGIPVLTLEDMVAEADIFVTTTGNKDIIMVSHMKQMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PG+KRITIKPQTDR++FPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGIKRITIKPQTDRWIFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKE+ +GKYEKKVYVLPKHLDEKVA+LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHY
Sbjct  424   WKERGSGKYEKKVYVLPKHLDEKVASLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/481 (88%), Positives = 453/481 (94%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5     VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+GTVPDP+STDN EFQ+VL II++ 
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKDGTVPDPTSTDNVEFQLVLGIIKES  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             LK DP K+T+MKERLVGVSEETTTGVKRL + +          NVNDSVTKSKFDNLYGC
Sbjct  185   LKTDPTKHTKMKERLVGVSEETTTGVKRLTRCKLMELCFSQLPNVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCA +LKQAGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAMSLKQAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVV++ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVADADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPS VMSCSFTNQVIAQLELW
Sbjct  365   GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSVVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYR
Sbjct  425   NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPVHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/482 (87%), Positives = 452/482 (94%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4     SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLI+TLT LGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIDTLTDLGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+RD
Sbjct  124   ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVLTILRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             G+K +P KY +M ERLVGVSEETTTGVKRLYQM ++G+LLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GMKENPNKYHKMAERLVGVSEETTTGVKRLYQMMDNGSLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCA+A+K AGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCASAMKAAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG QVL LED V  ADIF TTTGNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGYQVLRLEDCVEYADIFCTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFP+TK G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFPDTKRGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK +GKYEKKVYVLPKHLDEKVA LHL KLGA+LTKL+ +QA+YI++PV GPYKP HY
Sbjct  424   WNEKKSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSEDQASYINVPVGGPYKPAHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/482 (88%), Positives = 450/482 (93%), Gaps = 18/482 (4%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK DP++Y +MK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKTDPQRYHKMKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATD                  GCAAALKQAGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATD------------------GCAAALKQAGARVIVTEIDPICALQALM  285

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVL L+DVVSEADIFVTTTGNKDIIMV  MKKMKNNAIVCNIGHFDNEIDMHGLE +
Sbjct  286   EGLQVLPLQDVVSEADIFVTTTGNKDIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLENF  345

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  346   PGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  405

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK++GKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHY
Sbjct  406   WKEKSSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHY  465

Query  1532  RY  1537
             RY
Sbjct  466   RY  467



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/450 (92%), Positives = 436/450 (97%), Gaps = 0/450 (0%)
 Frame = +2

Query  188   MPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHa  367
             MPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHA
Sbjct  1     MPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHA  60

Query  368   aaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE  547
             AAA+ARDS AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE
Sbjct  61    AAAIARDSRAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE  120

Query  548   EYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQ  727
             EYAK+G +PDPSSTDNAEFQ+VLTIIRDGLK DP KYT+MKERLVGVSEETTTGVKRLYQ
Sbjct  121   EYAKSGKLPDPSSTDNAEFQLVLTIIRDGLKTDPLKYTKMKERLVGVSEETTTGVKRLYQ  180

Query  728   MQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK  907
             MQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGK
Sbjct  181   MQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGK  240

Query  908   GCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSH  1087
             GCAAALKQAGARVIVTEIDPICALQA MEGLQVLTLEDVVS+ DIFVTTTGNKDIIMV H
Sbjct  241   GCAAALKQAGARVIVTEIDPICALQATMEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDH  300

Query  1088  MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRL  1267
             M+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRL
Sbjct  301   MRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRL  360

Query  1268  MNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgkl  1447
             MNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKL
Sbjct  361   MNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKL  420

Query  1448  gakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             GA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  421   GARLTKLSKDQADYISVPVEGPYKPPHYRY  450



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/481 (88%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             V +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHMT
Sbjct  5     VSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKEARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETL+EYWWCTE+A
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLEEYWWCTEKA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             L+WGPGGGPDLIVDDGGDATLLIHEGVKAE EY ++G +P+P+ T+NAEFQIVL+II++G
Sbjct  125   LEWGPGGGPDLIVDDGGDATLLIHEGVKAEGEYERSGKLPNPNETENAEFQIVLSIIKEG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L  DPK+YTRMK+RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LLIDPKRYTRMKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKAAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G+ VLTLED+V+EADIFVTTTGNKDIIMVSHMK+MKNNA+VCNIGHFDNEIDM GLETYP
Sbjct  305   GIPVLTLEDMVAEADIFVTTTGNKDIIMVSHMKQMKNNAVVCNIGHFDNEIDMLGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             G+KRITIKPQTDR++FPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  365   GIKRITIKPQTDRWIFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  424

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
             KE+ +GKYEKKVYVLPKHLDE V +LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHYR
Sbjct  425   KERGSGKYEKKVYVLPKHLDEMVGSLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHYR  484

Query  1535  Y  1537
             Y
Sbjct  485   Y  485



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/482 (89%), Positives = 462/482 (96%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             T+ +T +GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4     TISRTPTGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGA+VRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETL+EYWWCTE+
Sbjct  64    TIQTAVLIETLTALGAQVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLEEYWWCTEK  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             AL+WGPGGGPDLIVDDGGDATLLIHEGVKAEE Y ++G +P+P+ T+NAEF+IVL+II++
Sbjct  124   ALEWGPGGGPDLIVDDGGDATLLIHEGVKAEEVYERSGKLPNPNETENAEFRIVLSIIKE  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GL  DPKKY RM+ERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLLVDPKKYRRMRERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQALM
Sbjct  244   CRHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKAAGARVIVTEIDPICALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG+ VLTLEDVV+EADIFVTTTGNKDIIMV HMK+MKNNAIVCNIGHFDNEIDM GLETY
Sbjct  304   EGIPVLTLEDVVAEADIFVTTTGNKDIIMVCHMKQMKNNAIVCNIGHFDNEIDMLGLETY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PG+KRITIKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGIKRITIKPQTDRWVFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKPP Y
Sbjct  424   WKERGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPPRY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/450 (93%), Positives = 435/450 (97%), Gaps = 0/450 (0%)
 Frame = +2

Query  188   MPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHa  367
             MPGLMACRAEFGPSQPFKGARI+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHA
Sbjct  1     MPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHA  60

Query  368   aaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE  547
             AAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDATLLIHEGVKAEE
Sbjct  61    AAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDATLLIHEGVKAEE  120

Query  548   EYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQ  727
             E+ K+G VPDP STDNAEF+IVLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKRLYQ
Sbjct  121   EFEKSGKVPDPESTDNAEFKIVLTIIRDGLKSDPSKYRKMKERLVGVSEETTTGVKRLYQ  180

Query  728   MQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK  907
             MQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK
Sbjct  181   MQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK  240

Query  908   GCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSH  1087
             GCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMV H
Sbjct  241   GCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDH  300

Query  1088  MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRL  1267
             M+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRL
Sbjct  301   MRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRL  360

Query  1268  MNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgkl  1447
             MNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKL
Sbjct  361   MNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKL  420

Query  1448  gakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             GA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  421   GARLTKLSKSQADYISVPVEGPYKPAHYRY  450



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/482 (87%), Positives = 448/482 (93%), Gaps = 0/482 (0%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4     SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII+D
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPASTDNAEFQIVLTIIKD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK+DP KY +M ERLVGV EETTTGV++L+QMQ +GTL  PAI VNDSVTKSKFDNLYG
Sbjct  184   GLKSDPTKYRKMNERLVGVLEETTTGVEKLFQMQANGTLFVPAIKVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHS PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K  GARVIVTEIDP CALQALM
Sbjct  244   CRHSSPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKPGGARVIVTEIDPFCALQALM  303

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             E  + LT   + S+ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct  304   EAFRFLTGGCLYSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENY  363

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VF ET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  364   PGVKRITIKPQTDRWVFLETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  423

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+ VEGPYKP HY
Sbjct  424   WNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVAVEGPYKPTHY  483

Query  1532  RY  1537
             RY
Sbjct  484   RY  485



>emb|CAJ01706.1| S-adenosyl-L-homocysteine hydrolase [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/450 (92%), Positives = 431/450 (96%), Gaps = 0/450 (0%)
 Frame = +2

Query  188   MPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHa  367
             MPGLMACR EFGPSQPFKGARI+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHA
Sbjct  1     MPGLMACRTEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHA  60

Query  368   aaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE  547
             AAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDATLLIHEGVKAEE
Sbjct  61    AAAIARDSAAVFAWKGETLEEYWWCTERCLDWGAGGGPDLIVDDGGDATLLIHEGVKAEE  120

Query  548   EYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQ  727
             E+ K+G VPDP STDN EF+IVLTIIRDGLK D  KY +MKERLVGVSEETTTGVKRLYQ
Sbjct  121   EFEKSGKVPDPESTDNPEFKIVLTIIRDGLKTDASKYRKMKERLVGVSEETTTGVKRLYQ  180

Query  728   MQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK  907
             MQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK
Sbjct  181   MQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK  240

Query  908   GCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSH  1087
             GCAAALKQAGARVIVTEIDPICALQALMEG+Q+LTLEDVVSEADIFVTTTGNKDIIMV H
Sbjct  241   GCAAALKQAGARVIVTEIDPICALQALMEGIQILTLEDVVSEADIFVTTTGNKDIIMVDH  300

Query  1088  MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRL  1267
             M+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRL
Sbjct  301   MRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRL  360

Query  1268  MNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgkl  1447
             MNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVAALHLGKL
Sbjct  361   MNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVAALHLGKL  420

Query  1448  gakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             GA+LTKLT  Q+ YISIP+EGPYKP  YRY
Sbjct  421   GARLTKLTKSQSDYISIPIEGPYKPAAYRY  450



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/476 (88%), Positives = 442/476 (93%), Gaps = 18/476 (4%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQ        
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQ--------  416

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKP  1522
                       KVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP
Sbjct  417   ----------KVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKP  462



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/481 (87%), Positives = 440/481 (91%), Gaps = 25/481 (5%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQ        
Sbjct  365   GVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQ--------  416

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
                              HLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYR
Sbjct  417   -----------------HLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR  459

Query  1535  Y  1537
             Y
Sbjct  460   Y  460



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/480 (86%), Positives = 438/480 (91%), Gaps = 25/480 (5%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5     VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCCTEFGPSQPLKGARITGSLHMT  64

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL+II+DG
Sbjct  125   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVLSIIKDG  184

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct  185   LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC  244

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct  245   RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME  304

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct  305   GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFP  364

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             GVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQ        
Sbjct  365   GVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQ--------  416

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
                              HLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYR
Sbjct  417   -----------------HLDEKVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPGHYR  459



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/450 (89%), Positives = 427/450 (95%), Gaps = 0/450 (0%)
 Frame = +2

Query  188   MPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHa  367
             MPGLMACRAEFGP+QPFKGARITGSLHMTIQTAVLIETL ALGAEVRWCSCNIFSTQDHA
Sbjct  1     MPGLMACRAEFGPAQPFKGARITGSLHMTIQTAVLIETLAALGAEVRWCSCNIFSTQDHA  60

Query  368   aaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE  547
             AAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE
Sbjct  61    AAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE  120

Query  548   EYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQ  727
             E+AK G VPDP ST N EFQ+VL +I++ +K DP +Y RMKERLVGVSEETTTGVKRLYQ
Sbjct  121   EFAKTGKVPDPESTTNLEFQMVLGLIKESMKVDPLRYHRMKERLVGVSEETTTGVKRLYQ  180

Query  728   MQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK  907
             MQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK
Sbjct  181   MQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK  240

Query  908   GCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSH  1087
             GC+AALK AGARVIVTEIDPICALQALMEGL VLTLEDVVS ADIFVTTTGNKDIIM+ H
Sbjct  241   GCSAALKVAGARVIVTEIDPICALQALMEGLPVLTLEDVVSTADIFVTTTGNKDIIMLDH  300

Query  1088  MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRL  1267
             M+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII+LAEGRL
Sbjct  301   MRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRL  360

Query  1268  MNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgkl  1447
             MNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KL
Sbjct  361   MNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKL  420

Query  1448  gakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             GA+LTKL+P+QA YI++PV+GPYKP HYRY
Sbjct  421   GARLTKLSPDQAEYINVPVDGPYKPAHYRY  450



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/482 (84%), Positives = 429/482 (89%), Gaps = 40/482 (8%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4     SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64    TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLKADPKKY +MKERLVGVSEETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYG
Sbjct  184   GLKADPKKYHKMKERLVGVSEETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYG  243

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMI                                        ALM
Sbjct  244   CRHSLPDGLMRATDVMI----------------------------------------ALM  263

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EGLQVLTLEDV+S+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETY
Sbjct  264   EGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETY  323

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  324   PGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  383

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             WKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HY
Sbjct  384   WKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHY  443

Query  1532  RY  1537
             RY
Sbjct  444   RY  445



>ref|XP_005843353.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
 gb|EFN51251.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
Length=483

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/481 (81%), Positives = 431/481 (90%), Gaps = 1/481 (0%)
 Frame = +2

Query  95    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
             VEK++SGREYKVKDMSQADFGRLE+E+AE EMPGLMACRAEFG  QPFKGA+I GSLHMT
Sbjct  4     VEKSASGREYKVKDMSQADFGRLEIEMAEAEMPGLMACRAEFGAKQPFKGAKIAGSLHMT  63

Query  275   IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
             IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDSAA FAWKGETL+EYWWCTE+A
Sbjct  64    IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDSAACFAWKGETLEEYWWCTEQA  123

Query  455   LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  634
             L W    G DL+VDDGGDATLLIHEGVKAEE + K+G+ PDP+STDN EFQIVL IIRDG
Sbjct  124   LSWPGSDGADLLVDDGGDATLLIHEGVKAEEAFEKDGSKPDPASTDNPEFQIVLRIIRDG  183

Query  635   LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC  814
             L+ DPKK+ +M  +LVGVSEETTTGVKRLY+M  SGTLLFPAINVNDSVTKSKFDN+YGC
Sbjct  184   LEKDPKKWRKMAAKLVGVSEETTTGVKRLYEMTASGTLLFPAINVNDSVTKSKFDNVYGC  243

Query  815   RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME  994
             RHSLPDG+MRATDVM+AGK A + GYGDVGKGCA+A+K AGAR IV+EIDPICALQA ME
Sbjct  244   RHSLPDGIMRATDVMLAGKTAFIAGYGDVGKGCASAMKAAGARTIVSEIDPICALQAAME  303

Query  995   GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP  1174
             G QV  ++DVVS ADIF+TTTGNKDIIM S M KMKNNAIV NIGHFDNEIDM GL   P
Sbjct  304   GYQVAPMDDVVSTADIFITTTGNKDIIMASDMAKMKNNAIVGNIGHFDNEIDMAGLMAIP  363

Query  1175  GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW  1354
             G+KR  IKPQ DRF+FP+   G+I+LAEGRL+NLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct  364   GMKRQNIKPQVDRFIFPDGH-GVIVLAEGRLLNLGCATGHPSFVMSCSFTNQVIAQLELW  422

Query  1355  KEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYR  1534
              E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLTP+QA YI++P+EGPYKPPHYR
Sbjct  423   NERASGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLTPDQATYINVPIEGPYKPPHYR  482

Query  1535  Y  1537
             Y
Sbjct  483   Y  483



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/423 (94%), Positives = 409/423 (97%), Gaps = 0/423 (0%)
 Frame = +2

Query  269   MTIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTE  448
             MTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTE
Sbjct  1     MTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTE  60

Query  449   RALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIR  628
             RALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIR
Sbjct  61    RALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIR  120

Query  629   DGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLY  808
             DGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLY
Sbjct  121   DGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLY  180

Query  809   GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  988
             GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL
Sbjct  181   GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  240

Query  989   MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLET  1168
             MEGLQVLTL DVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE 
Sbjct  241   MEGLQVLTLGDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLEN  300

Query  1169  YPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  1348
             YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  301   YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  360

Query  1349  LWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPH  1528
             LWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPH
Sbjct  361   LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPH  420

Query  1529  YRY  1537
             YRY
Sbjct  421   YRY  423



>ref|XP_002950429.1| hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis]
 gb|EFJ48630.1| hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis]
Length=483

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/478 (81%), Positives = 431/478 (90%), Gaps = 1/478 (0%)
 Frame = +2

Query  104   TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT  283
             T +GREYKVKD+++A+FGR+E+ELAE EMPGLMACR EFGP+QPFKGA+ITGSLHMTIQT
Sbjct  7     TVNGREYKVKDIAEANFGRIEIELAEAEMPGLMACRTEFGPAQPFKGAKITGSLHMTIQT  66

Query  284   AVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDW  463
             AVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTE+AL W
Sbjct  67    AVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTEQALTW  126

Query  464   GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKA  643
                 GPDL+VDDGGDATLLIHEGVKAE  +AK+GT+PDP STDNAEF+IVL +IRD +K 
Sbjct  127   EGCDGPDLLVDDGGDATLLIHEGVKAEAAFAKDGTLPDPDSTDNAEFKIVLALIRDTIKK  186

Query  644   DPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHS  823
             DP K+TRM  ++VGVSEETTTGVKRLY+MQ SG LLFPAINVNDSVTKSKFDN+YGCRHS
Sbjct  187   DPTKWTRMSTKVVGVSEETTTGVKRLYEMQTSGALLFPAINVNDSVTKSKFDNVYGCRHS  246

Query  824   LPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQ  1003
             LPDG+MRATDVMIAGK A + GYGDVGKGCA+A+K AGARVIV+EIDPICALQA MEG Q
Sbjct  247   LPDGIMRATDVMIAGKTAFIAGYGDVGKGCASAMKAAGARVIVSEIDPICALQACMEGYQ  306

Query  1004  VLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVK  1183
             VL LEDVV   DIFVTTTGNKDIIM  HM KMKNNAIV NIGHFDNE+DM GL  +PG+K
Sbjct  307   VLPLEDVVETVDIFVTTTGNKDIIMAQHMAKMKNNAIVGNIGHFDNEVDMAGLYAFPGIK  366

Query  1184  RITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK  1363
             R  IKPQ DRF+FP+    +IILAEGRL+NLGCATGHPSFVMSCSFTNQVIAQLELW E+
Sbjct  367   RQNIKPQVDRFIFPDGH-AVIILAEGRLLNLGCATGHPSFVMSCSFTNQVIAQLELWNER  425

Query  1364  NTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHYRY  1537
             ++G+YEKKVYVLPKHLDEKVAALHL KLGAKLT+L+PEQA YI++PV+GPYKP HYRY
Sbjct  426   SSGRYEKKVYVLPKHLDEKVAALHLPKLGAKLTRLSPEQATYINVPVDGPYKPLHYRY  483



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/482 (83%), Positives = 419/482 (87%), Gaps = 42/482 (9%)
 Frame = +2

Query  92    TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             +VEKT+SGREYKVKD+SQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  313   SVEKTASGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  372

Query  272   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
             TIQTAVLIETLTALGAE+                                         R
Sbjct  373   TIQTAVLIETLTALGAEL----------------------------------------SR  392

Query  452   ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  631
             A  W  GG P LIVDDGGDATLLIHEGVKAEEE+ ++G VPDP STDN EF+IVLTIIRD
Sbjct  393   A--WAAGGDPALIVDDGGDATLLIHEGVKAEEEFERSGKVPDPDSTDNPEFKIVLTIIRD  450

Query  632   GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  811
             GLK D +KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG
Sbjct  451   GLKTDARKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG  510

Query  812   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  991
             CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct  511   CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM  570

Query  992   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY  1171
             EG+Q+LTLEDVVS+ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETY
Sbjct  571   EGIQILTLEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETY  630

Query  1172  PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  1351
             PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct  631   PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL  690

Query  1352  WKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltkltPEQAAYISIPVEGPYKPPHY  1531
             W EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPV+GPYKP  Y
Sbjct  691   WNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVDGPYKPAAY  750

Query  1532  RY  1537
             RY
Sbjct  751   RY  752



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6142247526225