BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1727

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361420.1|  PREDICTED: uncharacterized protein R102.4 is...    301   1e-97   Solanum tuberosum [potatoes]
ref|XP_009631531.1|  PREDICTED: probable low-specificity L-threon...    300   1e-97   
ref|XP_009798339.1|  PREDICTED: probable low-specificity L-threon...    300   2e-97   Nicotiana sylvestris
ref|XP_010319280.1|  PREDICTED: probable low-specificity L-threon...    299   5e-97   Solanum lycopersicum
ref|NP_001275261.1|  L-allo-threonine aldolase-related protein          298   8e-97   Solanum tuberosum [potatoes]
ref|XP_004236787.1|  PREDICTED: probable low-specificity L-threon...    297   2e-96   Solanum lycopersicum
ref|XP_011101617.1|  PREDICTED: probable low-specificity L-threon...    288   1e-92   Sesamum indicum [beniseed]
gb|EPS60604.1|  hypothetical protein M569_14199                         284   2e-91   Genlisea aurea
gb|EYU19887.1|  hypothetical protein MIMGU_mgv1a008896mg                283   9e-91   Erythranthe guttata [common monkey flower]
ref|XP_008456444.1|  PREDICTED: probable low-specificity L-threon...    280   1e-89   Cucumis melo [Oriental melon]
gb|KDO44518.1|  hypothetical protein CISIN_1g0182432mg                  273   5e-89   Citrus sinensis [apfelsine]
gb|AGI05087.1|  threonine aldolase                                      275   9e-89   Gossypium aridum
ref|XP_006442684.1|  hypothetical protein CICLE_v10020798mg             275   1e-88   
gb|KHG00003.1|  ltaA                                                    276   1e-88   Gossypium arboreum [tree cotton]
ref|XP_004139254.1|  PREDICTED: probable low-specificity L-threon...    277   2e-88   Cucumis sativus [cucumbers]
gb|KHG00004.1|  ltaA                                                    277   2e-88   Gossypium arboreum [tree cotton]
ref|XP_007030425.1|  Threonine aldolase 1 isoform 6                     275   4e-88   
ref|XP_006487715.1|  PREDICTED: uncharacterized protein R102.4-li...    276   4e-88   Citrus sinensis [apfelsine]
gb|KCW61514.1|  hypothetical protein EUGRSUZ_H04236                     270   7e-88   Eucalyptus grandis [rose gum]
ref|XP_008388713.1|  PREDICTED: probable low-specificity L-threon...    276   8e-88   
ref|XP_007030422.1|  Threonine aldolase 1 isoform 3                     275   8e-88   
ref|XP_007030420.1|  Threonine aldolase 1 isoform 1                     275   9e-88   
ref|XP_002325334.2|  L-allo-threonine aldolase-related family pro...    275   1e-87   Populus trichocarpa [western balsam poplar]
gb|KCW61513.1|  hypothetical protein EUGRSUZ_H04236                     271   1e-87   Eucalyptus grandis [rose gum]
ref|XP_006442676.1|  hypothetical protein CICLE_v10020798mg             275   1e-87   Citrus clementina [clementine]
ref|XP_009795458.1|  PREDICTED: probable low-specificity L-threon...    275   1e-87   Nicotiana sylvestris
ref|XP_007030424.1|  Threonine aldolase 1 isoform 5                     275   2e-87   
gb|KCW61508.1|  hypothetical protein EUGRSUZ_H04236                     275   2e-87   Eucalyptus grandis [rose gum]
gb|ACJ85466.1|  unknown                                                 270   2e-87   Medicago truncatula
gb|KCW61512.1|  hypothetical protein EUGRSUZ_H04236                     271   2e-87   Eucalyptus grandis [rose gum]
gb|KJB44861.1|  hypothetical protein B456_007G276400                    276   3e-87   Gossypium raimondii
ref|XP_007030423.1|  L-allo-threonine aldolase isoform 4                274   4e-87   
gb|KJB82283.1|  hypothetical protein B456_013G187300                    273   5e-87   Gossypium raimondii
ref|XP_011038517.1|  PREDICTED: LOW QUALITY PROTEIN: probable low...    273   5e-87   Populus euphratica
ref|XP_004495576.1|  PREDICTED: L-allo-threonine aldolase-like is...    273   6e-87   Cicer arietinum [garbanzo]
gb|KJB44863.1|  hypothetical protein B456_007G276400                    272   7e-87   Gossypium raimondii
ref|XP_002319106.2|  L-allo-threonine aldolase-related family pro...    273   1e-86   
gb|KJB44860.1|  hypothetical protein B456_007G276400                    273   1e-86   Gossypium raimondii
ref|XP_004495577.1|  PREDICTED: L-allo-threonine aldolase-like is...    272   2e-86   Cicer arietinum [garbanzo]
ref|XP_010024956.1|  PREDICTED: probable low-specificity L-threon...    271   3e-86   
ref|XP_003590972.1|  L-allo-threonine aldolase                          272   3e-86   Medicago truncatula
ref|XP_012089322.1|  PREDICTED: probable low-specificity L-threon...    272   4e-86   
ref|XP_007205422.1|  hypothetical protein PRUPE_ppa007684mg             271   5e-86   Prunus persica
ref|XP_003590973.1|  L-allo-threonine aldolase                          272   5e-86   
gb|KCW61511.1|  hypothetical protein EUGRSUZ_H04236                     271   6e-86   Eucalyptus grandis [rose gum]
ref|XP_008388714.1|  PREDICTED: probable low-specificity L-threon...    271   7e-86   
ref|XP_008218319.1|  PREDICTED: probable low-specificity L-threon...    270   9e-86   Prunus mume [ume]
ref|XP_002521974.1|  l-allo-threonine aldolase, putative                270   9e-86   Ricinus communis
ref|XP_010694951.1|  PREDICTED: probable low-specificity L-threon...    271   1e-85   Beta vulgaris subsp. vulgaris [field beet]
gb|AES61221.2|  L-allo-threonine aldolase-like protein                  270   1e-85   Medicago truncatula
ref|XP_012089323.1|  PREDICTED: probable low-specificity L-threon...    269   2e-85   Jatropha curcas
ref|XP_003590970.1|  L-allo-threonine aldolase                          272   4e-85   
gb|AFK38526.1|  unknown                                                 269   4e-85   Medicago truncatula
ref|XP_011036295.1|  PREDICTED: probable low-specificity L-threon...    268   5e-85   Populus euphratica
ref|XP_009364444.1|  PREDICTED: probable low-specificity L-threon...    268   6e-85   Pyrus x bretschneideri [bai li]
gb|ACJ84635.1|  unknown                                                 261   1e-84   Medicago truncatula
ref|XP_007144017.1|  hypothetical protein PHAVU_007G122200g             266   3e-84   Phaseolus vulgaris [French bean]
gb|KJB46043.1|  hypothetical protein B456_007G345500                    266   6e-84   Gossypium raimondii
gb|KHG25609.1|  L-allo-threonine aldolase                               266   6e-84   Gossypium arboreum [tree cotton]
gb|KHN04944.1|  L-allo-threonine aldolase                               266   6e-84   Glycine soja [wild soybean]
gb|KGN66767.1|  hypothetical protein Csa_1G681130                       261   7e-84   Cucumis sativus [cucumbers]
ref|XP_002266992.1|  PREDICTED: probable low-specificity L-threon...    265   9e-84   Vitis vinifera
ref|XP_008802139.1|  PREDICTED: probable low-specificity L-threon...    265   1e-83   Phoenix dactylifera
ref|XP_006588445.1|  PREDICTED: uncharacterized protein LOC100790...    265   1e-83   Glycine max [soybeans]
gb|AFK43649.1|  unknown                                                 265   1e-83   Lotus japonicus
ref|XP_006606452.1|  PREDICTED: uncharacterized protein R102.4-li...    265   2e-83   
ref|XP_008802141.1|  PREDICTED: probable low-specificity L-threon...    263   2e-83   
gb|ACJ85157.1|  unknown                                                 266   2e-83   Medicago truncatula
ref|NP_001242307.1|  uncharacterized protein LOC100790890               264   2e-83   
ref|XP_006606453.1|  PREDICTED: uncharacterized protein R102.4-li...    265   3e-83   
gb|KJB46045.1|  hypothetical protein B456_007G345500                    265   3e-83   Gossypium raimondii
ref|XP_009389078.1|  PREDICTED: probable low-specificity L-threon...    263   4e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003556456.2|  PREDICTED: uncharacterized protein R102.4-li...    265   4e-83   
gb|ADI24921.1|  L-allo-threonine aldolase                               263   5e-83   Carica papaya [mamon]
gb|KEH24599.1|  L-allo-threonine aldolase-like protein                  263   6e-83   Medicago truncatula
gb|AFK40044.1|  unknown                                                 263   7e-83   Medicago truncatula
ref|XP_004494746.1|  PREDICTED: L-allo-threonine aldolase-like is...    263   8e-83   Cicer arietinum [garbanzo]
ref|XP_008453668.1|  PREDICTED: probable low-specificity L-threon...    263   9e-83   Cucumis melo [Oriental melon]
ref|XP_006606451.1|  PREDICTED: uncharacterized protein R102.4-li...    265   9e-83   
ref|XP_010246795.1|  PREDICTED: probable low-specificity L-threon...    262   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_011660269.1|  PREDICTED: probable low-specificity L-threon...    262   1e-82   Cucumis sativus [cucumbers]
emb|CAN82414.1|  hypothetical protein VITISV_039151                     263   1e-82   Vitis vinifera
ref|XP_002892465.1|  hypothetical protein ARALYDRAFT_470930             262   2e-82   
ref|XP_008453667.1|  PREDICTED: probable low-specificity L-threon...    263   2e-82   Cucumis melo [Oriental melon]
gb|KJB44862.1|  hypothetical protein B456_007G276400                    263   2e-82   Gossypium raimondii
ref|XP_010906811.1|  PREDICTED: probable low-specificity L-threon...    262   2e-82   
ref|XP_008453666.1|  PREDICTED: probable low-specificity L-threon...    263   2e-82   Cucumis melo [Oriental melon]
ref|XP_010906812.1|  PREDICTED: probable low-specificity L-threon...    261   2e-82   Elaeis guineensis
ref|XP_010906817.1|  PREDICTED: probable low-specificity L-threon...    260   4e-82   Elaeis guineensis
ref|XP_010906814.1|  PREDICTED: probable low-specificity L-threon...    260   8e-82   Elaeis guineensis
ref|XP_012069248.1|  PREDICTED: probable low-specificity L-threon...    253   1e-81   Jatropha curcas
ref|XP_010906809.1|  PREDICTED: probable low-specificity L-threon...    260   1e-81   
gb|KGN66765.1|  hypothetical protein Csa_1G680120                       259   1e-81   Cucumis sativus [cucumbers]
ref|XP_010906810.1|  PREDICTED: probable low-specificity L-threon...    260   2e-81   
gb|AAF99780.1|AC003981_30  F22O13.11                                    259   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077492.1|  threonine aldolase                                 258   2e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KDP23711.1|  hypothetical protein JCGZ_23544                         259   2e-81   Jatropha curcas
gb|AAM63785.1|  unknown                                                 259   3e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118358.1|  PREDICTED: probable low-specificity L-threon...    259   3e-81   
ref|NP_563822.1|  threonine aldolase                                    258   3e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142582.2|  PREDICTED: probable low-specificity L-threon...    258   5e-81   Cucumis sativus [cucumbers]
ref|XP_010475669.1|  PREDICTED: probable low-specificity L-threon...    258   6e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009148115.1|  PREDICTED: probable low-specificity L-threon...    258   7e-81   Brassica rapa
ref|XP_007147215.1|  hypothetical protein PHAVU_006G105400g             257   1e-80   Phaseolus vulgaris [French bean]
ref|XP_010489194.1|  PREDICTED: probable low-specificity L-threon...    257   2e-80   Camelina sativa [gold-of-pleasure]
emb|CDX95045.1|  BnaC05g06260D                                          256   2e-80   
emb|CDY06323.1|  BnaA09g48800D                                          256   2e-80   
ref|XP_010458106.1|  PREDICTED: probable low-specificity L-threon...    256   3e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006417664.1|  hypothetical protein EUTSA_v10008026mg             256   3e-80   Eutrema salsugineum [saltwater cress]
emb|CDY22672.1|  BnaC08g43060D                                          256   3e-80   Brassica napus [oilseed rape]
ref|XP_009110878.1|  PREDICTED: probable low-specificity L-threon...    256   4e-80   Brassica rapa
ref|XP_006305180.1|  hypothetical protein CARUB_v10009546mg             255   6e-80   Capsella rubella
ref|XP_010102233.1|  L-allo-threonine aldolase                          255   8e-80   Morus notabilis
ref|XP_010553775.1|  PREDICTED: probable low-specificity L-threon...    255   9e-80   Tarenaya hassleriana [spider flower]
ref|XP_006577318.1|  PREDICTED: uncharacterized protein R102.4-li...    255   9e-80   Glycine max [soybeans]
ref|XP_008443794.1|  PREDICTED: probable low-specificity L-threon...    255   1e-79   
ref|XP_006577317.1|  PREDICTED: uncharacterized protein R102.4-li...    255   1e-79   Glycine max [soybeans]
ref|XP_003521772.1|  PREDICTED: uncharacterized protein R102.4-li...    254   1e-79   Glycine max [soybeans]
emb|CDX93548.1|  BnaA06g05000D                                          254   2e-79   
emb|CDY31134.1|  BnaA08g26840D                                          253   6e-79   Brassica napus [oilseed rape]
emb|CDO99988.1|  unnamed protein product                                249   7e-78   Coffea canephora [robusta coffee]
ref|XP_006857300.1|  PREDICTED: probable low-specificity L-threon...    249   1e-77   Amborella trichopoda
ref|XP_011465993.1|  PREDICTED: probable low-specificity L-threon...    247   9e-77   Fragaria vesca subsp. vesca
ref|XP_008802138.1|  PREDICTED: probable low-specificity L-threon...    243   3e-75   Phoenix dactylifera
ref|XP_010262337.1|  PREDICTED: probable low-specificity L-threon...    243   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010262335.1|  PREDICTED: probable low-specificity L-threon...    243   3e-75   Nelumbo nucifera [Indian lotus]
gb|AFW58858.1|  putative threonine aldolase family protein              238   5e-74   
emb|CDY42933.1|  BnaC05g47180D                                          239   2e-73   Brassica napus [oilseed rape]
ref|XP_008661960.1|  PREDICTED: L-allo-threonine aldolase isoform X1    239   2e-73   
emb|CDY49330.1|  BnaA05g32920D                                          239   2e-73   Brassica napus [oilseed rape]
ref|NP_001149239.1|  L-allo-threonine aldolase                          239   2e-73   Zea mays [maize]
ref|XP_009123981.1|  PREDICTED: probable low-specificity L-threon...    238   3e-73   Brassica rapa
ref|NP_566228.1|  threonine aldolase 2                                  238   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189807.1|  threonine aldolase 2                               238   4e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAF63783.1|  L-allo-threonine aldolase, putative                     238   6e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884450.1|  hypothetical protein ARALYDRAFT_896488             236   1e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_006408182.1|  hypothetical protein EUTSA_v10021036mg             236   1e-72   Eutrema salsugineum [saltwater cress]
ref|XP_003590971.1|  L-allo-threonine aldolase                          234   3e-72   
ref|XP_010463930.1|  PREDICTED: probable low-specificity L-threon...    234   6e-72   Camelina sativa [gold-of-pleasure]
gb|ACG34432.1|  L-allo-threonine aldolase                               235   9e-72   Zea mays [maize]
ref|XP_010415759.1|  PREDICTED: probable low-specificity L-threon...    233   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010485829.1|  PREDICTED: probable low-specificity L-threon...    233   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010520652.1|  PREDICTED: probable low-specificity L-threon...    233   3e-71   Tarenaya hassleriana [spider flower]
emb|CBI22386.3|  unnamed protein product                                230   2e-70   Vitis vinifera
ref|XP_006298023.1|  hypothetical protein CARUB_v10014068mg             228   1e-69   Capsella rubella
ref|XP_004976228.1|  PREDICTED: uncharacterized protein R102.4-li...    228   3e-69   Setaria italica
ref|XP_004976227.1|  PREDICTED: uncharacterized protein R102.4-li...    228   4e-69   
gb|ABR18450.1|  unknown                                                 227   7e-69   Picea sitchensis
ref|XP_010553776.1|  PREDICTED: probable low-specificity L-threon...    222   4e-67   Tarenaya hassleriana [spider flower]
gb|EMT09938.1|  hypothetical protein F775_21345                         219   7e-67   
gb|EMS57977.1|  L-allo-threonine aldolase                               219   9e-67   Triticum urartu
ref|XP_006652519.1|  PREDICTED: uncharacterized protein R102.4-like     221   2e-66   Oryza brachyantha
ref|NP_001140767.1|  putative threonine aldolase family protein         218   5e-66   
gb|EMT23922.1|  hypothetical protein F775_09169                         216   9e-66   
ref|XP_008667491.1|  PREDICTED: putative threonine aldolase famil...    219   1e-65   
ref|NP_001241763.1|  L-allo-threonine aldolase                          219   1e-65   
ref|XP_008667492.1|  PREDICTED: putative threonine aldolase famil...    218   1e-65   Zea mays [maize]
ref|NP_001141974.1|  putative threonine aldolase family protein i...    213   2e-65   
dbj|BAK01917.1|  predicted protein                                      217   3e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03835.1|  predicted protein                                      217   5e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580135.1|  PREDICTED: probable low-specificity L-threon...    216   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_002448187.1|  hypothetical protein SORBIDRAFT_06g022630          215   4e-64   Sorghum bicolor [broomcorn]
tpg|DAA36971.1|  TPA: putative threonine aldolase family protein ...    215   4e-64   
gb|EMT28261.1|  hypothetical protein F775_27222                         211   5e-64   
gb|EMS52584.1|  L-allo-threonine aldolase                               214   7e-64   Triticum urartu
dbj|BAJ93201.1|  predicted protein                                      214   7e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001053314.1|  Os04g0516600                                       213   2e-63   
gb|EMT07295.1|  hypothetical protein F775_08681                         210   7e-63   
gb|EMS67121.1|  L-allo-threonine aldolase                               208   2e-61   Triticum urartu
emb|CAE05443.2|  OSJNBa0073E02.3                                        207   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001768407.1|  predicted protein                                  207   8e-61   
gb|EMS46485.1|  L-allo-threonine aldolase                               203   8e-61   Triticum urartu
ref|XP_004976226.1|  PREDICTED: uncharacterized protein R102.4-like     202   6e-60   Setaria italica
ref|XP_004976222.1|  PREDICTED: uncharacterized protein R102.4-like     202   3e-59   Setaria italica
ref|WP_014434736.1|  threonine aldolase                                 179   8e-51   Caldilinea aerophila
ref|XP_002973664.1|  hypothetical protein SELMODRAFT_99781              179   2e-50   
ref|XP_002975719.1|  hypothetical protein SELMODRAFT_103881             179   3e-50   
ref|XP_005989151.1|  PREDICTED: uncharacterized protein R102.4-like     179   6e-50   Latimeria chalumnae
emb|CDQ60587.1|  unnamed protein product                                179   9e-50   Oncorhynchus mykiss
ref|XP_011429035.1|  PREDICTED: probable low-specificity L-threon...    178   1e-49   Crassostrea gigas
ref|XP_003058675.1|  predicted protein                                  181   3e-49   Micromonas pusilla CCMP1545
ref|XP_002594275.1|  hypothetical protein BRAFLDRAFT_260210             176   3e-49   Branchiostoma floridae
ref|XP_010893799.1|  PREDICTED: probable low-specificity L-threon...    176   8e-49   Esox lucius
ref|WP_005011469.1|  Low-specificity L-threonine aldolase               173   3e-48   Nitrospina gracilis
ref|XP_005943923.1|  PREDICTED: uncharacterized protein R102.4-li...    172   4e-48   Haplochromis burtoni
ref|XP_008300571.1|  PREDICTED: probable low-specificity L-threon...    174   6e-48   Stegastes partitus
ref|XP_004556683.1|  PREDICTED: uncharacterized protein R102.4-like     172   2e-47   Maylandia zebra
ref|XP_005943922.1|  PREDICTED: uncharacterized protein R102.4-li...    172   2e-47   Haplochromis burtoni
ref|XP_006635478.1|  PREDICTED: uncharacterized protein R102.4-like     172   2e-47   
gb|EKC35640.1|  E3 ubiquitin-protein ligase TRAF7                       179   3e-47   Crassostrea gigas
ref|WP_038087996.1|  threonine aldolase                                 170   4e-47   Acidihalobacter prosperus
ref|XP_007562537.1|  PREDICTED: uncharacterized protein R102.4-like     171   4e-47   Poecilia formosa
ref|XP_003979332.2|  PREDICTED: probable low-specificity L-threon...    171   5e-47   Takifugu rubripes [tiger puffer]
ref|WP_026159079.1|  threonine aldolase                                 169   5e-47   
ref|XP_005749741.1|  PREDICTED: uncharacterized protein R102.4-like     171   7e-47   Pundamilia nyererei
ref|XP_004080515.1|  PREDICTED: probable low-specificity L-threon...    171   8e-47   Oryzias latipes [Japanese rice fish]
ref|XP_003441921.1|  PREDICTED: uncharacterized protein R102.4-like     171   1e-46   Oreochromis niloticus
ref|WP_013559406.1|  threonine aldolase                                 168   2e-46   Anaerolinea thermophila
ref|WP_020877756.1|  aromatic amino acid beta-eliminating lyase/t...    168   2e-46   Desulfococcus multivorans
ref|WP_036683028.1|  threonine aldolase                                 167   3e-46   
ref|WP_026171962.1|  threonine aldolase                                 167   5e-46   
ref|XP_008312508.1|  PREDICTED: probable low-specificity L-threon...    169   6e-46   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002069264.1|  GK21059                                            167   9e-46   Drosophila willistoni
ref|WP_011697570.1|  threonine aldolase                                 167   9e-46   Syntrophobacter fumaroxidans
ref|XP_010747733.1|  PREDICTED: probable low-specificity L-threon...    168   1e-45   
ref|XP_006814697.1|  PREDICTED: uncharacterized protein R102.4-like     165   1e-44   Saccoglossus kowalevskii
emb|CBN78642.1|  Threonine aldolase                                     171   1e-44   Ectocarpus siliculosus
ref|XP_002121406.1|  PREDICTED: probable low-specificity L-threon...    164   1e-44   
ref|XP_001419158.1|  predicted protein                                  164   2e-44   Ostreococcus lucimarinus CCE9901
ref|XP_005794827.1|  PREDICTED: uncharacterized protein R102.4-like     166   2e-44   
ref|WP_037564212.1|  threonine aldolase                                 163   2e-44   Alkalispirochaeta odontotermitis
ref|XP_002777074.1|  L-allo-threonine aldolase, putative                163   3e-44   Perkinsus marinus ATCC 50983
emb|CEG01512.1|  Aromatic amino acid beta-eliminating lyase/threo...    163   4e-44   Ostreococcus tauri
ref|XP_001625551.1|  predicted protein                                  162   5e-44   Nematostella vectensis
ref|XP_003385045.1|  PREDICTED: probable low-specificity L-threon...    162   6e-44   
ref|XP_003080829.1|  L-allo-threonine aldolase, putative (ISS)          162   9e-44   
ref|WP_013218741.1|  threonine aldolase                                 161   9e-44   Dehalogenimonas lykanthroporepellens
ref|XP_010795211.1|  PREDICTED: probable low-specificity L-threon...    163   1e-43   Notothenia coriiceps [yellowbelly rockcod]
ref|WP_019902461.1|  hypothetical protein                               160   1e-43   
ref|WP_018052780.1|  hypothetical protein                               160   3e-43   
ref|XP_002001285.1|  GI10703                                            159   7e-43   Drosophila mojavensis
ref|XP_001989934.1|  GH19068                                            159   8e-43   Drosophila grimshawi
gb|KDR08943.1|  hypothetical protein L798_00871                         159   1e-42   Zootermopsis nevadensis
ref|WP_004713360.1|  threonine aldolase                                 158   1e-42   Yersinia rohdei
ref|XP_784851.4|  PREDICTED: probable low-specificity L-threonine...    159   2e-42   Strongylocentrotus purpuratus [purple urchin]
ref|XP_011559305.1|  PREDICTED: probable low-specificity L-threon...    158   3e-42   Plutella xylostella [cabbage moth]
ref|XP_011560012.1|  PREDICTED: probable low-specificity L-threon...    158   3e-42   Plutella xylostella [cabbage moth]
ref|XP_008102407.1|  PREDICTED: LOW QUALITY PROTEIN: probable low...    159   3e-42   
ref|XP_001517050.1|  PREDICTED: probable low-specificity L-threon...    157   3e-42   
emb|CCO67312.1|  Low-specificity L-threonine aldolase                   157   4e-42   Yersinia enterocolitica IP 10393
ref|WP_012119285.1|  threonine aldolase                                 157   4e-42   Roseiflexus castenholzii
emb|CFQ65831.1|  L-threonine aldolase                                   157   4e-42   Yersinia frederiksenii
ref|WP_023377740.1|  Low-specificity L-threonine aldolase               156   5e-42   
ref|XP_002053845.1|  GJ23119                                            157   9e-42   Drosophila virilis
ref|XP_008483598.1|  PREDICTED: probable low-specificity L-threon...    152   9e-42   
emb|CFQ43732.1|  L-threonine aldolase                                   155   9e-42   Yersinia aleksiciae
tpg|DAA34403.1|  TPA: threonine aldolase                                152   1e-41   Amblyomma variegatum
emb|CRF04697.1|  L-threonine aldolase                                   155   1e-41   Yersinia intermedia
ref|WP_004873721.1|  threonine aldolase                                 155   2e-41   Yersinia mollaretii
ref|WP_042663615.1|  threonine aldolase                                 155   2e-41   Yersinia enterocolitica
ref|WP_032898062.1|  threonine aldolase                                 155   2e-41   Yersinia bercovieri
ref|XP_009060249.1|  hypothetical protein LOTGIDRAFT_154302             155   2e-41   Lottia gigantea
emb|CFQ29270.1|  L-threonine aldolase                                   155   2e-41   Yersinia enterocolitica
ref|WP_019079898.1|  threonine aldolase                                 154   2e-41   Yersinia enterocolitica
ref|WP_019083465.1|  threonine aldolase                                 154   2e-41   Yersinia enterocolitica
ref|WP_005162818.1|  threonine aldolase                                 154   3e-41   Yersinia enterocolitica
ref|WP_023161056.1|  L-allo-threonine aldolase                          154   3e-41   Yersinia enterocolitica
ref|WP_005171133.1|  threonine aldolase                                 154   3e-41   Yersinia enterocolitica
ref|WP_046050696.1|  threonine aldolase                                 154   3e-41   Yersinia enterocolitica
ref|WP_011816022.1|  threonine aldolase                                 154   3e-41   Yersinia enterocolitica
gb|AAI54202.1|  Zgc:91912                                               156   3e-41   Danio rerio [leopard danio]
emb|CFB70566.1|  L-threonine aldolase                                   154   3e-41   Yersinia enterocolitica
ref|XP_001982124.1|  GG12420                                            155   3e-41   
ref|WP_025383281.1|  threonine aldolase                                 154   3e-41   Yersinia pseudotuberculosis complex
emb|CFQ93963.1|  L-threonine aldolase                                   154   3e-41   Yersinia frederiksenii
ref|XP_002429180.1|  L-allo-threonine aldolase, putative                155   4e-41   Pediculus humanus corporis [human body lice]
ref|XP_004922009.1|  PREDICTED: uncharacterized protein R102.4-like     154   5e-41   Bombyx mori [silk moth]
ref|WP_042568238.1|  threonine aldolase                                 153   7e-41   Yersinia
ref|WP_005184761.1|  threonine aldolase                                 153   8e-41   Yersinia intermedia
ref|NP_651161.1|  CG10184                                               154   9e-41   Drosophila melanogaster
ref|WP_023160779.1|  L-allo-threonine aldolase                          153   1e-40   Yersinia enterocolitica
ref|XP_002032362.1|  GM23553                                            154   1e-40   Drosophila sechellia
ref|NP_001002176.1|  threonine aldolase 1                               154   1e-40   Danio rerio [leopard danio]
ref|XP_002104572.1|  GD18368                                            154   1e-40   
ref|XP_002020170.1|  GL13839                                            154   1e-40   Drosophila persimilis
ref|NP_001076701.2|  Protein R102.4, isoform c                          154   1e-40   Caenorhabditis elegans [roundworm]
ref|XP_001357814.2|  GA10138                                            153   2e-40   Drosophila pseudoobscura pseudoobscura
ref|WP_042819367.1|  threonine aldolase                                 152   2e-40   Yersinia wautersii
ref|WP_033853305.1|  threonine aldolase                                 152   2e-40   Yersinia pseudotuberculosis complex
ref|NP_501979.3|  Protein R102.4, isoform b                             154   2e-40   Caenorhabditis elegans [roundworm]
gb|EGT48067.1|  hypothetical protein CAEBREN_30968                      154   2e-40   Caenorhabditis brenneri
gb|KFM60885.1|  Hypothetical protein X975_00033                         152   2e-40   Stegodyphus mimosarum
gb|EHJ67858.1|  hypothetical protein KGM_00088                          153   2e-40   
ref|NP_501978.3|  Protein R102.4, isoform a                             154   2e-40   Caenorhabditis elegans [roundworm]
ref|WP_038404710.1|  threonine aldolase                                 147   2e-40   
ref|WP_018206339.1|  MULTISPECIES: hypothetical protein                 152   2e-40   
ref|XP_002098447.1|  GE23939                                            153   2e-40   Drosophila yakuba
gb|ELU12248.1|  hypothetical protein CAPTEDRAFT_174489                  152   3e-40   Capitella teleta
gb|ACI16795.2|  threonine aldolase                                      152   3e-40   Coprothermobacter proteolyticus DSM 5265
ref|WP_012543447.1|  threonine aldolase                                 152   3e-40   
ref|WP_038241504.1|  threonine aldolase                                 152   3e-40   
ref|XP_006270755.1|  PREDICTED: uncharacterized protein R102.4-like     152   3e-40   
ref|WP_004717312.1|  threonine aldolase                                 152   3e-40   
ref|WP_042528124.1|  threonine aldolase                                 152   3e-40   
ref|WP_034004929.1|  threonine aldolase                                 147   3e-40   
ref|WP_015671727.1|  threonine aldolase                                 152   3e-40   
ref|XP_003089462.1|  hypothetical protein CRE_15084                     153   3e-40   
gb|EYC42451.1|  hypothetical protein Y032_0531g3026                     149   3e-40   
ref|XP_003498871.1|  PREDICTED: probable low-specificity L-threon...    152   4e-40   
ref|WP_038632040.1|  MULTISPECIES: threonine aldolase                   151   4e-40   
emb|CFR04259.1|  L-threonine aldolase                                   151   4e-40   
ref|WP_004389601.1|  threonine aldolase                                 151   4e-40   
ref|XP_001651472.1|  AAEL005819-PA                                      152   4e-40   
ref|XP_004433000.1|  PREDICTED: uncharacterized protein R102.4-like     152   5e-40   
gb|EDL66247.1|  L-allo-threonine aldolase                               151   5e-40   
gb|EYC42453.1|  hypothetical protein Y032_0531g3026                     149   5e-40   
emb|CDW81197.1|  threonine aldolase                                     152   5e-40   
ref|XP_006064168.1|  PREDICTED: uncharacterized protein R102.4-li...    152   5e-40   
ref|XP_002072954.1|  GK13412                                            152   5e-40   
ref|WP_020675901.1|  hypothetical protein                               151   6e-40   
ref|XP_011964964.1|  PREDICTED: probable low-specificity L-threon...    153   6e-40   
ref|XP_001081745.1|  PREDICTED: probable low-specificity L-threon...    152   6e-40   
emb|CEF60693.1|  Aromatic amino acid beta-eliminating lyase/threo...    152   6e-40   
gb|ETO06892.1|  hypothetical protein RFI_30498                          153   7e-40   
emb|CBJ32110.1|  Threonine aldolase                                     153   7e-40   
ref|XP_004655761.1|  PREDICTED: uncharacterized protein R102.4-like     148   7e-40   
gb|EYC42452.1|  hypothetical protein Y032_0531g3026                     149   8e-40   
gb|EYC42454.1|  hypothetical protein Y032_0531g3026                     149   1e-39   
ref|XP_001955419.1|  GF18752                                            151   1e-39   
ref|WP_024917509.1|  threonine aldolase                                 147   1e-39   
gb|EGT59860.1|  hypothetical protein CAEBREN_31962                      152   1e-39   
ref|WP_035983901.1|  threonine aldolase                                 145   1e-39   
ref|WP_043185387.1|  threonine aldolase                                 150   1e-39   
ref|XP_005597157.1|  PREDICTED: uncharacterized protein R102.4-like     151   1e-39   
ref|XP_008523105.1|  PREDICTED: probable low-specificity L-threon...    151   2e-39   
ref|WP_017892242.1|  threonine aldolase                                 150   2e-39   
ref|WP_012006096.1|  threonine aldolase                                 150   2e-39   
ref|WP_045087165.1|  threonine aldolase                                 150   2e-39   
ref|WP_026051832.1|  hypothetical protein                               144   2e-39   
ref|WP_034078438.1|  threonine aldolase                                 144   2e-39   
emb|CDJ95042.1|  unnamed protein product                                150   2e-39   
ref|XP_003108500.1|  hypothetical protein CRE_10872                     151   2e-39   
ref|WP_035291801.1|  threonine aldolase                                 149   2e-39   
ref|XP_005351000.1|  PREDICTED: uncharacterized protein R102.4-like     151   3e-39   
ref|WP_044022162.1|  threonine aldolase                                 149   3e-39   
ref|XP_006734331.1|  PREDICTED: uncharacterized protein R102.4-like     150   3e-39   
emb|CDJ92999.1|  Aromatic amino acid beta-eliminating lyase threo...    150   3e-39   
ref|XP_008312591.1|  PREDICTED: probable low-specificity L-threon...    150   3e-39   
ref|WP_020826096.1|  threonine aldolase                                 149   3e-39   
ref|XP_012054433.1|  PREDICTED: probable low-specificity L-threon...    150   3e-39   
ref|XP_584041.3|  PREDICTED: probable low-specificity L-threonine...    150   3e-39   
ref|XP_005332676.1|  PREDICTED: uncharacterized protein R102.4-like     150   4e-39   
ref|XP_006176975.1|  PREDICTED: uncharacterized protein R102.4-like     152   4e-39   
ref|XP_010854566.1|  PREDICTED: probable low-specificity L-threon...    150   4e-39   
emb|CBX71679.1|  hypothetical protein YEW_FV24480                       142   4e-39   
gb|ERN03351.1|  hypothetical protein AMTR_s00003p00244760               142   5e-39   
ref|XP_005645027.1|  threonine aldolase                                 149   5e-39   
ref|WP_043418899.1|  threonine aldolase                                 149   5e-39   
ref|WP_009620768.1|  MULTISPECIES: L-threonine aldolase                 148   5e-39   
ref|WP_038052321.1|  threonine aldolase                                 148   5e-39   
dbj|BAL53180.1|  threonine aldolase                                     148   6e-39   
ref|WP_034016418.1|  threonine aldolase                                 148   7e-39   
ref|WP_016263814.1|  hypothetical protein                               148   7e-39   
ref|WP_034027655.1|  threonine aldolase                                 148   7e-39   
ref|XP_011063702.1|  PREDICTED: probable low-specificity L-threon...    149   8e-39   
ref|WP_019681686.1|  threonine aldolase                                 148   8e-39   
ref|WP_015903146.1|  threonine aldolase                                 148   8e-39   
dbj|BAH07479.1|  hypothetical protein                                   148   8e-39   
ref|XP_005624103.1|  PREDICTED: uncharacterized protein R102.4-like     149   9e-39   
ref|WP_033956165.1|  threonine aldolase                                 148   9e-39   
ref|WP_044549475.1|  threonine aldolase                                 148   9e-39   
ref|WP_006320879.1|  threonine aldolase                                 148   9e-39   
ref|WP_012103076.1|  threonine aldolase                                 148   9e-39   
ref|WP_003134258.1|  threonine aldolase                                 147   9e-39   
ref|WP_003111717.1|  MULTISPECIES: threonine aldolase                   147   9e-39   
ref|WP_023112294.1|  hypothetical protein                               147   9e-39   
ref|WP_003085964.1|  threonine aldolase                                 147   9e-39   
ref|WP_023409291.1|  hypothetical protein                               148   9e-39   
ref|WP_023130163.1|  hypothetical protein                               147   9e-39   
ref|WP_043094108.1|  threonine aldolase                                 147   9e-39   
ref|WP_033939139.1|  threonine aldolase                                 147   9e-39   
ref|WP_031756411.1|  threonine aldolase                                 147   1e-38   
ref|WP_012076935.1|  threonine aldolase                                 147   1e-38   
ref|WP_034080189.1|  threonine aldolase                                 147   1e-38   
ref|WP_033976545.1|  threonine aldolase                                 147   1e-38   
ref|XP_005195892.1|  PREDICTED: probable low-specificity L-threon...    149   1e-38   
ref|WP_043102813.1|  threonine aldolase                                 147   1e-38   
ref|WP_033971186.1|  threonine aldolase                                 147   1e-38   
ref|WP_043267694.1|  threonine aldolase                                 147   1e-38   
ref|WP_003153522.1|  hypothetical protein                               147   1e-38   
gb|ABX03684.1|  Threonine aldolase                                      147   1e-38   
ref|XP_005195891.1|  PREDICTED: probable low-specificity L-threon...    149   1e-38   
gb|ETN83139.1|  putative L-allo-threonine aldolase                      149   1e-38   
ref|WP_043250566.1|  threonine aldolase                                 147   1e-38   
ref|XP_002634311.1|  Hypothetical protein CBG17652                      149   1e-38   
ref|WP_041304095.1|  threonine aldolase                                 147   1e-38   
ref|WP_023437901.1|  L-allo-threonine aldolase                          147   1e-38   
gb|EDL34643.1|  threonine aldolase 1, isoform CRA_a                     149   1e-38   
ref|XP_006990325.1|  PREDICTED: uncharacterized protein R102.4-like     148   2e-38   
ref|WP_033971346.1|  threonine aldolase                                 144   2e-38   
ref|NP_001255502.1|  Protein R102.4, isoform d                          149   2e-38   
ref|XP_004593088.1|  PREDICTED: uncharacterized protein R102.4-like     149   2e-38   
ref|WP_040363469.1|  threonine aldolase                                 147   2e-38   
ref|XP_003997292.1|  PREDICTED: probable low-specificity L-threon...    148   2e-38   
ref|XP_011154490.1|  PREDICTED: probable low-specificity L-threon...    148   2e-38   
ref|WP_010090107.1|  Threonine aldolase                                 142   2e-38   
ref|XP_007515338.1|  L-allo-threonine aldolase                          148   2e-38   
ref|WP_015891592.1|  threonine aldolase                                 147   2e-38   
ref|WP_042862593.1|  threonine aldolase                                 144   2e-38   
gb|KKA75043.1|  hypothetical protein PRIPAC_7294                        146   3e-38   
ref|WP_014295561.1|  threonine aldolase                                 147   3e-38   
ref|WP_003125125.1|  hypothetical protein                               144   3e-38   
ref|WP_008194516.1|  MULTISPECIES: threonine aldolase                   147   3e-38   
ref|XP_004416298.1|  PREDICTED: uncharacterized protein R102.4-like     147   3e-38   
ref|WP_028784440.1|  threonine aldolase                                 146   3e-38   
ref|WP_003455159.1|  Low-specificity L-threonine aldolase               146   3e-38   
emb|CEG27461.1|  putative threonine aldolase                            146   3e-38   
gb|EMP32436.1|  hypothetical protein UY3_10400                          147   3e-38   
ref|WP_038067327.1|  threonine aldolase                                 146   3e-38   
ref|WP_045846470.1|  threonine aldolase                                 146   3e-38   
ref|XP_005530759.1|  PREDICTED: uncharacterized protein R102.4-like     147   3e-38   
ref|XP_011564411.1|  PREDICTED: probable low-specificity L-threon...    148   4e-38   
gb|AHD18362.1|  threonine aldolase                                      146   4e-38   
ref|XP_011332668.1|  PREDICTED: probable low-specificity L-threon...    147   4e-38   
ref|WP_037426510.1|  threonine aldolase                                 146   4e-38   
ref|WP_035379564.1|  threonine aldolase                                 146   4e-38   
gb|ACM23118.1|  L-allo-threonine aldolase                               146   4e-38   
ref|WP_025778488.1|  threonine aldolase                                 146   4e-38   
ref|WP_037036076.1|  threonine aldolase                                 146   4e-38   
ref|WP_016979789.1|  threonine aldolase                                 146   4e-38   
ref|XP_005056386.1|  PREDICTED: uncharacterized protein LOC101822012    149   4e-38   
ref|WP_012208016.1|  threonine aldolase                                 146   5e-38   
gb|AEE61991.1|  unknown                                                 147   5e-38   
ref|XP_001862301.1|  L-allo-threonine aldolase                          147   5e-38   
ref|WP_029683814.1|  threonine aldolase                                 146   5e-38   
ref|XP_011332667.1|  PREDICTED: probable low-specificity L-threon...    147   6e-38   
ref|XP_010982152.1|  PREDICTED: probable low-specificity L-threon...    149   6e-38   
ref|WP_017491720.1|  threonine aldolase                                 145   6e-38   
ref|XP_006869717.1|  PREDICTED: uncharacterized protein R102.4-like     147   6e-38   
ref|WP_011943587.1|  MULTISPECIES: threonine aldolase                   145   6e-38   
ref|WP_028617611.1|  threonine aldolase                                 145   7e-38   
ref|WP_038033095.1|  MULTISPECIES: threonine aldolase                   145   7e-38   
ref|WP_034099927.1|  MULTISPECIES: threonine aldolase                   145   7e-38   
ref|XP_011692293.1|  PREDICTED: probable low-specificity L-threon...    146   7e-38   
ref|WP_016743452.1|  threonine aldolase                                 145   7e-38   
ref|XP_005070249.1|  PREDICTED: uncharacterized protein R102.4-like     148   7e-38   
ref|WP_034085836.1|  threonine aldolase                                 143   7e-38   
ref|WP_029529053.1|  MULTISPECIES: threonine aldolase                   145   7e-38   
ref|WP_029611038.1|  threonine aldolase                                 145   7e-38   
ref|WP_028240749.1|  threonine aldolase                                 145   7e-38   
ref|WP_021491468.1|  threonine aldolase                                 145   7e-38   
emb|CDY25132.1|  BnaC07g03750D                                          140   7e-38   
ref|WP_031504717.1|  threonine aldolase                                 145   8e-38   
ref|WP_034789087.1|  threonine aldolase                                 145   8e-38   
ref|WP_045707148.1|  threonine aldolase                                 145   8e-38   
ref|WP_019342021.1|  threonine aldolase                                 145   8e-38   
ref|XP_008577736.1|  PREDICTED: probable low-specificity L-threon...    148   8e-38   
ref|WP_045791709.1|  threonine aldolase                                 145   9e-38   
gb|KKB80098.1|  threonine aldolase                                      145   9e-38   
ref|XP_011503110.1|  PREDICTED: probable low-specificity L-threon...    146   9e-38   
ref|WP_034760672.1|  threonine aldolase                                 145   9e-38   
ref|WP_034012492.1|  threonine aldolase                                 145   9e-38   
ref|WP_043552701.1|  threonine aldolase                                 145   9e-38   
gb|AAT51465.1|  PA0902                                                  145   1e-37   
ref|WP_003112603.1|  MULTISPECIES: threonine aldolase                   145   1e-37   
ref|WP_023084940.1|  hypothetical protein                               145   1e-37   
ref|WP_034054613.1|  threonine aldolase                                 145   1e-37   
ref|WP_033982853.1|  threonine aldolase                                 145   1e-37   
ref|WP_003120729.1|  threonine aldolase                                 145   1e-37   
ref|WP_015838690.1|  threonine aldolase                                 145   1e-37   
ref|XP_004946349.1|  PREDICTED: uncharacterized protein R102.4-like     146   1e-37   
ref|WP_023105499.1|  hypothetical protein                               145   1e-37   
ref|WP_023124923.1|  hypothetical protein                               145   1e-37   
ref|WP_034053251.1|  threonine aldolase                                 145   1e-37   
ref|WP_041686662.1|  threonine aldolase                                 145   1e-37   
ref|WP_003567767.1|  threonine aldolase                                 145   1e-37   
ref|WP_011196526.1|  threonine aldolase                                 145   1e-37   
ref|WP_043087068.1|  threonine aldolase                                 145   1e-37   
ref|WP_034041498.1|  threonine aldolase                                 145   1e-37   
ref|WP_017148803.1|  threonine aldolase                                 145   1e-37   
ref|WP_041479261.1|  threonine aldolase                                 144   1e-37   
ref|WP_004082276.1|  threonine aldolase                                 145   1e-37   
ref|WP_033950956.1|  threonine aldolase                                 144   1e-37   
ref|WP_035551533.1|  threonine aldolase                                 145   1e-37   
ref|XP_010949003.1|  PREDICTED: probable low-specificity L-threon...    145   1e-37   
ref|WP_027612644.1|  threonine aldolase                                 144   1e-37   
ref|WP_016983961.1|  threonine aldolase                                 144   1e-37   
ref|WP_012874185.1|  threonine aldolase                                 145   1e-37   
ref|WP_003123235.1|  threonine aldolase                                 144   1e-37   
ref|WP_018625079.1|  threonine aldolase                                 144   2e-37   
ref|WP_034153323.1|  threonine aldolase                                 144   2e-37   
ref|WP_042303392.1|  threonine aldolase                                 144   2e-37   
ref|WP_026145012.1|  threonine aldolase                                 144   2e-37   
gb|KJJ18498.1|  glycine hydroxymethyltransferase                        145   2e-37   
pdb|1JG8|A  Chain A, Crystal Structure Of Threonine Aldolase (Low...    144   2e-37   
ref|WP_035129814.1|  threonine aldolase                                 144   2e-37   
ref|WP_035297428.1|  threonine aldolase                                 144   2e-37   
ref|WP_015878127.1|  threonine aldolase                                 144   2e-37   
ref|WP_021443542.1|  threonine aldolase                                 144   2e-37   
ref|WP_011335528.1|  threonine aldolase                                 144   2e-37   
ref|WP_007963085.1|  threonine aldolase                                 144   2e-37   
ref|WP_015406796.1|  threonine aldolase                                 144   2e-37   
ref|WP_044898251.1|  threonine aldolase                                 144   2e-37   
ref|XP_008251370.1|  PREDICTED: LOW QUALITY PROTEIN: probable low...    145   2e-37   
ref|WP_038134832.1|  threonine aldolase                                 139   2e-37   
ref|WP_008086086.1|  threonine aldolase                                 144   2e-37   
pdb|2FM1|A  Chain A, Crystal Structure Of L-allo-threonine Aldola...    144   2e-37   
ref|WP_039757944.1|  threonine aldolase                                 144   2e-37   
ref|WP_013574761.1|  MULTISPECIES: threonine aldolase                   144   2e-37   
ref|WP_021488633.1|  threonine aldolase                                 144   2e-37   
gb|KFJ93194.1|  threonine aldolase                                      144   2e-37   
ref|WP_038710129.1|  threonine aldolase                                 144   2e-37   
ref|WP_008679760.1|  threonine aldolase                                 144   2e-37   
ref|WP_021804123.1|  threonine aldolase                                 144   2e-37   
ref|WP_017249163.1|  threonine aldolase                                 144   2e-37   
ref|XP_313472.4|  AGAP003688-PA                                         145   2e-37   
ref|WP_035141711.1|  threonine aldolase                                 144   3e-37   
ref|WP_038669718.1|  threonine aldolase                                 144   3e-37   
ref|WP_012881510.1|  threonine aldolase                                 144   3e-37   
ref|WP_038662087.1|  threonine aldolase                                 144   3e-37   



>ref|XP_006361420.1| PREDICTED: uncharacterized protein R102.4 isoform X1 [Solanum 
tuberosum]
 ref|XP_006361421.1| PREDICTED: uncharacterized protein R102.4 isoform X2 [Solanum 
tuberosum]
 ref|XP_006361422.1| PREDICTED: uncharacterized protein R102.4 isoform X3 [Solanum 
tuberosum]
Length=361

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMV RTVDLRSDTVTKPTEAMR AMA+AEVDDDVLG+DPTAQRLEAE+A+I GKEAGLFV
Sbjct  2    KMVVRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEMARITGKEAGLFV  61

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMDLD
Sbjct  62   PSGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDLD  121

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIRDP FEIC+PTTRLICLENS AHSGGRCLS
Sbjct  122  LIEAAIRDPSFEICYPTTRLICLENSQAHSGGRCLS  157



>ref|XP_009631531.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631532.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631533.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
Length=359

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTEAMR AMA+AEVDDDVLG+DPTAQRLEAEIA+IMGKEAGLFVP
Sbjct  1    MVMRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEIARIMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGI+T+GGVHPRT+KNN+DGTMDLD 
Sbjct  61   SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGIATLGGVHPRTVKNNEDGTMDLDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP FEIC+PTTRLICLENS+AHSGGRCLS
Sbjct  121  IEAAIRDPSFEICYPTTRLICLENSHAHSGGRCLS  155



>ref|XP_009798339.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798340.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798341.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798342.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798343.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=359

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTEAMR AMA+AEVDDDVLG+DPTAQRLEAEIA+IMGKEAGLFVP
Sbjct  1    MVMRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEIARIMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGI+T+GGVHPRT+KNN+DGTMDLD 
Sbjct  61   SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGIATLGGVHPRTVKNNEDGTMDLDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP FEIC+PTTRLICLENS+AHSGGRCLS
Sbjct  121  IEAAIRDPSFEICYPTTRLICLENSHAHSGGRCLS  155



>ref|XP_010319280.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319281.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319282.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
Length=361

 Score =   299 bits (766),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMV RTVDLRSDTVT+PTEAMR AMA+AEVDDDVLG+DPTAQRLEAE+A+I GKEAGLFV
Sbjct  2    KMVVRTVDLRSDTVTRPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEMARITGKEAGLFV  61

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMDLD
Sbjct  62   PSGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDLD  121

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIRDP FEIC+PTTRLICLENS AHSGGRCLS
Sbjct  122  LIEAAIRDPSFEICYPTTRLICLENSQAHSGGRCLS  157



>ref|NP_001275261.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
 ref|XP_006361424.1| PREDICTED: uncharacterized protein R102.4 isoform X5 [Solanum 
tuberosum]
 ref|XP_006361425.1| PREDICTED: uncharacterized protein R102.4 isoform X6 [Solanum 
tuberosum]
 gb|ABB72802.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
Length=359

 Score =   298 bits (764),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTEAMR AMA+AEVDDDVLG+DPTAQRLEAE+A+I GKEAGLFVP
Sbjct  1    MVVRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEMARITGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMDLD 
Sbjct  61   SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDLDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP FEIC+PTTRLICLENS AHSGGRCLS
Sbjct  121  IEAAIRDPSFEICYPTTRLICLENSQAHSGGRCLS  155



>ref|XP_004236787.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236788.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236789.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
Length=359

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVT+PTEAMR AMA+AEVDDDVLG+DPTAQRLEAE+A+I GKEAGLFVP
Sbjct  1    MVVRTVDLRSDTVTRPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEMARITGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMDLD 
Sbjct  61   SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDLDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP FEIC+PTTRLICLENS AHSGGRCLS
Sbjct  121  IEAAIRDPSFEICYPTTRLICLENSQAHSGGRCLS  155



>ref|XP_011101617.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
 ref|XP_011101618.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
Length=359

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTE MRAAMASAEVDDDVLG+DPTA RLE E+A+IMGKEA LFVP
Sbjct  1    MVTRRVDLRSDTVTKPTETMRAAMASAEVDDDVLGYDPTAARLETEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLI VLTHC IRGSE+ILGDYSHIHIYENGGISTIGGVHPRT+KNN+DGTMD++ 
Sbjct  61   SGTMANLICVLTHCQIRGSEVILGDYSHIHIYENGGISTIGGVHPRTVKNNEDGTMDINL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IE AIRDP FEIC+PTTRLICLENS+AHSGGRCLS
Sbjct  121  IEEAIRDPSFEICYPTTRLICLENSHAHSGGRCLS  155



>gb|EPS60604.1| hypothetical protein M569_14199, partial [Genlisea aurea]
Length=322

 Score =   284 bits (726),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV + VDLRSDTVTKPT+ MRAAMA AEVDDDVLG DPTA RLE E+AKIMGKEA LF P
Sbjct  1    MVMKKVDLRSDTVTKPTQTMRAAMADAEVDDDVLGKDPTAARLELEMAKIMGKEAALFTP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVLTHC IRGSE+ILGDYSHIHIYENGGISTIGGVHPRT+KN DDGTMD+D 
Sbjct  61   SGTMANLISVLTHCQIRGSEVILGDYSHIHIYENGGISTIGGVHPRTVKNTDDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPRFEIC+PTTRLICLENS+AHSGGRCL+
Sbjct  121  IEAAIRDPRFEICYPTTRLICLENSHAHSGGRCLT  155



>gb|EYU19887.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19888.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19889.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19890.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
Length=359

 Score =   283 bits (724),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA RLE E+AKIMGKEA LFVP
Sbjct  1    MVTRRVDLRSDTVTKPTEAMRAAMASADVDDDVLGHDPTAARLEKEMAKIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLI VLTHC IRGSE+ILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMD+  
Sbjct  61   SGTMANLICVLTHCQIRGSEVILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDIQL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IE AIRDP FEIC+PTTRLICLENS+AHSGGRCL+
Sbjct  121  IEEAIRDPSFEICYPTTRLICLENSHAHSGGRCLT  155



>ref|XP_008456444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=358

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL +DPTA RLE E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLKYDPTALRLETEMAKIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDNSHIHIYENGGIATIGGVHPRTVRNNGDGTMDLDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR EI FPTTRLICLENS+A+ GGRCLS
Sbjct  121  IEAAIRDPRGEIVFPTTRLICLENSHANCGGRCLS  155



>gb|KDO44518.1| hypothetical protein CISIN_1g0182432mg, partial [Citrus sinensis]
 gb|KDO44519.1| hypothetical protein CISIN_1g0182432mg, partial [Citrus sinensis]
Length=185

 Score =   273 bits (697),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL  DPTA RLE E+AK+MGKEAGLFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLMHDPTAFRLETEMAKVMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNQDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ EI +PTTRLICLEN++A+ GGRCLS
Sbjct  121  IEAAIRDPKGEIVYPTTRLICLENTHANCGGRCLS  155



>gb|AGI05087.1| threonine aldolase, partial [Gossypium aridum]
Length=273

 Score =   275 bits (703),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DPTA RLE+E+AKIMGKEAGLFV 
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMATAEVDDDVLGADPTAARLESEVAKIMGKEAGLFVA  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPR +KNNDDGTMD+  
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRPVKNNDDGTMDIGL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR EI +PTTRLICLENS+A++GGRCLS
Sbjct  121  IEAAIRDPRGEIVYPTTRLICLENSHANTGGRCLS  155



>ref|XP_006442684.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442685.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442686.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442687.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55924.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55925.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55926.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55927.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
Length=297

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL  DPTA RLE E+AK+MGKEAGLFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLMHDPTAFRLETEMAKVMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNKDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ EI +PTTRLICLEN++A+ GGRCLS
Sbjct  121  IEAAIRDPKGEIVYPTTRLICLENTHANCGGRCLS  155



>gb|KHG00003.1| ltaA [Gossypium arboreum]
Length=326

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DPTA RLE+E+AKIMGKEAGLFV 
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMATAEVDDDVLGADPTAARLESEVAKIMGKEAGLFVA  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPR +KNNDDGTMD+  
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRPVKNNDDGTMDIGL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR EI +PTTRLICLENS+A++GGRCLS
Sbjct  121  IEAAIRDPRGEIVYPTTRLICLENSHANTGGRCLS  155



>ref|XP_004139254.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
sativus]
 gb|KGN60769.1| hypothetical protein Csa_2G009560 [Cucumis sativus]
Length=359

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTEAMRAAMASAEVDDDVL +DPTA RLE E+AKIMGKEA LFVP
Sbjct  1    MVKRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLKYDPTALRLETEMAKIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDNSHIHIYENGGIATIGGVHPRTVRNNGDGTMDLDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ FPTTRLICLENS+A+ GGRCLS
Sbjct  121  IEAAIRDPRGELVFPTTRLICLENSHANCGGRCLS  155



>gb|KHG00004.1| ltaA [Gossypium arboreum]
Length=362

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 157/189 (83%), Gaps = 8/189 (4%)
 Frame = +2

Query  140  FLSFAFLIRKGTEQSSQFHL-----WFSRRK---MVTRTVDLRSDTVTKPTEAMRAAMAS  295
            FLSF  +    +    +F L     ++ ++K   MVT+TVDLRSDTVTKPTEAMRAAMA+
Sbjct  3    FLSFLGISSTCSWYGIKFPLGGRENFYQKKKCKTMVTKTVDLRSDTVTKPTEAMRAAMAT  62

Query  296  AEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDY  475
            AEVDDDVLG DPTA RLE+E+AKIMGKEAGLFV SGTMGNLISVL HC IRGSE+ILGD 
Sbjct  63   AEVDDDVLGADPTAARLESEVAKIMGKEAGLFVASGTMGNLISVLVHCDIRGSEVILGDN  122

Query  476  SHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICLENSN  655
             HIHIYENGGISTIGGVHPR +KNNDDGTMD+  IEAAIRDPR EI +PTTRLICLENS+
Sbjct  123  CHIHIYENGGISTIGGVHPRPVKNNDDGTMDIGLIEAAIRDPRGEIVYPTTRLICLENSH  182

Query  656  AHSGGRCLS  682
            A++GGRCLS
Sbjct  183  ANTGGRCLS  191



>ref|XP_007030425.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
 gb|EOY10927.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
Length=319

 Score =   275 bits (703),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ +PTTRLICLENS+A+SGGRCLS
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENSHANSGGRCLS  155



>ref|XP_006487715.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487716.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487717.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Citrus 
sinensis]
 ref|XP_006487718.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Citrus 
sinensis]
Length=359

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL  DPTA RLE E+AK+MGKEAGLFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLMHDPTAFRLETEMAKVMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+I+GD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEIRGSEVIIGDNSHIHIYENGGISTIGGVHPRTVKNNQDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ EI +PTTRLICLEN++A+ GGRCLS
Sbjct  121  IEAAIRDPKGEIVYPTTRLICLENTHANCGGRCLS  155



>gb|KCW61514.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=209

 Score =   270 bits (691),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+  + +PTTRLICLENS+A++GG+CLS
Sbjct  121  IEAAIRDPKGALVYPTTRLICLENSHANTGGKCLS  155



>ref|XP_008388713.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Malus domestica]
Length=371

 Score =   276 bits (706),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  200  WFSRRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKE  379
             FS  KMVTRTVDLRSDTVTKP E MRAAMASAEVDDDVLG DPTA RLE+E+AK+MGKE
Sbjct  7    LFSSPKMVTRTVDLRSDTVTKPCETMRAAMASAEVDDDVLGADPTAFRLESEMAKVMGKE  66

Query  380  AGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDG  559
            A LFVPSGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGI+TIGGVHPRT++NN DG
Sbjct  67   AALFVPSGTMGNLISVLVHCDIRGSEVILGHNSHIHIYENGGIATIGGVHPRTVRNNKDG  126

Query  560  TMDLDQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            TMDLD IEA+IRDPR E+ +PTTRLICLENS A+ GGRCL+
Sbjct  127  TMDLDAIEASIRDPRGELVYPTTRLICLENSQANCGGRCLT  167



>ref|XP_007030422.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
 gb|EOY10924.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
Length=355

 Score =   275 bits (704),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ +PTTRLICLENS+A+SGGRCLS
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENSHANSGGRCLS  155



>ref|XP_007030420.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030421.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10922.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10923.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
Length=358

 Score =   275 bits (704),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ +PTTRLICLENS+A+SGGRCLS
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENSHANSGGRCLS  155



>ref|XP_002325334.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE99715.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=359

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMA+AEVDDDVL +DP+A RLE E+AK+ GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLSYDPSALRLETEMAKVTGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL+SVL HC IRGSE+ILG+ SHIHIYENGGISTIGGVHPRT+KNNDDGTMD+D 
Sbjct  61   SGTMGNLVSVLVHCNIRGSEVILGNNSHIHIYENGGISTIGGVHPRTVKNNDDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR EI +PTTRLICLEN+ A+ GGRCLS
Sbjct  121  IEAAIRDPRGEIVYPTTRLICLENTQANCGGRCLS  155



>gb|KCW61513.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=246

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+  + +PTTRLICLENS+A++GG+CLS
Sbjct  121  IEAAIRDPKGALVYPTTRLICLENSHANTGGKCLS  155



>ref|XP_006442676.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442677.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442678.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442679.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442680.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442681.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442682.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442683.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55916.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55917.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55918.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55919.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55920.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55921.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55922.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55923.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
Length=359

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL  DPTA RLE E+AK+MGKEAGLFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLMHDPTAFRLETEMAKVMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNKDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ EI +PTTRLICLEN++A+ GGRCLS
Sbjct  121  IEAAIRDPKGEIVYPTTRLICLENTHANCGGRCLS  155



>ref|XP_009795458.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=372

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M  RTVD RSDTVTKPTE+MR AMA+AEVDDDVLG+DPTAQRLEAE+A+IMGKEAGLFVP
Sbjct  1    MAVRTVDFRSDTVTKPTESMRNAMANAEVDDDVLGYDPTAQRLEAEMARIMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI +LTHC IRGSE+ILGD SHIH+YENGGISTIGGVHPRT+KNN+DGTMDL  
Sbjct  61   SGTMGNLICLLTHCQIRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNNEDGTMDLHL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRD  FEI +PTTRLICLENS+A SGGRCL+
Sbjct  121  IEAAIRDSSFEILYPTTRLICLENSHARSGGRCLT  155



>ref|XP_007030424.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
 gb|EOY10926.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
Length=357

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ +PTTRLICLENS+A+SGGRCLS
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENSHANSGGRCLS  155



>gb|KCW61508.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=362

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  212  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  391
            +KMVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLF
Sbjct  3    KKMVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLF  62

Query  392  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  571
            VPSGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+
Sbjct  63   VPSGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDI  122

Query  572  DQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            D IEAAIRDP+  + +PTTRLICLENS+A++GG+CLS
Sbjct  123  DLIEAAIRDPKGALVYPTTRLICLENSHANTGGKCLS  159



>gb|ACJ85466.1| unknown [Medicago truncatula]
Length=221

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  212  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  391
             KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LF
Sbjct  14   EKMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALF  73

Query  392  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  571
            VPSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+
Sbjct  74   VPSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDI  133

Query  572  DQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            D IEAAIRDPR E+ FP+TRLICLENS+A+SGGRCLS
Sbjct  134  DLIEAAIRDPRGELMFPSTRLICLENSHANSGGRCLS  170



>gb|KCW61512.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=275

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+  + +PTTRLICLENS+A++GG+CLS
Sbjct  121  IEAAIRDPKGALVYPTTRLICLENSHANTGGKCLS  155



>gb|KJB44861.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=417

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 145/165 (88%), Gaps = 3/165 (2%)
 Frame = +2

Query  197  LWFS---RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKI  367
            +WFS      MV RTVDLRSDTVTKPTE MRAAMA+AEVDDDVLG DPTA RLE+E+AKI
Sbjct  38   IWFSTLNSSTMVARTVDLRSDTVTKPTETMRAAMATAEVDDDVLGADPTAFRLESEVAKI  97

Query  368  MGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKN  547
             GKEAGLFV SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KN
Sbjct  98   TGKEAGLFVSSGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKN  157

Query  548  NDDGTMDLDQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            N+DGTMD+D IE AIRDPR E+ FPTT+LICLENS+A+SGGRCLS
Sbjct  158  NEDGTMDIDSIEVAIRDPRGELVFPTTKLICLENSHANSGGRCLS  202



>ref|XP_007030423.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 ref|XP_007030426.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10925.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10928.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
Length=359

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ +PTTRLICLENS+A+SGGRCLS
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENSHANSGGRCLS  155



>gb|KJB82283.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
 gb|KJB82284.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
Length=358

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT++VDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DPTA RLE+E AKIMGKEAGLFV 
Sbjct  1    MVTKSVDLRSDTVTKPTEAMRAAMATAEVDDDVLGADPTAARLESEAAKIMGKEAGLFVA  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPR +KNNDDGTMD+  
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRPVKNNDDGTMDIGL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR EI +PTTRLICLENS+A++GGRCLS
Sbjct  121  IEAAIRDPRGEIVYPTTRLICLENSHANTGGRCLS  155



>ref|XP_011038517.1| PREDICTED: LOW QUALITY PROTEIN: probable low-specificity L-threonine 
aldolase 1 [Populus euphratica]
Length=356

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTV+KPTEAMRAAMA+AEVDDDVLG DP+A RLE E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVSKPTEAMRAAMANAEVDDDVLGHDPSALRLETEMAKIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC IRGSE+ILG+ SHIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMSNLISVLVHCNIRGSEVILGNKSHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR EI +PTTRLICLENS    GGRCLS
Sbjct  121  IEAAIRDPRGEIVYPTTRLICLENSQGSCGGRCLS  155



>ref|XP_004495576.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
Length=370

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLG DPTA  LE E+AKIMGKEA LFV
Sbjct  15   KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGNDPTAFLLETEMAKIMGKEAALFV  74

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLI VL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNNDDGTMD+D
Sbjct  75   PSGTMGNLICVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNDDGTMDID  134

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEA IR+PR+++ +PTTRLICLENS+A+SGGRCLS
Sbjct  135  LIEANIRNPRWDLMYPTTRLICLENSHANSGGRCLS  170



>gb|KJB44863.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=339

 Score =   272 bits (696),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTE MRAAMA+AEVDDDVLG DPTA RLE+E+AKI GKEAGLFV 
Sbjct  1    MVARTVDLRSDTVTKPTETMRAAMATAEVDDDVLGADPTAFRLESEVAKITGKEAGLFVS  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDIDS  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IE AIRDPR E+ FPTT+LICLENS+A+SGGRCLS
Sbjct  121  IEVAIRDPRGELVFPTTKLICLENSHANSGGRCLS  155



>ref|XP_002319106.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE95029.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=356

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTV+KPTEAMRAAMA+AEVDDDVLG DP+A RLE E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVSKPTEAMRAAMANAEVDDDVLGHDPSALRLETEMAKIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC IRGSE+ILG  SHIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMSNLISVLVHCNIRGSEVILGSKSHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR EI +PTTRLICLENS    GGRCLS
Sbjct  121  IEAAIRDPRGEIVYPTTRLICLENSQGSCGGRCLS  155



>gb|KJB44860.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=370

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTE MRAAMA+AEVDDDVLG DPTA RLE+E+AKI GKEAGLFV 
Sbjct  1    MVARTVDLRSDTVTKPTETMRAAMATAEVDDDVLGADPTAFRLESEVAKITGKEAGLFVS  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDIDS  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IE AIRDPR E+ FPTT+LICLENS+A+SGGRCLS
Sbjct  121  IEVAIRDPRGELVFPTTKLICLENSHANSGGRCLS  155



>ref|XP_004495577.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=355

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLG DPTA  LE E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGNDPTAFLLETEMAKIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI VL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNNDDGTMD+D 
Sbjct  61   SGTMGNLICVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNDDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEA IR+PR+++ +PTTRLICLENS+A+SGGRCLS
Sbjct  121  IEANIRNPRWDLMYPTTRLICLENSHANSGGRCLS  155



>ref|XP_010024956.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024958.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024959.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024960.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024961.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024962.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024963.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 gb|KCW61509.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
 gb|KCW61510.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=358

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+  + +PTTRLICLENS+A++GG+CLS
Sbjct  121  IEAAIRDPKGALVYPTTRLICLENSHANTGGKCLS  155



>ref|XP_003590972.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61223.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=370

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFV
Sbjct  15   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFV  74

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D
Sbjct  75   PSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDID  134

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIRDPR E+ FP+TRLICLENS+A+SGGRCLS
Sbjct  135  LIEAAIRDPRGELMFPSTRLICLENSHANSGGRCLS  170



>ref|XP_012089322.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X1 [Jatropha curcas]
Length=383

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  209  RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGL  388
            + KMVTRTVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DP A RL+ E+A+IMGKEA L
Sbjct  23   KVKMVTRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLGDDPNALRLQTEMARIMGKEAAL  82

Query  389  FVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMD  568
            FVPSGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGIST+GGVHPRT+KNN DGTMD
Sbjct  83   FVPSGTMGNLISVLVHCDIRGSEVILGHDSHIHIYENGGISTLGGVHPRTVKNNKDGTMD  142

Query  569  LDQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            +D IEAAIRDP++++ +PTTRLICLENS+A+ GGRCLS
Sbjct  143  IDLIEAAIRDPKWQLVYPTTRLICLENSHANCGGRCLS  180



>ref|XP_007205422.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 ref|XP_007205423.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06621.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06622.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
Length=359

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTE MRAAMASAEVDDDVLG DPTA RLE+E+AKI GKEA LFVP
Sbjct  1    MVTKTVDLRSDTVTKPTETMRAAMASAEVDDDVLGNDPTAFRLESEMAKITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGISTIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHNSHIHIYENGGISTIGGVHPRTVRNNKDGTMDLDS  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ +PTTRLICLENS+A+ GGRCL+
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENSHANCGGRCLT  155



>ref|XP_003590973.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61224.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=396

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFV
Sbjct  41   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFV  100

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D
Sbjct  101  PSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDID  160

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIRDPR E+ FP+TRLICLENS+A+SGGRCLS
Sbjct  161  LIEAAIRDPRGELMFPSTRLICLENSHANSGGRCLS  196



>gb|KCW61511.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=365

 Score =   271 bits (693),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+  + +PTTRLICLENS+A++GG+CLS
Sbjct  121  IEAAIRDPKGALVYPTTRLICLENSHANTGGKCLS  155



>ref|XP_008388714.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388715.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388716.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
Length=359

 Score =   271 bits (692),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKP E MRAAMASAEVDDDVLG DPTA RLE+E+AK+MGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPCETMRAAMASAEVDDDVLGADPTAFRLESEMAKVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGI+TIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHNSHIHIYENGGIATIGGVHPRTVRNNKDGTMDLDA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEA+IRDPR E+ +PTTRLICLENS A+ GGRCL+
Sbjct  121  IEASIRDPRGELVYPTTRLICLENSQANCGGRCLT  155



>ref|XP_008218319.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218320.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218321.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218322.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218323.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
Length=359

 Score =   270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTE MRAAMASAEVDDDVLG DPTA RLE+E+AKI GKEA LFVP
Sbjct  1    MVTKTVDLRSDTVTKPTETMRAAMASAEVDDDVLGNDPTAFRLESEMAKITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGIST+GGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHNSHIHIYENGGISTLGGVHPRTVRNNKDGTMDLDS  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ +PTTRLICLENS+A+ GGRCL+
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENSHANCGGRCLT  155



>ref|XP_002521974.1| l-allo-threonine aldolase, putative [Ricinus communis]
 gb|EEF40378.1| l-allo-threonine aldolase, putative [Ricinus communis]
Length=358

 Score =   270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG+DP+A RLE E+AKIMGKEA L+VP
Sbjct  1    MVMRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLGYDPSAFRLETEMAKIMGKEAALYVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILG  SHIHI+ENGGIST+GGVHPRT++NN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCNIRGSEVILGHNSHIHIFENGGISTLGGVHPRTVQNNKDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ +PTTRLICLENS+A+ GGRCLS
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENSHANCGGRCLS  155



>ref|XP_010694951.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010694952.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
Length=371

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            +MV R VD+RSDTVTKPTEAMRAAMA AEVDDDVLG+DPTA RLE E+A+IMGKEAGLFV
Sbjct  12   EMVKRVVDMRSDTVTKPTEAMRAAMAIAEVDDDVLGYDPTALRLETEMARIMGKEAGLFV  71

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLI VL HC +RGSE+ILGD SHIHIYENGGIST+GGVHPRT+KNN DGTMDLD
Sbjct  72   PSGTMGNLICVLVHCDVRGSEVILGDISHIHIYENGGISTLGGVHPRTVKNNIDGTMDLD  131

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIRDP+ E+ +P TRLIC+ENS+A+SGGRCLS
Sbjct  132  LIEAAIRDPKGELYYPRTRLICIENSHANSGGRCLS  167



>gb|AES61221.2| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=355

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFVP
Sbjct  1    MVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D 
Sbjct  61   SGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR E+ FP+TRLICLENS+A+SGGRCLS
Sbjct  121  IEAAIRDPRGELMFPSTRLICLENSHANSGGRCLS  155



>ref|XP_012089323.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X2 [Jatropha curcas]
 ref|XP_012089324.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X2 [Jatropha curcas]
 ref|XP_012089326.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X2 [Jatropha curcas]
 ref|XP_012089327.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X2 [Jatropha curcas]
 ref|XP_012089328.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X2 [Jatropha curcas]
Length=358

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DP A RL+ E+A+IMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLGDDPNALRLQTEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGIST+GGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHDSHIHIYENGGISTLGGVHPRTVKNNKDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP++++ +PTTRLICLENS+A+ GGRCLS
Sbjct  121  IEAAIRDPKWQLVYPTTRLICLENSHANCGGRCLS  155



>ref|XP_003590970.1| L-allo-threonine aldolase [Medicago truncatula]
Length=463

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFV
Sbjct  57   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFV  116

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D
Sbjct  117  PSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDID  176

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIRDPR E+ FP+TRLICLENS+A+SGGRCLS
Sbjct  177  LIEAAIRDPRGELMFPSTRLICLENSHANSGGRCLS  212



>gb|AFK38526.1| unknown [Medicago truncatula]
Length=370

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFV
Sbjct  15   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFV  74

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLI VL HC IRGSE+ILGD   I+IYENGGISTIGGVHPR +KNNDDGT+D+D
Sbjct  75   PSGTMGNLICVLVHCDIRGSEVILGDNCRINIYENGGISTIGGVHPRQVKNNDDGTIDID  134

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIRDPR E+ FP+TRLICLENS+A+SGGRCLS
Sbjct  135  LIEAAIRDPRGELMFPSTRLICLENSHANSGGRCLS  170



>ref|XP_011036295.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036297.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036298.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036299.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036300.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
Length=359

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTEAMRAAMA+AEVDDDVL  DP+A RLE E+AK+ GKEA LFVP
Sbjct  1    MVARTVDLRSDTVTKPTEAMRAAMANAEVDDDVLSHDPSALRLETEMAKVTGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL+SVL HC IRGSE+ILG+  HIHI+ENGGISTIGGVHPRT+KNNDDGTMD+D 
Sbjct  61   SGTMGNLVSVLVHCNIRGSEVILGNNCHIHIFENGGISTIGGVHPRTVKNNDDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDPR EI FPTTRLICLEN+ A+ GGRCLS
Sbjct  121  IEAAIRDPRGEIVFPTTRLICLENTQANCGGRCLS  155



>ref|XP_009364444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364445.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364446.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
Length=359

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKP E MR AMASAEVDDDVLG DPTA RLE+E+AK+MGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPCETMRTAMASAEVDDDVLGADPTAFRLESEMAKVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILG  SHIH+YENGGI+TIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHNSHIHVYENGGIATIGGVHPRTVRNNKDGTMDLDA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEA+IRDPR E+ +PTTRLICLENS+A+ GGRCL+
Sbjct  121  IEASIRDPRGELVYPTTRLICLENSHANCGGRCLT  155



>gb|ACJ84635.1| unknown [Medicago truncatula]
Length=166

 Score =   261 bits (666),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTE MR AMA+AEVDDDVLG DP+  RLE E+AKI GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRVAMANAEVDDDVLGRDPSCFRLEEEMAKITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPRTVRNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ E+ +PTTRLICLENS+ ++GGRCLS
Sbjct  121  IEAAIRDPKGELVYPTTRLICLENSHGNTGGRCLS  155



>ref|XP_007144017.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 ref|XP_007144018.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16011.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16012.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
Length=365

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG DPTA RLEAE+AK MGKEA LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGNDPTAFRLEAEMAKTMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI VL HC +RGSE+ILGD  HI+IYENGGI+TIGGVHPR +KNNDDGTMD+D 
Sbjct  61   SGTMGNLICVLVHCDVRGSEVILGDNCHIYIYENGGIATIGGVHPRPVKNNDDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IE AIRDPR E+ +PTT+LICLEN++A+SGGRCLS
Sbjct  121  IETAIRDPRGELLYPTTKLICLENTHANSGGRCLS  155



>gb|KJB46043.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
 gb|KJB46044.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=358

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M TRTVDLRSDTVTKPTEAMRAAMA+AEVDDDV G DPTA +L++E+AK+MGKEAGLFVP
Sbjct  1    MATRTVDLRSDTVTKPTEAMRAAMATAEVDDDVFGADPTAVKLQSEVAKMMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILG+ SHIHIYENGGI+TIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGNNSHIHIYENGGIATIGGVHPRPVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            IE AIRDPR E+ +PTTRLICLENS+ ++GGRCL
Sbjct  121  IEDAIRDPRGELVYPTTRLICLENSHGNTGGRCL  154



>gb|KHG25609.1| L-allo-threonine aldolase [Gossypium arboreum]
Length=358

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M TRTVDLRSDTVTKPTEAMRAAMA+AEVDDDV G DPTA +L++E+AK+MGKEAGLFVP
Sbjct  1    MATRTVDLRSDTVTKPTEAMRAAMATAEVDDDVFGADPTAVKLQSEVAKMMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILG+ SHIHIYENGGI+TIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGNNSHIHIYENGGIATIGGVHPRPVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            IE AIRDPR E+ +PTTRLICLENS+ ++GGRCL
Sbjct  121  IEDAIRDPRGELVYPTTRLICLENSHGNTGGRCL  154



>gb|KHN04944.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP  E+ +PTT+LICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPMGELFYPTTKLICLENTHANSGGRCLS  155



>gb|KGN66767.1| hypothetical protein Csa_1G681130 [Cucumis sativus]
Length=229

 Score =   261 bits (666),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE E+AKIMGKE GLFVP
Sbjct  1    MVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEEMAKIMGKEEGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR+P+ ++ FPTTRLICLEN++A+SGG+CLS
Sbjct  121  IEAAIRNPKGQLFFPTTRLICLENTHANSGGKCLS  155



>ref|XP_002266992.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633695.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633696.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_010660226.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
Length=364

 Score =   265 bits (678),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTE MRAAMA AEVDDDVL  DPTA+RLE E+A+I GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRAAMAIAEVDDDVLVCDPTAERLETEMARITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIHIYENGGIST+GGVHPRT+KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHIYENGGISTLGGVHPRTVKNNEDGTMDINL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            IEAAIRDPR E+ +PTTRLICLEN++A+ GGRCL
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENTHANCGGRCL  154



>ref|XP_008802139.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Phoenix dactylifera]
Length=359

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTKPTEAMRAAMASADVDDDVLGSDPTAHRFESEMARVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMDLDQ
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDLDQ  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P   + +PTTRLICLEN++A+ GGRC+S
Sbjct  121  IEAAIRHPEGALYYPTTRLICLENTHANCGGRCIS  155



>ref|XP_006588445.1| PREDICTED: uncharacterized protein LOC100790890 isoform X1 [Glycine 
max]
 gb|KHN14818.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGKEA LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL+SVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGT+D+D 
Sbjct  61   SGTMGNLVSVLVHCDVRGSEVILGDNCHINIFENGGIATIGGVHPRQVKNNDDGTIDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP  E+ +PTT+LICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPMGELFYPTTKLICLENTHANSGGRCLS  155



>gb|AFK43649.1| unknown [Lotus japonicus]
Length=358

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M TRTVDLRSDTVTKPTEAMR AMA+A+VDDDVLG DPT  RLE E+AKIMGKEA LFVP
Sbjct  1    MATRTVDLRSDTVTKPTEAMRTAMANADVDDDVLGHDPTCFRLETEMAKIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDNSHIHIYENGGIATIGGVHPRTVRNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR+P  E+ +PTTRLICLEN++ +SGGRCLS
Sbjct  121  IEAAIRNPNLELIYPTTRLICLENTHGNSGGRCLS  155



>ref|XP_006606452.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=390

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  209  RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGL  388
            +  MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A L
Sbjct  8    QENMVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAAL  67

Query  389  FVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMD  568
            FVPSGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD
Sbjct  68   FVPSGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMD  127

Query  569  LDQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            +D IEAAIRDP  E+ +PTT+LICLEN++A+SGGRCLS
Sbjct  128  IDLIEAAIRDPMGELFYPTTKLICLENTHANSGGRCLS  165



>ref|XP_008802141.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Phoenix dactylifera]
Length=333

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTKPTEAMRAAMASADVDDDVLGSDPTAHRFESEMARVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMDLDQ
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDLDQ  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P   + +PTTRLICLEN++A+ GGRC+S
Sbjct  121  IEAAIRHPEGALYYPTTRLICLENTHANCGGRCIS  155



>gb|ACJ85157.1| unknown [Medicago truncatula]
 gb|AFK44463.1| unknown [Medicago truncatula]
Length=421

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPT   LE E+AK+MGKEA LFV
Sbjct  66   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTVLLLETEMAKMMGKEAALFV  125

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR  KNNDDGT+D+D
Sbjct  126  PSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQAKNNDDGTIDID  185

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIRDPR E+ FP+TRLICLENS+ +SGGRCLS
Sbjct  186  LIEAAIRDPRGELMFPSTRLICLENSHVNSGGRCLS  221



>ref|NP_001242307.1| uncharacterized protein LOC100790890 [Glycine max]
 gb|ACU17690.1| unknown [Glycine max]
Length=360

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGKEA LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL+SVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGT+D+D 
Sbjct  61   SGTMGNLVSVLVHCDVRGSEVILGDNCHINIFENGGIATIGGVHPRQVKNNDDGTIDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP  E+ +PTT+LICLEN++A SGGRCLS
Sbjct  121  IEAAIRDPMGELFYPTTKLICLENTHADSGGRCLS  155



>ref|XP_006606453.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Glycine 
max]
Length=380

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP  E+ +PTT+LICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPMGELFYPTTKLICLENTHANSGGRCLS  155



>gb|KJB46045.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=388

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M TRTVDLRSDTVTKPTEAMRAAMA+AEVDDDV G DPTA +L++E+AK+MGKEAGLFVP
Sbjct  1    MATRTVDLRSDTVTKPTEAMRAAMATAEVDDDVFGADPTAVKLQSEVAKMMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILG+ SHIHIYENGGI+TIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGNNSHIHIYENGGIATIGGVHPRPVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            IE AIRDPR E+ +PTTRLICLENS+ ++GGRCL
Sbjct  121  IEDAIRDPRGELVYPTTRLICLENSHGNTGGRCL  154



>ref|XP_009389078.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Musa 
acuminata subsp. malaccensis]
Length=359

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMASA+VDDDVL  DPTAQR E E+A+IMGKEA +FVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASADVDDDVLSGDPTAQRFEEEVARIMGKEAAVFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIHIYENGGIS+IGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHIYENGGISSIGGVHPRTVKNNPDGTMDIDR  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P   + +PTTRLICLEN++A+ GGRC+S
Sbjct  121  IEAAIRHPDGALYYPTTRLICLENTHANCGGRCIS  155



>ref|XP_003556456.2| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
Length=421

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  209  RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGL  388
            +  MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A L
Sbjct  59   QENMVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAAL  118

Query  389  FVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMD  568
            FVPSGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD
Sbjct  119  FVPSGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMD  178

Query  569  LDQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            +D IEAAIRDP  E+ +PTT+LICLEN++A+SGGRCLS
Sbjct  179  IDLIEAAIRDPMGELFYPTTKLICLENTHANSGGRCLS  216



>gb|ADI24921.1| L-allo-threonine aldolase [Carica papaya]
Length=360

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVT+PTE MRAAM +AEVDDDVL  DPTA  LE+E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTRPTEEMRAAMVTAEVDDDVLAHDPTAFLLESEMAKIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IR SE++LGD SHIHIYENGGI+TIGGVHPRT+KNN+DGTMD+  
Sbjct  61   SGTMGNLISVLVHCDIRASEVVLGDNSHIHIYENGGIATIGGVHPRTVKNNEDGTMDIHS  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP  E+ FPTTRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPAGELLFPTTRLICLENTHANSGGRCLS  155



>gb|KEH24599.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=358

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTE MR AMA+AEVDDDVLG DP+  RLE E+AKI GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRVAMANAEVDDDVLGRDPSCFRLEEEMAKITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPRTVRNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ E+ +PTTRLICLENS+ ++GGRCLS
Sbjct  121  IEAAIRDPKGELVYPTTRLICLENSHGNTGGRCLS  155



>gb|AFK40044.1| unknown [Medicago truncatula]
Length=358

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTE MR AMA+AEVDDDVLG DP+  RLE E+AKI GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRVAMANAEVDDDVLGRDPSCFRLEEEMAKITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPRTVRNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ E+ +PTTRLICLENS+ ++GGRCLS
Sbjct  121  IEAAIRDPKGELVYPTTRLICLENSHGNTGGRCLS  155



>ref|XP_004494746.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
 ref|XP_004494747.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=358

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M TRTVD+RSDTVTKPTE+MR AMA+A+VDDDVLG DP+  RLE E+AKIMGKEAGLFVP
Sbjct  1    MATRTVDIRSDTVTKPTESMRVAMANADVDDDVLGRDPSCFRLENEVAKIMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYE GGI+TIGGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYELGGIATIGGVHPRTVRNNEDGTMDVDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ E+ +PTTRLICLENS+ ++GGRCLS
Sbjct  121  IEAAIRDPKAELAYPTTRLICLENSHGNTGGRCLS  155



>ref|XP_008453668.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Cucumis melo]
Length=382

 Score =   263 bits (673),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE ++AKIMGKE GLFV
Sbjct  42   KMVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEKMAKIMGKEGGLFV  101

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLIS+L HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D
Sbjct  102  PSGTMGNLISILVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDID  161

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIR+P+ ++ FPTTRLICLEN++A+SGG+CLS
Sbjct  162  LIEAAIRNPKGQLFFPTTRLICLENTHANSGGKCLS  197



>ref|XP_006606451.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=441

 Score =   265 bits (677),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  209  RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGL  388
            +  MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A L
Sbjct  59   QENMVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAAL  118

Query  389  FVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMD  568
            FVPSGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD
Sbjct  119  FVPSGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMD  178

Query  569  LDQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            +D IEAAIRDP  E+ +PTT+LICLEN++A+SGGRCLS
Sbjct  179  IDLIEAAIRDPMGELFYPTTKLICLENTHANSGGRCLS  216



>ref|XP_010246795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nelumbo 
nucifera]
Length=358

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DPTA R EAEIA+I GKEA LFVP
Sbjct  1    MVVRKVDLRSDTVTKPTEAMRAAMANAEVDDDVLGADPTACRFEAEIARITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIH+YENGGISTIG VH RT+KNN DGTMD+  
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDISHIHVYENGGISTIGHVHSRTVKNNSDGTMDISL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ E+ +PTTRLICLEN++A+SGGRC+S
Sbjct  121  IEAAIRDPKGELFYPTTRLICLENTHANSGGRCIS  155



>ref|XP_011660269.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
sativus]
 ref|XP_011660270.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
sativus]
 ref|XP_011660271.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
sativus]
Length=358

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE E+AKIMGKE GLFVP
Sbjct  1    MVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEEMAKIMGKEEGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR+P+ ++ FPTTRLICLEN++A+SGG+CLS
Sbjct  121  IEAAIRNPKGQLFFPTTRLICLENTHANSGGKCLS  155



>emb|CAN82414.1| hypothetical protein VITISV_039151 [Vitis vinifera]
Length=397

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTE MRAAMA AEVDDDVL  DPTA+RLE E+A+I GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRAAMAIAEVDDDVLVCDPTAERLETEMARITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIHIYENGGIST+GGVHPRT+KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHIYENGGISTLGGVHPRTVKNNEDGTMDINL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            IEAAIRDPR E+ +PTTRLICLEN++A+ GGRCL
Sbjct  121  IEAAIRDPRGELVYPTTRLICLENTHANCGGRCL  154



>ref|XP_002892465.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68724.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVTKPT+AMR AM SAEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTKPTDAMREAMCSAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLEA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>ref|XP_008453667.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Cucumis melo]
Length=392

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE ++AKIMGKE GLFV
Sbjct  42   KMVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEKMAKIMGKEGGLFV  101

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLIS+L HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D
Sbjct  102  PSGTMGNLISILVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDID  161

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIR+P+ ++ FPTTRLICLEN++A+SGG+CLS
Sbjct  162  LIEAAIRNPKGQLFFPTTRLICLENTHANSGGKCLS  197



>gb|KJB44862.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=413

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 141/165 (85%), Gaps = 7/165 (4%)
 Frame = +2

Query  197  LWFS---RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKI  367
            +WFS      MV RTVDLRSDTVTKPTE MRAAMA+AEVDDDVLG DPTA RLE+E+AKI
Sbjct  38   IWFSTLNSSTMVARTVDLRSDTVTKPTETMRAAMATAEVDDDVLGADPTAFRLESEVAKI  97

Query  368  MGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKN  547
             GKEAGLFV SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KN
Sbjct  98   TGKEAGLFVSSGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKN  157

Query  548  NDDGTMDLDQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            N+DGTMD+D IE AIRDPR E+ FPTT+LICLENS+A    +CLS
Sbjct  158  NEDGTMDIDSIEVAIRDPRGELVFPTTKLICLENSHA----KCLS  198



>ref|XP_010906811.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Elaeis guineensis]
Length=365

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKPTEAMRAAMASA+V+DDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  7    MVMRRVDLRSDTVTKPTEAMRAAMASADVEDDVLGSDPTAHRFESEMARVMGKEAALFVP  66

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KN  DGTMDLDQ
Sbjct  67   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNKSDGTMDLDQ  126

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P   + +PTTRLICLEN++A+ GGRC+S
Sbjct  127  IEAAIRHPEGALYYPTTRLICLENTHANCGGRCIS  161



>ref|XP_008453666.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Cucumis melo]
Length=400

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            KMV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE ++AKIMGKE GLFV
Sbjct  42   KMVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEKMAKIMGKEGGLFV  101

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLIS+L HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D
Sbjct  102  PSGTMGNLISILVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDID  161

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             IEAAIR+P+ ++ FPTTRLICLEN++A+SGG+CLS
Sbjct  162  LIEAAIRNPKGQLFFPTTRLICLENTHANSGGKCLS  197



>ref|XP_010906812.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
 ref|XP_010906813.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
Length=359

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKPTEAMRAAMASA+V+DDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  1    MVMRRVDLRSDTVTKPTEAMRAAMASADVEDDVLGSDPTAHRFESEMARVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KN  DGTMDLDQ
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNKSDGTMDLDQ  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P   + +PTTRLICLEN++A+ GGRC+S
Sbjct  121  IEAAIRHPEGALYYPTTRLICLENTHANCGGRCIS  155



>ref|XP_010906817.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=335

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA  LE+E+AK+ GKEA LFVP
Sbjct  1    MVKRTVDLRSDTVTKPTEAMRAAMASADVDDDVLGSDPTAHHLESEMAKLTGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIH+ ENGGISTIGGVHP+ +KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDTSHIHVLENGGISTIGGVHPKAVKNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P   + FPTTRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRSPDGALFFPTTRLICLENTHANSGGRCLS  155



>ref|XP_010906814.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
 ref|XP_010906816.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=359

 Score =   260 bits (665),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA  LE+E+AK+ GKEA LFVP
Sbjct  1    MVKRTVDLRSDTVTKPTEAMRAAMASADVDDDVLGSDPTAHHLESEMAKLTGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIH+ ENGGISTIGGVHP+ +KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDTSHIHVLENGGISTIGGVHPKAVKNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P   + FPTTRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRSPDGALFFPTTRLICLENTHANSGGRCLS  155



>ref|XP_012069248.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Jatropha 
curcas]
 gb|KDP40730.1| hypothetical protein JCGZ_24729 [Jatropha curcas]
Length=160

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DP A RL+ E+A+IMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLGDDPNALRLQTEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGIST+GGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHDSHIHIYENGGISTLGGVHPRTVKNNKDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNA  658
            IEAAIRDP++++ +PTTRLICLENS+A
Sbjct  121  IEAAIRDPKWQLVYPTTRLICLENSHA  147



>ref|XP_010906809.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=387

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKPTEAMRAAMASA+V+DDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  29   MVMRRVDLRSDTVTKPTEAMRAAMASADVEDDVLGSDPTAHRFESEMARVMGKEAALFVP  88

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KN  DGTMDLDQ
Sbjct  89   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNKSDGTMDLDQ  148

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P   + +PTTRLICLEN++A+ GGRC+S
Sbjct  149  IEAAIRHPEGALYYPTTRLICLENTHANCGGRCIS  183



>gb|KGN66765.1| hypothetical protein Csa_1G680120 [Cucumis sativus]
Length=331

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
            +R +DLRSDTVTKPTE MRAAMA AEVDDDVLG DP A  LE E+AKIMGKE GLFVPSG
Sbjct  4    SRKIDLRSDTVTKPTETMRAAMAMAEVDDDVLGNDPIAVELEEEMAKIMGKEGGLFVPSG  63

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVH RT+KN DDGTMD+D IE
Sbjct  64   TMGNLISVLVHCEIRGSEVILGDSSHIHIYENGGIATIGGVHSRTVKNKDDGTMDIDLIE  123

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            AAIRDP+ ++ FPTTRLICLEN++A+SGGRCL
Sbjct  124  AAIRDPKGDLFFPTTRLICLENTHANSGGRCL  155



>ref|XP_010906810.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=384

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKPTEAMRAAMASA+V+DDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  26   MVMRRVDLRSDTVTKPTEAMRAAMASADVEDDVLGSDPTAHRFESEMARVMGKEAALFVP  85

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KN  DGTMDLDQ
Sbjct  86   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNKSDGTMDLDQ  145

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P   + +PTTRLICLEN++A+ GGRC+S
Sbjct  146  IEAAIRHPEGALYYPTTRLICLENTHANCGGRCIS  180



>gb|AAF99780.1|AC003981_30 F22O13.11 [Arabidopsis thaliana]
Length=352

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMDLEA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>ref|NP_001077492.1| threonine aldolase [Arabidopsis thaliana]
 dbj|BAH19728.1| AT1G08630 [Arabidopsis thaliana]
 gb|AEE28324.1| threonine aldolase [Arabidopsis thaliana]
Length=344

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMDLEA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>gb|KDP23711.1| hypothetical protein JCGZ_23544 [Jatropha curcas]
Length=354

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 4/155 (3%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DP A RL+ E+A+IMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLGDDPNALRLQTEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGIST+GGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHDSHIHIYENGGISTLGGVHPRTVKNNKDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP++++ +PTTRLICLENS+A    +CLS
Sbjct  121  IEAAIRDPKWQLVYPTTRLICLENSHA----KCLS  151



>gb|AAM63785.1| unknown [Arabidopsis thaliana]
Length=358

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMDLEA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>ref|XP_009118358.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118360.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118361.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118362.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118363.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVT+PT+AMR AM SAEVDDDVLG+DPTA+RLE EIAK+MGKEA LFVP
Sbjct  1    MVMRTVDLRSDTVTRPTDAMREAMGSAEVDDDVLGYDPTARRLEEEIAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI ++ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICIMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLGA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>ref|NP_563822.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849614.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849615.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_001031001.2| threonine aldolase [Arabidopsis thaliana]
 sp|Q8RXU4.1|THA1_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 1; 
AltName: Full=Threonine aldolase 1 [Arabidopsis thaliana]
 gb|AAL86346.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51302.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01898.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28320.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28321.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28322.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28323.1| threonine aldolase [Arabidopsis thaliana]
Length=358

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMDLEA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>ref|XP_004142582.2| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
sativus]
Length=360

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
            +R +DLRSDTVTKPTE MRAAMA AEVDDDVLG DP A  LE E+AKIMGKE GLFVPSG
Sbjct  4    SRKIDLRSDTVTKPTETMRAAMAMAEVDDDVLGNDPIAVELEEEMAKIMGKEGGLFVPSG  63

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVH RT+KN DDGTMD+D IE
Sbjct  64   TMGNLISVLVHCEIRGSEVILGDSSHIHIYENGGIATIGGVHSRTVKNKDDGTMDIDLIE  123

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            AAIRDP+ ++ FPTTRLICLEN++A+SGGRCL
Sbjct  124  AAIRDPKGDLFFPTTRLICLENTHANSGGRCL  155



>ref|XP_010475669.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010475670.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVT+PT+AMR AM  AEVDDDVLG+DPTA+RLE E+AK+MGKEAGLFVP
Sbjct  1    MVMRNVDLRSDTVTRPTDAMREAMCGAEVDDDVLGYDPTARRLEDEMAKMMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLAA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>ref|XP_009148115.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148116.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148118.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVT+PT+AMR AMASAEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTRPTDAMREAMASAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDTCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLVA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>ref|XP_007147215.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 ref|XP_007147216.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19209.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19210.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
Length=362

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M  + VDLRSDTVTKPTEAMR+AMASAEVDDDVLG DP+  RLE EIAK+ GKEA LFVP
Sbjct  1    MGAKIVDLRSDTVTKPTEAMRSAMASAEVDDDVLGRDPSCFRLETEIAKLFGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDDSHIHIYENGGIATLGGVHPRTVKNNEDGTMDIDL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ E+ +PTTRLICLEN++ + GGRCLS
Sbjct  121  IEAAIRDPKGELVYPTTRLICLENTHGNCGGRCLS  155



>ref|XP_010489194.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489200.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489206.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVT+PT+AMR AM  AEVDDDVLG+DPTA+RLE E+AK+MGKEAGLFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCGAEVDDDVLGYDPTARRLEDEMAKMMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLAA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+ GGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANCGGRCLS  155



>emb|CDX95045.1| BnaC05g06260D [Brassica napus]
Length=358

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVT+PT+AMR AMASAEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTRPTDAMREAMASAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TI+N +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDTCHIHVYENGGISTIGGVHPKTIRNEEDGTMDLVA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTLYPSTRLICLENTHANSGGRCLS  155



>emb|CDY06323.1| BnaA09g48800D [Brassica napus]
Length=358

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVT+PT+AMR AM SAEVDDDVLG+DPTA+RLE EIAK+MGKEA LFVP
Sbjct  1    MVMRTVDLRSDTVTRPTDAMREAMGSAEVDDDVLGYDPTARRLEEEIAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTM+L  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMELGA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPLTRLICLENTHANSGGRCLS  155



>ref|XP_010458106.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458107.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458108.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVT+PT+AMR AM  AEVDDDVLG+DPTA+RLE E+AK+MGKEAGLFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCGAEVDDDVLGYDPTARRLEDEMAKMMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLAA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+ GGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANCGGRCLS  155



>ref|XP_006417664.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
 gb|ESQ36017.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
Length=358

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV ++VDLRSDTVT+PT+AMR AM SAEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMKSVDLRSDTVTRPTDAMREAMGSAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI V+ HC +RGSE+ILGD SHIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPKTIKNEEDGTMDLAA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+ GGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANCGGRCLS  155



>emb|CDY22672.1| BnaC08g43060D [Brassica napus]
Length=358

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVT+PT+AMR AM SAEVDDDVLG+DPTA+ LE EIAK+MGKEA LFVP
Sbjct  1    MVMRTVDLRSDTVTRPTDAMREAMGSAEVDDDVLGYDPTARHLEEEIAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLGA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            +EAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  VEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>ref|XP_009110878.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=369

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVT+PT+AMR AMA AEVDDD+LG+DPTA+ LE E+AK+MGKEA LFVP
Sbjct  1    MVIRSVDLRSDTVTRPTDAMREAMAGAEVDDDILGYDPTARHLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI V+ HC +RGSE+ILGD SHIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPKTIKNEEDGTMDLGD  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>ref|XP_006305180.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
 gb|EOA38078.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
Length=358

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEAGLFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEDEMAKMMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN  DGTMDL  
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEPDGTMDLAA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+ GGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANCGGRCLS  155



>ref|XP_010102233.1| L-allo-threonine aldolase [Morus notabilis]
 gb|EXB93176.1| L-allo-threonine aldolase [Morus notabilis]
Length=358

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTR VDLRSDTVTKPTE MRAAMA+AEVDDDVLG DPTA RLE E+A I GKEA LFVP
Sbjct  1    MVTRRVDLRSDTVTKPTETMRAAMAAAEVDDDVLGNDPTAFRLEKEMAAIAGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVHPR +KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGIATIGGVHPRPVKNNPDGTMDIDS  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I +AIRDP+ E+ +PTTRLICLEN++ ++GGR LS
Sbjct  121  IVSAIRDPKGELVYPTTRLICLENTHGNTGGRVLS  155



>ref|XP_010553775.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Tarenaya hassleriana]
Length=365

 Score =   255 bits (651),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            K V RTVDLRSDTVTKPTE+M++AMA AEVDDDVLG DPTA++LE E+AKI GKEAGLFV
Sbjct  7    KTVARTVDLRSDTVTKPTESMQSAMARAEVDDDVLGHDPTARKLEQEMAKITGKEAGLFV  66

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLISV+ HC +RGSE+ILGD  HIHIYENGG++T+GG+HPRT++NN+DGTMD+D
Sbjct  67   PSGTMGNLISVMAHCEVRGSEVILGDNCHIHIYENGGVATVGGIHPRTVRNNEDGTMDID  126

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             +EAAIRDP+  + +P TRLICLEN++A+ GGRCL+
Sbjct  127  DVEAAIRDPKGGMFYPRTRLICLENTHANCGGRCLT  162



>ref|XP_006577318.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=357

 Score =   255 bits (651),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKP+EAMRAAMASAEVDDDVLG DP+  RLE E+AKI+GKE  LFVP
Sbjct  1    MVPRIVDLRSDTVTKPSEAMRAAMASAEVDDDVLGRDPSCFRLETEMAKILGKEGALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHP T++NN+DGTMD+  
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPTTVRNNEDGTMDIHL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ E+ +PTTRLICLEN++ +SGGRCLS
Sbjct  121  IEAAIRDPKGELVYPTTRLICLENTHGNSGGRCLS  155



>ref|XP_008443794.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
 ref|XP_008443795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=360

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R +DLRSDTVTKPTE MRAAMA AEVDDDVLG DP A  LE E+AKIMGKE GLFVPSGT
Sbjct  5    RKIDLRSDTVTKPTETMRAAMAMAEVDDDVLGNDPIALELEEEMAKIMGKEEGLFVPSGT  64

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLISVL HC IRGSE+I+GD SHIHIYENGGI+TIGGVH RT+KN DDGTMD+D IEA
Sbjct  65   MGNLISVLVHCEIRGSEVIVGDNSHIHIYENGGIATIGGVHSRTVKNKDDGTMDIDLIEA  124

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            AIR+P+ ++ FPTTRLICLEN++A+SGGRCL
Sbjct  125  AIRNPKGQLFFPTTRLICLENTHANSGGRCL  155



>ref|XP_006577317.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=368

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKP+EAMRAAMASAEVDDDVLG DP+  RLE E+AKI+GKE  LFVP
Sbjct  1    MVPRIVDLRSDTVTKPSEAMRAAMASAEVDDDVLGRDPSCFRLETEMAKILGKEGALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHP T++NN+DGTMD+  
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPTTVRNNEDGTMDIHL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ E+ +PTTRLICLEN++ +SGGRCLS
Sbjct  121  IEAAIRDPKGELVYPTTRLICLENTHGNSGGRCLS  155



>ref|XP_003521772.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
 gb|KHN31499.1| L-allo-threonine aldolase [Glycine soja]
Length=358

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKP+EAMRAAMASAEVDDDVLG DP+  RLE E+AKI+GKE  LFVP
Sbjct  1    MVPRIVDLRSDTVTKPSEAMRAAMASAEVDDDVLGRDPSCFRLETEMAKILGKEGALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHP T++NN+DGTMD+  
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPTTVRNNEDGTMDIHL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+ E+ +PTTRLICLEN++ +SGGRCLS
Sbjct  121  IEAAIRDPKGELVYPTTRLICLENTHGNSGGRCLS  155



>emb|CDX93548.1| BnaA06g05000D [Brassica napus]
Length=358

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVT+PT+AMR AMASAEVDDDVLG+DPTA+ LE E+AK+MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTRPTDAMREAMASAEVDDDVLGYDPTARGLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDTCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLVA  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P+TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLS  155



>emb|CDY31134.1| BnaA08g26840D [Brassica napus]
Length=369

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R+VDLRSDTVT+PT+AMR AMA AEVDDD+LG+DPTA+ LE E+AK+MGKEA LFVP
Sbjct  1    MVIRSVDLRSDTVTRPTDAMREAMAGAEVDDDILGYDPTARHLEEEMAKMMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLI V+ HC +RGSE+ILGD SHIH+YENGGISTIGGVHP+T KN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPKTTKNEEDGTMDLGD  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP+    +P TRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRDPKESTFYPYTRLICLENTHANSGGRCLS  155



>emb|CDO99988.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   249 bits (637),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +2

Query  275  MRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGS  454
            MR AMA+AEVDDDVL  DPTA+RLE E+A+I GKEA LFVPSGTMGNLI VLTHCPIRGS
Sbjct  1    MRTAMANAEVDDDVLSHDPTARRLETEMARITGKEAALFVPSGTMGNLICVLTHCPIRGS  60

Query  455  EIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRL  634
            E+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD++Q+EAAIRDPRFEIC+PTTRL
Sbjct  61   EVILGDSCHIHIYENGGISTIGGVHPRTVKNNEDGTMDINQMEAAIRDPRFEICYPTTRL  120

Query  635  ICLENSNAHSGGRCLS  682
            ICLENS+AHSGGRCLS
Sbjct  121  ICLENSHAHSGGRCLS  136



>ref|XP_006857300.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Amborella 
trichopoda]
 ref|XP_011628095.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Amborella 
trichopoda]
 ref|XP_011628096.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Amborella 
trichopoda]
 gb|ERN18767.1| hypothetical protein AMTR_s00067p00056150 [Amborella trichopoda]
Length=358

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV R VDLRSDTVTKPTEAM AAMA+AEVDDDVLGFDPTAQ+LE E+A+I+GKEA LFVP
Sbjct  1    MVRRIVDLRSDTVTKPTEAMIAAMANAEVDDDVLGFDPTAQKLETEVARIVGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLIS++ HC IRGSE+ILGD SHIH+ ENGGISTIG  H RT+ NN DGTMD++ 
Sbjct  61   SGTMSNLISIMVHCEIRGSEVILGDQSHIHLLENGGISTIGCAHSRTVPNNSDGTMDINL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIRDP   + +PTTRLICLEN+ A++GGRCLS
Sbjct  121  IEAAIRDPTEAMYYPTTRLICLENTQANTGGRCLS  155



>ref|XP_011465993.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465994.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465995.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+TVDLRSDTVTKPTE MRAAMA+A VDDDVLG DPTA RLE+E+AKIMGKEA LFVP
Sbjct  1    MVTQTVDLRSDTVTKPTETMRAAMAAAVVDDDVLGSDPTAFRLESEMAKIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIHI+ENGGISTIGGVHPRT+KNN+DGTMDL+ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIFENGGISTIGGVHPRTVKNNNDGTMDLNL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEA IRDPR E+ FPTTRLICLENS+A+ GGRCL+
Sbjct  121  IEATIRDPRGELVFPTTRLICLENSHANCGGRCLT  155



>ref|XP_008802138.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Phoenix 
dactylifera]
Length=359

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MV RTVDLRSDTVTKPTEAMRAAMA A+VDDDVLG DPTA  LE+E+AK+ GKEA LFVP
Sbjct  1    MVKRTVDLRSDTVTKPTEAMRAAMARADVDDDVLGSDPTAYHLESEMAKLTGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+I+GD SHIH+ ENGGISTIGGVHP+T+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLIHCDVRGSEVIIGDTSHIHVLENGGISTIGGVHPKTVKNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEAAIR P  E+ FPTTRLICLEN++A+SGGRCLS
Sbjct  121  IEAAIRSPDGELFFPTTRLICLENTHANSGGRCLS  155



>ref|XP_010262337.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Nelumbo nucifera]
Length=341

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMA+A+VDDDVLG DPTA R EAE+AK+MGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANADVDDDVLGVDPTAYRFEAEMAKVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIH+YENGGISTIG VH +T+KNN DGTMD+  
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDNSHIHVYENGGISTIGNVHSKTVKNNSDGTMDISL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEA+IRDP  E+ +PTTRLICLEN++A+ GGRCL+
Sbjct  121  IEASIRDPEEELYYPTTRLICLENTHANCGGRCLT  155



>ref|XP_010262335.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262336.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
Length=358

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVTRTVDLRSDTVTKPTEAMRAAMA+A+VDDDVLG DPTA R EAE+AK+MGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANADVDDDVLGVDPTAYRFEAEMAKVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC IRGSE+ILGD SHIH+YENGGISTIG VH +T+KNN DGTMD+  
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDNSHIHVYENGGISTIGNVHSKTVKNNSDGTMDISL  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IEA+IRDP  E+ +PTTRLICLEN++A+ GGRCL+
Sbjct  121  IEASIRDPEEELYYPTTRLICLENTHANCGGRCLT  155



>gb|AFW58858.1| putative threonine aldolase family protein [Zea mays]
Length=298

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  218  MVTRTV-DLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            M T+ V DLRSDTVTKP+EAMRA+MA+A+VDDDV G DPTA+R + E+A +MGKEA LFV
Sbjct  1    MATKVVVDLRSDTVTKPSEAMRASMAAADVDDDVRGADPTARRFQEEMAALMGKEAALFV  60

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHP+T++NN DGTMD+D
Sbjct  61   PSGTMGNLVSVLAHCDVRGSEVILGDDSHIHLYENGGISTLGGVHPKTVRNNSDGTMDID  120

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             I AAIR P   + +PTTRLICLEN++ +SGG+CLS
Sbjct  121  SIVAAIRPPGGGLYYPTTRLICLENTHGNSGGKCLS  156



>emb|CDY42933.1| BnaC05g47180D [Brassica napus]
Length=360

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  221  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  400
            V RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA  LE E+A+I GKEA +FVPS
Sbjct  5    VIRTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTAVLLEREVAEIAGKEAAMFVPS  64

Query  401  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  580
            GTMGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  I
Sbjct  65   GTMGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEISSI  124

Query  581  EAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            EAA+R P+ ++ +P T+LICLEN+ A+ GGRCL
Sbjct  125  EAAVRSPKGDLHYPVTKLICLENTQANCGGRCL  157



>ref|XP_008661960.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 ref|XP_008661961.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 gb|ACG33933.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58856.1| putative threonine aldolase family protein [Zea mays]
Length=377

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  218  MVTRTV-DLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            M T+ V DLRSDTVTKP+EAMRA+MA+A+VDDDV G DPTA+R + E+A +MGKEA LFV
Sbjct  1    MATKVVVDLRSDTVTKPSEAMRASMAAADVDDDVRGADPTARRFQEEMAALMGKEAALFV  60

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHP+T++NN DGTMD+D
Sbjct  61   PSGTMGNLVSVLAHCDVRGSEVILGDDSHIHLYENGGISTLGGVHPKTVRNNSDGTMDID  120

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             I AAIR P   + +PTTRLICLEN++ +SGG+CLS
Sbjct  121  SIVAAIRPPGGGLYYPTTRLICLENTHGNSGGKCLS  156



>emb|CDY49330.1| BnaA05g32920D [Brassica napus]
Length=360

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  221  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  400
            V RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA  LE E+A+I GKEA +FVPS
Sbjct  5    VIRTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTAVILEREVAEIAGKEAAMFVPS  64

Query  401  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  580
            GTMGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  I
Sbjct  65   GTMGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEISSI  124

Query  581  EAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            EAA+R P+ ++ +P T+LICLEN+ A+ GGRCL
Sbjct  125  EAAVRSPKGDLHYPVTKLICLENTQANCGGRCL  157



>ref|NP_001149239.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG34688.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58857.1| putative threonine aldolase family protein [Zea mays]
Length=375

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  218  MVTRTV-DLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            M T+ V DLRSDTVTKP+EAMRA+MA+A+VDDDV G DPTA+R + E+A +MGKEA LFV
Sbjct  1    MATKVVVDLRSDTVTKPSEAMRASMAAADVDDDVRGADPTARRFQEEMAALMGKEAALFV  60

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHP+T++NN DGTMD+D
Sbjct  61   PSGTMGNLVSVLAHCDVRGSEVILGDDSHIHLYENGGISTLGGVHPKTVRNNSDGTMDID  120

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             I AAIR P   + +PTTRLICLEN++ +SGG+CLS
Sbjct  121  SIVAAIRPPGGGLYYPTTRLICLENTHGNSGGKCLS  156



>ref|XP_009123981.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
 ref|XP_009123982.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
Length=360

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  221  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  400
            V RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA  LE E+A+I GKEA +FVPS
Sbjct  5    VIRTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTAVILEREVAEIAGKEAAMFVPS  64

Query  401  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  580
            GTMGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  I
Sbjct  65   GTMGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEISSI  124

Query  581  EAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            EAA+R P+ ++ +P T+LICLEN+ A+ GGRCL
Sbjct  125  EAAVRSPKGDLHYPVTKLICLENTQANCGGRCL  157



>ref|NP_566228.1| threonine aldolase 2 [Arabidopsis thaliana]
 sp|Q9FPH3.1|THA2_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 2; 
AltName: Full=Threonine aldolase 2 [Arabidopsis thaliana]
 gb|AAG40385.1|AF325033_1 AT3g04520 [Arabidopsis thaliana]
 gb|AAM14044.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 gb|AAM62682.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
 gb|AAM67566.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 dbj|BAD43108.1| L-allo-threonine aldolase like protein [Arabidopsis thaliana]
 gb|AEE74091.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=355

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSGT
Sbjct  8    RTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGT  67

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  IEA
Sbjct  68   MGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEIGAIEA  127

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            A+R P+ ++  P T+LICLEN+ A+ GGRCL
Sbjct  128  AVRSPKGDLHHPVTKLICLENTQANCGGRCL  158



>ref|NP_001189807.1| threonine aldolase 2 [Arabidopsis thaliana]
 gb|AEE74092.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=354

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSGT
Sbjct  8    RTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGT  67

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  IEA
Sbjct  68   MGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEIGAIEA  127

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            A+R P+ ++  P T+LICLEN+ A+ GGRCL
Sbjct  128  AVRSPKGDLHHPVTKLICLENTQANCGGRCL  158



>gb|AAF63783.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
Length=370

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSGT
Sbjct  8    RTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGT  67

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  IEA
Sbjct  68   MGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEIGAIEA  127

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            A+R P+ ++  P T+LICLEN+ A+ GGRCL
Sbjct  128  AVRSPKGDLHHPVTKLICLENTQANCGGRCL  158



>ref|XP_002884450.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60709.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
Length=353

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSGT
Sbjct  8    RTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGT  67

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLISVL HC  RGSE+ILGD SHIHIYENGGIS++GGVHPRT+KN +DGTM++  IEA
Sbjct  68   MGNLISVLVHCDERGSEVILGDDSHIHIYENGGISSLGGVHPRTVKNEEDGTMEIGAIEA  127

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
             +R P+ ++  P T+LICLEN+ A+ GGRCL
Sbjct  128  VVRSPKGDLHHPVTKLICLENTQANCGGRCL  158



>ref|XP_006408182.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
 gb|ESQ49635.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
Length=352

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 134/157 (85%), Gaps = 3/157 (2%)
 Frame = +2

Query  218  MVT---RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGL  388
            MVT   RTVDLRSDTVTKPTE+MR AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +
Sbjct  1    MVTPTIRTVDLRSDTVTKPTESMRLAMANAEVDDDVLGNDPTAVRLEREVAEIAGKEAAM  60

Query  389  FVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMD  568
            FVPSGTMGNLISVL HC  RGSE+I GD SHIHIYENGG+S++GGVHPRT+KN +DGTM+
Sbjct  61   FVPSGTMGNLISVLVHCDERGSEVIRGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTME  120

Query  569  LDQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            +  IEAA+R P+ ++ +P T+LICLEN+ A+ GGRCL
Sbjct  121  IGSIEAAVRSPKGDLHYPVTKLICLENTQANCGGRCL  157



>ref|XP_003590971.1| L-allo-threonine aldolase [Medicago truncatula]
Length=336

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  275  MRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGS  454
            MRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFVPSGTMGNLI VL HC IRGS
Sbjct  1    MRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFVPSGTMGNLICVLVHCDIRGS  60

Query  455  EIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRL  634
            E+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D IEAAIRDPR E+ FP+TRL
Sbjct  61   EVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDIDLIEAAIRDPRGELMFPSTRL  120

Query  635  ICLENSNAHSGGRCLS  682
            ICLENS+A+SGGRCLS
Sbjct  121  ICLENSHANSGGRCLS  136



>ref|XP_010463930.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   234 bits (598),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             RTVDLRSDTVTKPTE+MR+AMA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSG
Sbjct  7    VRTVDLRSDTVTKPTESMRSAMAIAEVDDDVLGSDPTAMRLEKEMAEIAGKEAAMFVPSG  66

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  IE
Sbjct  67   TMANLISVLIHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEIGSIE  126

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            AA+R P+ ++  P T+LICLEN+ A+ GGRCL
Sbjct  127  AAVRGPKGDLHHPVTKLICLENTQANRGGRCL  158



>gb|ACG34432.1| L-allo-threonine aldolase [Zea mays]
Length=377

 Score =   235 bits (599),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  218  MVTRTV-DLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            M T+ V DLRSDTVTKP+EAMRA+MA+A+VD DV G DPTA+R + ++A++MGKEA LFV
Sbjct  1    MATKVVVDLRSDTVTKPSEAMRASMAAADVDYDVRGADPTARRFQEKMAELMGKEAALFV  60

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHP+T++NN DGTMD+D
Sbjct  61   PSGTMGNLVSVLAHCDVRGSEVILGDDSHIHLYENGGISTLGGVHPKTVRNNSDGTMDID  120

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             I AAIR P   + +PTTRLICLEN++ +SGG+CLS
Sbjct  121  SIVAAIRPPGGGLYYPTTRLICLENTHGNSGGKCLS  156



>ref|XP_010415759.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             RTVDLRSDTVTKPTE+MR+AMA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSG
Sbjct  7    VRTVDLRSDTVTKPTESMRSAMAIAEVDDDVLGNDPTAMRLEKEMAEIAGKEAAMFVPSG  66

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM +  IE
Sbjct  67   TMANLISVLIHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMKIGSIE  126

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            AA+R P+ ++  P T+LICLEN+ A+ GGRCL
Sbjct  127  AAVRGPKGDLHHPVTKLICLENTQANRGGRCL  158



>ref|XP_010485829.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             RTVDLRSDTVTKPTE+MR+AMA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSG
Sbjct  7    VRTVDLRSDTVTKPTESMRSAMAKAEVDDDVLGSDPTAMRLEKEMAEIAGKEAAMFVPSG  66

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM +  IE
Sbjct  67   TMANLISVLIHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMVIGSIE  126

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            AA+R P+ ++  P T+LICLEN+ A+ GGRCL
Sbjct  127  AAVRGPKGDLHHPVTKLICLENTQANRGGRCL  158



>ref|XP_010520652.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Tarenaya 
hassleriana]
Length=349

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  221  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  400
            + +TVDLRSDTVTKPTE+MR+ MA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPS
Sbjct  20   INKTVDLRSDTVTKPTESMRSEMAKAEVDDDVLGHDPTALRLEQEMAEIAGKEAAIFVPS  79

Query  401  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  580
            GTMGNLISVL HC  RGSE+ILGD SHIH+YENGGI+T+GGVHPRT+KN +DGTM +  I
Sbjct  80   GTMGNLISVLVHCDERGSEVILGDNSHIHVYENGGIATLGGVHPRTVKNEEDGTMGISAI  139

Query  581  EAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            E A+R P+ ++  P T+LICLEN+ A+ GGRCL
Sbjct  140  EEAVRTPKGDLHHPVTKLICLENTQANCGGRCL  172



>emb|CBI22386.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  275  MRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGS  454
            MRAAMA AEVDDDVL  DPTA+RLE E+A+I GKEA LFVPSGTMGNLISVL HC +RGS
Sbjct  1    MRAAMAIAEVDDDVLVCDPTAERLETEMARITGKEAALFVPSGTMGNLISVLVHCEVRGS  60

Query  455  EIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRL  634
            E+ILGD SHIHIYENGGIST+GGVHPRT+KNN+DGTMD++ IEAAIRDPR E+ +PTTRL
Sbjct  61   EVILGDNSHIHIYENGGISTLGGVHPRTVKNNEDGTMDINLIEAAIRDPRGELVYPTTRL  120

Query  635  ICLENSNAHSGGRCL  679
            ICLEN++A+ GGRCL
Sbjct  121  ICLENTHANCGGRCL  135



>ref|XP_006298023.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
 gb|EOA30921.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
Length=353

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             RTVDLRSDTVTKPTE+MR+AMA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSG
Sbjct  7    VRTVDLRSDTVTKPTESMRSAMAKAEVDDDVLGNDPTAMRLEKEMAEIAGKEAAMFVPSG  66

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NLISVL HC  RGSE+ILGD  HIHIYENGG+S++GGVHPRT+KN +DGTM +  IE
Sbjct  67   TMANLISVLIHCDERGSEVILGDDCHIHIYENGGVSSLGGVHPRTVKNEEDGTMKIGSIE  126

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            AA+R  + ++  P T+LICLEN+ A+ GGRCL
Sbjct  127  AAVRGHKGDLHHPVTKLICLENTQANRGGRCL  158



>ref|XP_004976228.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Setaria 
italica]
Length=372

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+ VDLRSDTVTKPTEAMRAAMA+A+VDDDVLG DPTAQR EAE+AK+MGKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPTEAMRAAMAAADVDDDVLGADPTAQRFEAEMAKLMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NL+SVL HC +RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMANLVSVLVHCDVRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR+    + +PTTRLICLEN++A+ GG+CLS
Sbjct  121  IVAAIRNRAGALLYPTTRLICLENTHANCGGKCLS  155



>ref|XP_004976227.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Setaria 
italica]
Length=374

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+ VDLRSDTVTKPTEAMRAAMA+A+VDDDVLG DPTAQR EAE+AK+MGKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPTEAMRAAMAAADVDDDVLGADPTAQRFEAEMAKLMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NL+SVL HC +RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMANLVSVLVHCDVRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR+    + +PTTRLICLEN++A+ GG+CLS
Sbjct  121  IVAAIRNRAGALLYPTTRLICLENTHANCGGKCLS  155



>gb|ABR18450.1| unknown [Picea sitchensis]
Length=379

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            K   R VDLRSDTVT+PT+ MRAAMA A+VDDDVLG DPTA +L+ ++AK+MGKEAGLFV
Sbjct  18   KSAPRVVDLRSDTVTRPTDTMRAAMAKADVDDDVLGSDPTADQLQRQVAKLMGKEAGLFV  77

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTMGNLISVL HC +RGSE+ILG  SHIH+YENGGISTIG VHPR + N +DGTMDL 
Sbjct  78   PSGTMGNLISVLVHCEVRGSEVILGSDSHIHVYENGGISTIGHVHPRVVPNKEDGTMDLR  137

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            +IEA+IR P+ E+ + TTRLIC+EN++A  GGRC++
Sbjct  138  KIEASIR-PK-ELLYATTRLICIENTHADCGGRCIT  171



>ref|XP_010553776.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Tarenaya hassleriana]
Length=339

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  275  MRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGS  454
            M++AMA AEVDDDVLG DPTA++LE E+AKI GKEAGLFVPSGTMGNLISV+ HC +RGS
Sbjct  1    MQSAMARAEVDDDVLGHDPTARKLEQEMAKITGKEAGLFVPSGTMGNLISVMAHCEVRGS  60

Query  455  EIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRL  634
            E+ILGD  HIHIYENGG++T+GG+HPRT++NN+DGTMD+D +EAAIRDP+  + +P TRL
Sbjct  61   EVILGDNCHIHIYENGGVATVGGIHPRTVRNNEDGTMDIDDVEAAIRDPKGGMFYPRTRL  120

Query  635  ICLENSNAHSGGRCLS  682
            ICLEN++A+ GGRCL+
Sbjct  121  ICLENTHANCGGRCLT  136



>gb|EMT09938.1| hypothetical protein F775_21345 [Aegilops tauschii]
Length=267

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M T+ VDLRSDTVTKP+EAMRAAMA+A+V+DD+LG DPTA+R EAE+A+IMGKEA LFVP
Sbjct  1    MATKVVDLRSDTVTKPSEAMRAAMAAADVEDDILGSDPTARRFEAEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC  RGSE ILGD SHIH+YE+GGIST+GGVHPR + NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDTRGSEAILGDNSHIHVYEHGGISTLGGVHPRIVANNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR     + +PTTRLICLEN+  + GG+CLS
Sbjct  121  IVAAIRSRDGSLYYPTTRLICLENTQGNCGGKCLS  155



>gb|EMS57977.1| L-allo-threonine aldolase [Triticum urartu]
Length=302

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M T+ VDLRSDTVTKP+EAMRAAMA+A+V+DD+LG DPTA+R EAE+A+IMGKEA LFVP
Sbjct  1    MATKVVDLRSDTVTKPSEAMRAAMAAADVEDDILGSDPTARRFEAEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC  RGSE ILGD SHIH+YE+GGIST+GGVHPR + NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDTRGSEAILGDNSHIHVYEHGGISTLGGVHPRIVANNADGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR     + +PTTRLICLEN+  + GG+CLS
Sbjct  121  IVAAIRSRDGSLYYPTTRLICLENTQGNCGGKCLS  155



>ref|XP_006652519.1| PREDICTED: uncharacterized protein R102.4-like [Oryza brachyantha]
Length=372

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R E E+A+IMGKEA LFVP
Sbjct  1    MVTKLVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFETEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHP+T++NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDTRGSEVILGDNSHIHIYENGGISTIGGVHPKTVRNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR P   + +PTTRLICLEN++A+ GG+CLS
Sbjct  121  IVAAIRHPDGALYYPTTRLICLENTHANCGGKCLS  155



>ref|NP_001140767.1| putative threonine aldolase family protein [Zea mays]
 gb|ACF84582.1| unknown [Zea mays]
 tpg|DAA36967.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=321

 Score =   218 bits (556),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M ++ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFEAEMAAVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEAILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR P  ++ +PTTRLICLEN++ ++GG+CLS
Sbjct  121  IVAAIRHP--DLHYPTTRLICLENTHGNTGGKCLS  153



>gb|EMT23922.1| hypothetical protein F775_09169 [Aegilops tauschii]
Length=261

 Score =   216 bits (549),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 141/181 (78%), Gaps = 9/181 (5%)
 Frame = +2

Query  146  SFAFLIRKGTEQSSQFHLWFSRRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGF  325
            S+ FL+++  +   Q        +MVT+ V   SDTVT P+EAMRAAMA+AEVDDDVLG 
Sbjct  25   SYEFLLKRELQLRRQG-------RMVTKVVAPGSDTVTNPSEAMRAAMAAAEVDDDVLGA  77

Query  326  DPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGG  505
            DPTAQRLEAE+A++ GKEA LFVPSGTMGNL+SVLT C  RGSE+ILGD SHIH+ ENGG
Sbjct  78   DPTAQRLEAEMARVTGKEAALFVPSGTMGNLVSVLTQCDTRGSEVILGDSSHIHMCENGG  137

Query  506  ISTIGGVHPRTIKNNDDGTMDLDQIEAAIRD--PRFEICFPTTRLICLENSNAHSGGRCL  679
            ISTIGGVHPRT++NN DGTMD+D I AAIR       + +PTTRLICLEN++  SGG+CL
Sbjct  138  ISTIGGVHPRTVRNNPDGTMDIDMIVAAIRHHVGAGALHYPTTRLICLENTHGRSGGKCL  197

Query  680  S  682
            S
Sbjct  198  S  198



>ref|XP_008667491.1| PREDICTED: putative threonine aldolase family protein isoform 
X1 [Zea mays]
 tpg|DAA36968.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=370

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M ++ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFEAEMAAVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEAILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR P  ++ +PTTRLICLEN++ ++GG+CLS
Sbjct  121  IVAAIRHP--DLHYPTTRLICLENTHGNTGGKCLS  153



>ref|NP_001241763.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG36649.1| L-allo-threonine aldolase [Zea mays]
Length=370

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M ++ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFEAEMAAVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEAILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR P  ++ +PTTRLICLEN++ ++GG+CLS
Sbjct  121  IVAAIRHP--DLHYPTTRLICLENTHGNTGGKCLS  153



>ref|XP_008667492.1| PREDICTED: putative threonine aldolase family protein isoform 
X2 [Zea mays]
Length=360

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M ++ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFEAEMAAVMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEAILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR P  ++ +PTTRLICLEN++ ++GG+CLS
Sbjct  121  IVAAIRHP--DLHYPTTRLICLENTHGNTGGKCLS  153



>ref|NP_001141974.1| putative threonine aldolase family protein isoform 1 [Zea mays]
 gb|ACF87405.1| unknown [Zea mays]
 tpg|DAA36969.1| TPA: putative threonine aldolase family protein isoform 1 [Zea 
mays]
 tpg|DAA36970.1| TPA: putative threonine aldolase family protein isoform 2 [Zea 
mays]
Length=221

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT  VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTA+R EAE+A ++GKEA LFVP
Sbjct  1    MVTNVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTARRFEAEMAALLGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHPRT+ NN DGTMDL +
Sbjct  61   SGTMANLVSVLAHCDVRGSEVILGDASHIHVYENGGISTLGGVHPRTVPNNPDGTMDLAR  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I  AIR+P   + +PTTRLICLEN++A+SGG+CLS
Sbjct  121  IVDAIRNPDGALLYPTTRLICLENTHANSGGKCLS  155



>dbj|BAK01917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 132/157 (84%), Gaps = 2/157 (1%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+ VDLRSDTVTKP+EAMRAAMA+AEVDDDVLG DPTAQR EAE+A+I GKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPSEAMRAAMAAAEVDDDVLGADPTAQRFEAEMARITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL+SVLTHC  RGSE+ILGD SHIH+ ENGGISTIGGVH   + NN DGTMD+D+
Sbjct  61   SGTMGNLVSVLTHCDTRGSEVILGDSSHIHMCENGGISTIGGVHSMPVVNNPDGTMDIDK  120

Query  578  IEAAIRD--PRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR       + +PTTRLICLEN++  SGG+CLS
Sbjct  121  IVAAIRHRVGAGALHYPTTRLICLENTHGRSGGKCLS  157



>dbj|BAK03835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 132/157 (84%), Gaps = 2/157 (1%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+ VDLRSDTVTKP+EAMRAAMA+AEVDDDVLG DPTAQR EAE+A+I GKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPSEAMRAAMAAAEVDDDVLGADPTAQRFEAEMARITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL+SVLTHC  RGSE+ILGD SHIH+ ENGGISTIGGVH   + NN DGTMD+D+
Sbjct  61   SGTMGNLVSVLTHCDTRGSEVILGDSSHIHMCENGGISTIGGVHSMPVVNNPDGTMDIDK  120

Query  578  IEAAIRD--PRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR       + +PTTRLICLEN++  SGG+CLS
Sbjct  121  IVAAIRHRVGAGALHYPTTRLICLENTHGRSGGKCLS  157



>ref|XP_003580135.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
 ref|XP_010240138.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
Length=372

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+ VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTAQR EAE+A+IMGKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTAQRFEAEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NL+SVL HC  RGSEIILGD SHIHIYENGGIS++GGVHP+T+ NN DGTMD+D+
Sbjct  61   SGTMANLVSVLVHCDTRGSEIILGDTSHIHIYENGGISSLGGVHPKTLPNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR     + +PTTRLICLEN++A+ GG+CLS
Sbjct  121  IVAAIRHQDGALYYPTTRLICLENTHANCGGKCLS  155



>ref|XP_002448187.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
 gb|EES12515.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
Length=372

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT+ VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTA+R E E+A + GK+A LFVP
Sbjct  1    MVTKVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTARRFEGEMAALTGKDAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+ NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVPNNPDGTMDVDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR+P   + +PTTRLICLEN++A+ GG+CLS
Sbjct  121  ILAAIRNPDGALLYPTTRLICLENTHANCGGKCLS  155



>tpg|DAA36971.1| TPA: putative threonine aldolase family protein isoform 1 [Zea 
mays]
 tpg|DAA36972.1| TPA: putative threonine aldolase family protein isoform 2 [Zea 
mays]
Length=372

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT  VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTA+R EAE+A ++GKEA LFVP
Sbjct  1    MVTNVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTARRFEAEMAALLGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHPRT+ NN DGTMDL +
Sbjct  61   SGTMANLVSVLAHCDVRGSEVILGDASHIHVYENGGISTLGGVHPRTVPNNPDGTMDLAR  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I  AIR+P   + +PTTRLICLEN++A+SGG+CLS
Sbjct  121  IVDAIRNPDGALLYPTTRLICLENTHANSGGKCLS  155



>gb|EMT28261.1| hypothetical protein F775_27222 [Aegilops tauschii]
Length=259

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +2

Query  287  MASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIIL  466
            MA+AEVDDDVLG DPTAQR EAE+A+IMGKEA LFVPSGTMGNL+SVL HC  RGSE+IL
Sbjct  1    MAAAEVDDDVLGADPTAQRFEAEMARIMGKEAALFVPSGTMGNLVSVLAHCDTRGSEVIL  60

Query  467  GDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICLE  646
            GD SHIHIYENGGI+T+GGVHPRT+ NN DGTMD+D+I AAIR     + +PTTRLICLE
Sbjct  61   GDNSHIHIYENGGIATLGGVHPRTVPNNPDGTMDVDKIVAAIRHRDGAMYYPTTRLICLE  120

Query  647  NSNAHSGGRCLS  682
            N++ ++GG+CLS
Sbjct  121  NTHGNTGGKCLS  132



>gb|EMS52584.1| L-allo-threonine aldolase [Triticum urartu]
Length=349

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +2

Query  287  MASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIIL  466
            MA+AEVDDDVLG DPTAQR EAE+A+IMGKEA LFVPSGTMGNL+SVL HC  RGSE+IL
Sbjct  1    MAAAEVDDDVLGADPTAQRFEAEMARIMGKEAALFVPSGTMGNLVSVLAHCDTRGSEVIL  60

Query  467  GDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICLE  646
            GD SHIHIYENGGIST+GGVHPRT+ NN DGTMD+ +I AAIR P   + +PTTRLICLE
Sbjct  61   GDNSHIHIYENGGISTLGGVHPRTVPNNPDGTMDIHKIVAAIRHPDGAMYYPTTRLICLE  120

Query  647  NSNAHSGGRCLS  682
            N++ ++GG+CLS
Sbjct  121  NTHGNTGGKCLS  132



>dbj|BAJ93201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M  + VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA+R EAE+A+IMGKEA LFVP
Sbjct  1    MAAKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTARRFEAEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC  RGSE+ILGD SHIH+YE+GGIST+GGVHPRT+ NN DGTMD+D+
Sbjct  61   SGTMANLISVLAHCDARGSEVILGDDSHIHVYEHGGISTLGGVHPRTVPNNPDGTMDVDR  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR P   + +PTTRLICLEN++ +SGG+CL+
Sbjct  121  IVAAIRSPDGALYYPTTRLICLENTHGNSGGKCLT  155



>ref|NP_001053314.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAD41482.2| OSJNBb0072M01.18 [Oryza sativa Japonica Group]
 dbj|BAF15228.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAH67219.1| OSIGBa0145M07.1 [Oryza sativa Indica Group]
 dbj|BAG94039.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87066.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77644.1| hypothetical protein OsI_16646 [Oryza sativa Indica Group]
 gb|EEE61341.1| hypothetical protein OsJ_15466 [Oryza sativa Japonica Group]
Length=372

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            MVT  VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTA R E E+A+I GKEA LFVP
Sbjct  1    MVTNVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTAHRFEMEMARITGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHP+T++NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDTRGSEVILGDNSHIHIYENGGISTIGGVHPKTVRNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I  AIR P   + +PTTRLICLEN++A+ GG+CLS
Sbjct  121  IVVAIRHPDGALYYPTTRLICLENTHANCGGKCLS  155



>gb|EMT07295.1| hypothetical protein F775_08681 [Aegilops tauschii]
Length=317

 Score =   210 bits (534),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M T+ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A+IMGKEA LFVP
Sbjct  1    MATKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTACRFEAEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC  RGSE+ILGD SH+H+YE+GGIST+GGVHPRT+ NN DGTMD+D+
Sbjct  61   SGTMANLISVLAHCDARGSEVILGDDSHVHVYEHGGISTLGGVHPRTVPNNPDGTMDVDR  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR     + +PTTRLICLEN++ +SGG+CL+
Sbjct  121  IVAAIRSTDGALYYPTTRLICLENTHGNSGGKCLT  155



>gb|EMS67121.1| L-allo-threonine aldolase [Triticum urartu]
Length=367

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M T+ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A+IMGKEA LFVP
Sbjct  1    MATKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTACRFEAEMARIMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTM NLISVL HC  RGSE+ILG  SHIH+YE+GGIST+GGVHPRT+ NN DGTMD+D+
Sbjct  61   SGTMANLISVLAHCDARGSEVILGHDSHIHVYEHGGISTLGGVHPRTVPNNPDGTMDVDR  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR     + +PTTRLICLEN++ +SGG+CL+
Sbjct  121  IVAAIRSTDGALYYPTTRLICLENTHGNSGGKCLT  155



>emb|CAE05443.2| OSJNBa0073E02.3 [Oryza sativa Japonica Group]
Length=349

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  287  MASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIIL  466
            MA+A+VDDDVLG DPTA R E E+A+I GKEA LFVPSGTM NLISVL HC  RGSE+IL
Sbjct  1    MAAADVDDDVLGADPTAHRFEMEMARITGKEAALFVPSGTMANLISVLVHCDTRGSEVIL  60

Query  467  GDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICLE  646
            GD SHIHIYENGGISTIGGVHP+T++NN DGTMD+D+I  AIR P   + +PTTRLICLE
Sbjct  61   GDNSHIHIYENGGISTIGGVHPKTVRNNPDGTMDIDKIVVAIRHPDGALYYPTTRLICLE  120

Query  647  NSNAHSGGRCLS  682
            N++A+ GG+CLS
Sbjct  121  NTHANCGGKCLS  132



>ref|XP_001768407.1| predicted protein [Physcomitrella patens]
 gb|EDQ66769.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VD RSDTVTKPT AMRAAMA+AEVDDD+LG DPT   L+ ++A +MGKEAGLFVPSGT
Sbjct  14   RVVDFRSDTVTKPTAAMRAAMANAEVDDDILGVDPTMNELQKQVATVMGKEAGLFVPSGT  73

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLI+VL HC +RGSE+I+G+ SHI  YE GGIST+GGVHPRT+ NN DGT DL ++EA
Sbjct  74   MGNLIAVLVHCEVRGSEVIIGEESHIMHYEQGGISTLGGVHPRTVPNNADGTFDLKKVEA  133

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            AIR    +  FP TRLICLEN+ A  GGRCLS
Sbjct  134  AIR-YELDDHFPITRLICLENTQARCGGRCLS  164



>gb|EMS46485.1| L-allo-threonine aldolase [Triticum urartu]
Length=272

 Score =   203 bits (517),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +2

Query  287  MASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIIL  466
            MA+AEVDDDVLG DPTAQR EAE+A+I GKEA LFVPSGTMGNLISVLTHC  RGSE+IL
Sbjct  1    MAAAEVDDDVLGADPTAQRFEAEMARITGKEAALFVPSGTMGNLISVLTHCDTRGSEVIL  60

Query  467  GDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRD--PRFEICFPTTRLIC  640
            GD SHIH+ ENGGISTIGGVHPRT++NN DGTMD+D I AAIR       + +PTTRLIC
Sbjct  61   GDTSHIHMCENGGISTIGGVHPRTVRNNPDGTMDIDMIVAAIRHHVGAGALHYPTTRLIC  120

Query  641  LENSNAHSGGRCL  679
            LEN++  SGG+CL
Sbjct  121  LENTHGRSGGKCL  133



>ref|XP_004976226.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=321

 Score =   202 bits (515),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 136/155 (88%), Gaps = 2/155 (1%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M ++ VDLRSDTVTKP++AMRAAMA+A VDDDV+G DPTAQ+ + E+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSDAMRAAMAAAVVDDDVVGVDPTAQQFQEEMAALMGKEAALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHP+T++NN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDDSHIHVYENGGISTIGGVHPKTVRNNPDGTMDIDK  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            I AAIR P  ++ +PTTRLICLEN++ + GG+CLS
Sbjct  121  IVAAIRHP--DLHYPTTRLICLENTHGNCGGKCLS  153



>ref|XP_004976222.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=372

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = +2

Query  230  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  409
             VDLRSDT+TKPTEAMRAAMA+A+VDDDV   DPTA+R +AE+A +MGKEA LFVPSGTM
Sbjct  6    VVDLRSDTITKPTEAMRAAMAAADVDDDVRDGDPTARRFQAEMAALMGKEAALFVPSGTM  65

Query  410  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  589
             NL+SVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHP T+++N DGTMD+D+I AA
Sbjct  66   ANLVSVLVHCDVRGSEVILGDDSHIHLYENGGISTIGGVHPTTVRSNPDGTMDIDKIVAA  125

Query  590  IRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IR P   I +PTTRLICLEN++ +SGG+CLS
Sbjct  126  IRRPDV-IYYPTTRLICLENTHVNSGGKCLS  155



>ref|WP_014434736.1| threonine aldolase [Caldilinea aerophila]
 dbj|BAM01510.1| putative threonine aldolase [Caldilinea aerophila DSM 14535 = 
NBRC 104270]
Length=346

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            + +DLRSDTVTKPT AMR AMA AEV DDV G DPT  RLEA +A+ +GKEA LFVPSGT
Sbjct  3    KVIDLRSDTVTKPTPAMRRAMAEAEVGDDVYGEDPTVNRLEALVAERLGKEAALFVPSGT  62

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLIS+L+HC  RG E++LGD +HI  YE GG + +GGVHPR + N  DGT+DL Q+ +
Sbjct  63   MGNLISILSHCG-RGDEMLLGDQAHIFHYEQGGSAAVGGVHPRILPNCPDGTIDLHQLNS  121

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            +IR    +  FP TRLI LEN++   GGR L
Sbjct  122  SIRGD--DEHFPVTRLIALENTHNRCGGRVL  150



>ref|XP_002973664.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
 gb|EFJ25324.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
Length=358

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VD RSDT+TKPT AMRAAMASAEVDDD++  DPT   L+ E+A+I GKEA LFVPSGT
Sbjct  10   RIVDFRSDTITKPTAAMRAAMASAEVDDDIVTVDPTMDELQKEMARIFGKEAALFVPSGT  69

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLISVL HC  R SE I+G  SHI++YE GG++T+GGV P  + NN DGTMDL  +E 
Sbjct  70   MGNLISVLVHCEARASEAIIGSESHINVYEQGGMATLGGVFPSIVPNNPDGTMDLRAVEN  129

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            AI+ P  +  F TTRLIC+EN++   GGRC+S
Sbjct  130  AIK-PLDDEHFATTRLICIENTHNRCGGRCVS  160



>ref|XP_002975719.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
 gb|EFJ23348.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
Length=358

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VD RSDT+TKPT AMRAAMASAEVDDD++  DPT   L+ E+A+I GKEA LFVPSGT
Sbjct  10   RIVDFRSDTITKPTAAMRAAMASAEVDDDIVTVDPTMDELQKEMARIFGKEAALFVPSGT  69

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLISVL HC  R SE I+G  SHI++YE GG++T+GGV P  + NN DGTMDL  +E 
Sbjct  70   MGNLISVLVHCEARASEAIIGSESHINVYEQGGMATLGGVFPSIVPNNPDGTMDLRAVEN  129

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            AI+ P  +  F TTRLIC+EN++   GGRC+S
Sbjct  130  AIK-PLDDEHFATTRLICIENTHNRCGGRCVS  160



>ref|XP_005989151.1| PREDICTED: uncharacterized protein R102.4-like [Latimeria chalumnae]
Length=417

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VDLRSDTVTKP  AMR+AMA A+V DDV G DPT   LE   A++ G EA LFVPSGT
Sbjct  48   RCVDLRSDTVTKPGPAMRSAMAQAQVGDDVYGEDPTVYELERRGAELFGMEATLFVPSGT  107

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLISV+ HC  RG+E+++GD +H+H+YE GGI+ + G+H RT+KN  DGT DL +++ 
Sbjct  108  MGNLISVMCHCRERGAELVVGDQAHVHLYEQGGIAQLAGIHSRTVKNLPDGTFDLREVKT  167

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
             +RD   +  +P +RLIC+EN++   GGR L
Sbjct  168  KLRDGYPDPHYPRSRLICVENTHNVQGGRVL  198



>emb|CDQ60587.1| unnamed protein product [Oncorhynchus mykiss]
Length=432

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 107/152 (70%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             RTVDLRSDTVTKP  AMR AMA AEV DDV G DPT   L+   A++ G EA L+VPSG
Sbjct  62   ARTVDLRSDTVTKPGAAMRQAMAEAEVGDDVFGEDPTVNELQKMAAEVFGMEAALYVPSG  121

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+ N  DGT DLDQ+E
Sbjct  122  TMANLIAVMVHCRERGDEMIVGDLSHLHIYEQGGSAQLAGVHSTTVTNLPDGTFDLDQLE  181

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            + IR    +  +P +RL+C+EN++   GGR L
Sbjct  182  SKIRHGYPDAHYPRSRLVCVENTHNIQGGRVL  213



>ref|XP_011429035.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Crassostrea 
gigas]
Length=402

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 112/153 (73%), Gaps = 7/153 (5%)
 Frame = +2

Query  230  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  409
             VDLRSDTVTKP+  MR AMA+AEV DDV+G DPT   L+  I+K+  KEA LFVP+GTM
Sbjct  42   VVDLRSDTVTKPSPGMRNAMATAEVGDDVMGEDPTVNALQNRISKLFDKEAALFVPTGTM  101

Query  410  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  589
            GNLISV THCP RG E++LG  SHI ++E G I+  GG+   T++NNDDGTMDL++++  
Sbjct  102  GNLISVFTHCPERGLEVVLGHKSHIFVHEQGNIAQFGGLLTSTVENNDDGTMDLEKMKER  161

Query  590  IR---DPRFEICFPTTRLICLENSNAHSGGRCL  679
            IR   DP     FP TRLIC+EN++ + GG+ +
Sbjct  162  IRLSDDPH----FPYTRLICVENTHNYCGGKVI  190



>ref|XP_003058675.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57130.1| predicted protein [Micromonas pusilla CCMP1545]
Length=640

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 108/151 (72%), Gaps = 2/151 (1%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R +DLRSDTVTKPT+ MRAAMA+A   DDV G DPT + LE  +A   GKEA LFVPSGT
Sbjct  290  RIIDLRSDTVTKPTQTMRAAMATAICGDDVFGDDPTVKDLEIVVAAAFGKEAALFVPSGT  349

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLI+V  HC +RGSE I GD SH+HIYE GG+ST+ G HPR +KN DDGT+DL +I  
Sbjct  350  MGNLIAVGVHCEVRGSEFICGDLSHVHIYEQGGLSTLMGAHPRALKNEDDGTIDLQRIRN  409

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            A R    +  FP T ++C+E ++   GGR L
Sbjct  410  AFRSD--DQHFPRTTVLCIEQTHNKKGGRVL  438



>ref|XP_002594275.1| hypothetical protein BRAFLDRAFT_260210 [Branchiostoma floridae]
 gb|EEN50286.1| hypothetical protein BRAFLDRAFT_260210 [Branchiostoma floridae]
Length=360

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 6/149 (4%)
 Frame = +2

Query  239  LRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNL  418
            +RSDT+TKPT AMR AMA AEV DDV G DPT   L+ + AK+ G EA LFVP+GTMGN 
Sbjct  1    MRSDTITKPTPAMRRAMAEAEVGDDVYGEDPTVNALQEKAAKLFGMEAALFVPTGTMGNF  60

Query  419  ISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIR-  595
             S++ HC  RGSE++LGD +HI IYE GG + +GG+HPRT++N  DGT DLD++E+ +R 
Sbjct  61   CSIMAHCWERGSEMLLGDCAHIFIYEQGGSAQLGGIHPRTVRNKPDGTFDLDEVESKVRT  120

Query  596  -DPRFEICFPTTRLICLENSNAHSGGRCL  679
             DP      P TRLIC+EN+    GGR L
Sbjct  121  SDPH----LPITRLICVENTQNICGGRVL  145



>ref|XP_010893799.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Esox 
lucius]
Length=429

 Score =   176 bits (447),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            RTVDLRSDTVTKP  AMR AMA AEV DDV G DPT   L+   A++ G EA L+VPSGT
Sbjct  60   RTVDLRSDTVTKPGAAMRQAMAEAEVGDDVFGEDPTVNELQKMAAELFGMEAALYVPSGT  119

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            M NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DLDQ+E+
Sbjct  120  MANLIAVMVHCRERGDEMIVGDLSHLHIYEQGGTAQLAGVHSTTVTTLPDGTFDLDQLES  179

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
             IR    +  +P +RL+C+EN++   GGR L
Sbjct  180  KIRHGYPDAHYPRSRLVCVENTHNIQGGRVL  210



>ref|WP_005011469.1| Low-specificity L-threonine aldolase [Nitrospina gracilis]
 emb|CCQ92024.1| Low-specificity L-threonine aldolase [Nitrospina gracilis 3/211]
Length=344

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 114/152 (75%), Gaps = 3/152 (2%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            + +D RSDT+T+PT+AMR AMA+A+V DDV   DPT  RL+   A+  GKEA LFVPSGT
Sbjct  2    QIIDYRSDTLTQPTDAMRQAMANAKVGDDVFDEDPTVHRLQELAAEKTGKEAALFVPSGT  61

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNL+S+LTHC  RG EIILG  SHI I E GG+S +GG+HP  + N DDGT+D+ +++A
Sbjct  62   MGNLVSLLTHCQ-RGDEIILGRRSHIFINEVGGLSALGGIHPHPVANRDDGTLDMGEVKA  120

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            AIR  + ++ +P TRLICLEN++ + GG  L+
Sbjct  121  AIR--KDDVHYPPTRLICLENTHNYCGGYPLT  150



>ref|XP_005943923.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_005943924.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Haplochromis 
burtoni]
Length=336

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +2

Query  212  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  391
            R    R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LF
Sbjct  54   RAAHVRVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFGMEAALF  113

Query  392  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  571
            VPSGTM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL
Sbjct  114  VPSGTMSNLIAVMVHCRERGDEVIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDL  173

Query  572  DQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            +Q+E+ IR    +  +P +RL+C+EN++   GGR L
Sbjct  174  EQLESKIRHGYPDPHYPRSRLVCVENTHNIQGGRVL  209



>ref|XP_008300571.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Stegastes 
partitus]
Length=431

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 104/152 (68%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LFVPSG
Sbjct  61   VRVVDLRSDTVTKPGPAMRRAMAEAEVGDDVMGEDPTVNELQKMTADLFGMEAALFVPSG  120

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TMGNLI+V+ HC  RG E+I+GD  HIHIYE G  + + GVH  T+    DGT DLDQ+E
Sbjct  121  TMGNLIAVMVHCRERGDEMIVGDRCHIHIYEQGSSAQLAGVHSTTVTTLPDGTFDLDQLE  180

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            + IR    +  +P +RLICLEN++   GGR L
Sbjct  181  SKIRHGYPDPHYPRSRLICLENTHNIQGGRVL  212



>ref|XP_004556683.1| PREDICTED: uncharacterized protein R102.4-like [Maylandia zebra]
Length=428

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +2

Query  212  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  391
            R    R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LF
Sbjct  54   RAAHVRVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFGMEAALF  113

Query  392  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  571
            VPSGTM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL
Sbjct  114  VPSGTMSNLIAVMVHCRERGDEVIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDL  173

Query  572  DQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            +Q+E+ IR    +  +P +RL+C+EN++   GGR L
Sbjct  174  EQLESKIRHGYPDPHYPRSRLVCVENTHNIQGGRVL  209



>ref|XP_005943922.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Haplochromis 
burtoni]
Length=428

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +2

Query  212  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  391
            R    R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LF
Sbjct  54   RAAHVRVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFGMEAALF  113

Query  392  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  571
            VPSGTM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL
Sbjct  114  VPSGTMSNLIAVMVHCRERGDEVIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDL  173

Query  572  DQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            +Q+E+ IR    +  +P +RL+C+EN++   GGR L
Sbjct  174  EQLESKIRHGYPDPHYPRSRLVCVENTHNIQGGRVL  209



>ref|XP_006635478.1| PREDICTED: uncharacterized protein R102.4-like [Lepisosteus oculatus]
Length=398

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = +2

Query  197  LWFSRRKMVT----RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAK  364
            L++   K VT    RTVDLRSDTVTKP  AMR AMA AEV DDV G DPT   L+   A 
Sbjct  15   LYYVSPKSVTGNSFRTVDLRSDTVTKPGPAMRRAMAEAEVGDDVFGEDPTVNELQKRAAD  74

Query  365  IMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIK  544
            + G EA LFVP+GTM NLI+V+ HC  RG EII+GD SH+H+YE GG +   GVH  T+ 
Sbjct  75   VFGMEAALFVPTGTMSNLIAVMVHCSERGDEIIVGDQSHLHVYEQGGSAQCAGVHSTTVS  134

Query  545  NNDDGTMDLDQIEAAIRDPRFEICFPTTRLICLENSNAHSGG  670
            N  DGT DL+++E+ IR    +  +P +RL+C+EN++   GG
Sbjct  135  NLPDGTFDLEEMESKIRHGYPDAHYPRSRLVCVENTHNICGG  176



>gb|EKC35640.1| E3 ubiquitin-protein ligase TRAF7 [Crassostrea gigas]
Length=1658

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 7/152 (5%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            VDLRSDTVTKP+  MR AMA+AEV DDV+G DPT   L+  I+K+  KEA LFVP+GTMG
Sbjct  694  VDLRSDTVTKPSPGMRNAMATAEVGDDVMGEDPTVNALQNRISKLFDKEAALFVPTGTMG  753

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NLISV THCP RG E++LG  SHI ++E G I+  GG+   T++NNDDGTMDL++++  I
Sbjct  754  NLISVFTHCPERGLEVVLGHKSHIFVHEQGNIAQFGGLLTSTVENNDDGTMDLEKMKERI  813

Query  593  R---DPRFEICFPTTRLICLENSNAHSGGRCL  679
            R   DP     FP TRLIC+EN++ + GG+ +
Sbjct  814  RLSDDPH----FPYTRLICVENTHNYCGGKVI  841



>ref|WP_038087996.1| threonine aldolase [Thiobacillus prosperus]
 gb|KFZ90980.1| L-allo-threonine aldolase [Thiobacillus prosperus]
Length=356

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = +2

Query  230  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  409
            TVDLRSDT+T+PT++MR AMA AEV DDV G DPT   LEA  A+ +GK A LFVPSGTM
Sbjct  11   TVDLRSDTLTRPTDSMREAMARAEVGDDVYGEDPTVNALEALAAERLGKAAALFVPSGTM  70

Query  410  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  589
            GNLISVL  C  RG E+ILG  +HI  YE GG +  GGV PRT+ N  DGT+DL ++EAA
Sbjct  71   GNLISVLAQCG-RGDEMILGADAHIFYYEQGGAAGFGGVQPRTLANRADGTLDLAEVEAA  129

Query  590  IRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            IR       +P TRLI LEN++   GGR L
Sbjct  130  IRADNDH--YPVTRLIALENTHNRCGGRVL  157



>ref|XP_007562537.1| PREDICTED: uncharacterized protein R102.4-like [Poecilia formosa]
Length=418

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 104/152 (68%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A++ G EA LFVPSG
Sbjct  51   VRVVDLRSDTVTKPGPAMRQAMAQAEVGDDVMGEDPTVNELQKLAAEMFGMEASLFVPSG  110

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NLI+V+ HC  R  E+I+GD SH+HIYE GG + + GVH  T+    DGT DL Q+E
Sbjct  111  TMSNLIAVMVHCRERSDEMIVGDLSHMHIYEQGGSAQLAGVHATTVTTRPDGTFDLKQLE  170

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            + IR    +  +P TRLIC+EN++   GGR L
Sbjct  171  SKIRHGYPDPHYPRTRLICVENTHNIQGGRVL  202



>ref|XP_003979332.2| PREDICTED: probable low-specificity L-threonine aldolase 2 [Takifugu 
rubripes]
Length=421

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
            TR VDLRSDTVTKPT AMR AMASAEV DDV+G DPT   L+   A++   EA LFV SG
Sbjct  52   TRVVDLRSDTVTKPTPAMRQAMASAEVGDDVMGEDPTVNELQKVAAELFRMEAALFVTSG  111

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TMGNL++ + HC  R  E+I+GD SHIH+YE GG + + GVH  T++   DGT DL ++E
Sbjct  112  TMGNLLAAMVHCRRRDDEMIVGDLSHIHVYEQGGSAYLAGVHSTTVRTQPDGTFDLTELE  171

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            + IR    +  +P TRLIC+EN++   GGR L
Sbjct  172  SKIRHGYPDPHYPRTRLICVENTHNIQGGRVL  203



>ref|WP_026159079.1| threonine aldolase [Nitrospina sp. SCGC AAA288-L16]
Length=344

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = +2

Query  230  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  409
            T+DLRSDT+T+PTE+MR AMA AEV DDV G DPT  RLE   A  MGKEA +FVPSGTM
Sbjct  3    TIDLRSDTLTQPTESMRKAMAEAEVGDDVFGEDPTVNRLEKIAADRMGKEAAIFVPSGTM  62

Query  410  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  589
            GNLI +L+HC  RG E+ILGD SHI + E GGI+ +GG+HP  I N  DGT++L+ +E  
Sbjct  63   GNLIGMLSHCN-RGDEVILGDQSHIFLNEVGGIAALGGIHPHIISNESDGTLNLETVEKK  121

Query  590  IRDPRFEICFPTTRLICLENSNAHSGG  670
            IR    ++ +P TRLI LEN++ +  G
Sbjct  122  IRAS--DLHYPPTRLIALENTHNYCMG  146



>ref|XP_005749741.1| PREDICTED: uncharacterized protein R102.4-like [Pundamilia nyererei]
Length=428

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +2

Query  212  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  391
            R    R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LF
Sbjct  54   RAAHVRVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFGMEAALF  113

Query  392  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  571
            VPSGTM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT +L
Sbjct  114  VPSGTMSNLIAVMVHCRERGDEVIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFEL  173

Query  572  DQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            +Q+E+ IR    +  +P +RL+C+EN++   GGR L
Sbjct  174  EQLESKIRHGYPDPHYPRSRLVCVENTHNIQGGRVL  209



>ref|XP_004080515.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Oryzias 
latipes]
Length=428

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 104/151 (69%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA +FVPSGT
Sbjct  61   RVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNDLQQTAADLFGMEAAIFVPSGT  120

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            M NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL Q+EA
Sbjct  121  MSNLIAVMVHCRERGDEMIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDLKQLEA  180

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
             IR    +  +P +RLIC+EN++   GGR L
Sbjct  181  KIRHGYPDPHYPRSRLICVENTHNIQGGRVL  211



>ref|XP_003441921.1| PREDICTED: uncharacterized protein R102.4-like [Oreochromis niloticus]
Length=428

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 105/152 (69%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             R VDLRSDTVTKP  AMR AMA A+V DDV+G DPT   L+   A + G EA LFVPSG
Sbjct  58   VRVVDLRSDTVTKPGPAMRQAMAEAKVGDDVMGEDPTVNELQKIAADMFGMEAALFVPSG  117

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL+Q+E
Sbjct  118  TMSNLIAVMVHCRERGDEVIVGDSSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDLEQLE  177

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            + IR    +  +P +RL+C+EN++   GGR L
Sbjct  178  SKIRHGYPDPHYPRSRLVCVENTHNIQGGRVL  209



>ref|WP_013559406.1| threonine aldolase [Anaerolinea thermophila]
 dbj|BAJ63015.1| threonine aldolase [Anaerolinea thermophila UNI-1]
Length=347

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 110/157 (70%), Gaps = 7/157 (4%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M+   +DLRSDTVT PT  MR AMA AEV DDV+G DPT  RLE   A+ MGKEAGLFVP
Sbjct  1    MINHFIDLRSDTVTHPTPEMRQAMAQAEVGDDVMGEDPTVNRLEELAAEKMGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL ++LTHC  RG E+I+G  SH +++E GG + +GGVHP  ++N  DGT+ L+ 
Sbjct  61   SGTMGNLTAILTHCG-RGDEMIVGHLSHTYLFEAGGSAALGGVHPFVLQNQPDGTLRLED  119

Query  578  IEAAIR--DPRFEICFPTTRLICLENSNAHSGGRCLS  682
            +  A+R  DP     +PTTRLI LEN++   GG  L+
Sbjct  120  LRHAVREDDPH----YPTTRLIILENTHNRCGGVVLT  152



>ref|WP_020877756.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans]
 gb|EPR35940.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans DSM 2059]
Length=347

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            + ++LRSDT+T+PT AMR AMA A V DDV G DPT  RLEA  A+  GK A L VPSGT
Sbjct  2    QVIELRSDTLTRPTPAMRRAMAEAPVGDDVFGEDPTVNRLEAMAAECTGKAAALLVPSGT  61

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNL++ LTHC  RG E ILGD SH+  YE GG + +GG+HPRTI N  DGT+DL+   A
Sbjct  62   MGNLVAQLTHCG-RGCETILGDQSHVFYYEQGGAAALGGIHPRTIPNRPDGTLDLEATTA  120

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            AIR    ++ FP TRLI LEN++   GG  L+
Sbjct  121  AIRPD--DLHFPRTRLILLENTHNRCGGAPLT  150



>ref|WP_036683028.1| threonine aldolase [Pelobacter seleniigenes]
Length=350

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = +2

Query  230  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  409
            T+DLRSDTVT+P+ AMR AMA A V DDV G DPT  +L+   A++ G+EA L V SGT 
Sbjct  8    TIDLRSDTVTQPSAAMRQAMAEAAVGDDVYGEDPTVNQLQQRAAELFGQEAALLVTSGTQ  67

Query  410  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  589
            GNL+++LTH P RGSE+ILGD SHI +YE GGI+ +GG+ P TI    DGT+ LD IEAA
Sbjct  68   GNLVAMLTHAP-RGSEVILGDKSHIFLYEQGGIAALGGIMPHTITVQQDGTLRLDDIEAA  126

Query  590  IRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            +R     + FP TR+I LEN+    GG  LS
Sbjct  127  VRGD--NVHFPRTRVIALENTQGTVGGVPLS  155



>ref|WP_026171962.1| threonine aldolase [Nitrospina sp. AB-629-B18]
Length=344

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = +2

Query  230  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  409
            T+DLRSDT+T+PTE+MR A+A AEV DDV   DPT  RLE   A  MGKE  +FVPSGTM
Sbjct  3    TIDLRSDTLTQPTESMRKAIAEAEVGDDVFSEDPTVNRLEKIAADRMGKETAVFVPSGTM  62

Query  410  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  589
            GNLIS+L+HC  RG E++LGD SHI + E GGI+ +GG+HP TI N  DGT++L+ IE  
Sbjct  63   GNLISMLSHCN-RGDEVLLGDQSHIFLNEVGGIAALGGIHPHTISNESDGTLNLETIEKK  121

Query  590  IRDPRFEICFPTTRLICLENSNAHSGG  670
            IR    ++ +P TRLI LEN++ +  G
Sbjct  122  IRAS--DLHYPPTRLIALENTHNYCMG  146



>ref|XP_008312508.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Cynoglossus 
semilaevis]
Length=434

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 104/151 (69%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VDLRSDTVTKP  AMR A+A AEV DDV+G DPT   L+   A + G EA LFVP+GT
Sbjct  65   RVVDLRSDTVTKPGAAMRQAIAEAEVGDDVMGEDPTVNELQRIAADMFGMEAALFVPTGT  124

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            M NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T     DGT DL+Q+E+
Sbjct  125  MSNLIAVMVHCRERGDEMIVGDLSHLHIYEQGGSAQLAGVHATTATTRPDGTFDLEQLES  184

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
             IR    +  +P +RLIC+EN++   GGR L
Sbjct  185  KIRHGYPDPHYPRSRLICVENTHNIQGGRVL  215



>ref|XP_002069264.1| GK21059 [Drosophila willistoni]
 gb|EDW80250.1| GK21059 [Drosophila willistoni]
Length=379

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M TR VDLRSDT+T+PTE MRA M+SA V DDV G DPT   LE++IA + GKEAGLFV 
Sbjct  1    MSTRIVDLRSDTLTQPTEEMRARMSSAVVGDDVYGEDPTVNELESKIASMFGKEAGLFVA  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL++++ HCP RGSEII+GD SH+ +YE GG + + GV   TIKN  DGT  L +
Sbjct  61   SGTMGNLLAIMVHCPSRGSEIIIGDQSHVFLYEQGGPAQLAGVQVATIKNEIDGTFSLAE  120

Query  578  IEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            ++  IR    +I  P T L+ +EN++   GG+ +
Sbjct  121  LQRKIRID--DIHEPITSLVVVENTHNVCGGKVV  152



>ref|WP_011697570.1| threonine aldolase [Syntrophobacter fumaroxidans]
 gb|ABK16397.1| L-threonine aldolase [Syntrophobacter fumaroxidans MPOB]
Length=353

 Score =   167 bits (422),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 3/149 (2%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+PT++MR AMA A+V DDV G DPT   L+ + A+ +GKEA LFV SGTM 
Sbjct  4    IDLRSDTVTQPTQSMRRAMAEAKVGDDVFGEDPTVNTLQEKAAERLGKEAALFVASGTMA  63

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+S+LTHC  RG E+ILGD SHI +YE GG + +GG+HPRT+ N   GTM +  IEAAI
Sbjct  64   NLVSLLTHCG-RGDEVILGDRSHIFLYEQGGTAALGGIHPRTVPNEPHGTMSVCGIEAAI  122

Query  593  RDPRFEICFPTTRLICLENSNAHSGGRCL  679
            R+    + FP TRLI LEN++    G  L
Sbjct  123  REE--NVHFPPTRLIALENTHNRCSGSPL  149



>ref|XP_010747733.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Larimichthys 
crocea]
Length=433

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 104/151 (69%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A +   EA LFVP+GT
Sbjct  64   RVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFQMEAALFVPTGT  123

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            M NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    +GT DL+Q+E+
Sbjct  124  MSNLIAVMVHCRERGDEMIVGDLSHLHIYEQGGSAQLAGVHATTVTTLPNGTFDLEQLES  183

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
             IR    +  +P TRLIC+EN++   GGR L
Sbjct  184  KIRHGYPDPHYPRTRLICVENTHNIQGGRVL  214



>ref|XP_006814697.1| PREDICTED: uncharacterized protein R102.4-like [Saccoglossus 
kowalevskii]
Length=416

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 106/151 (70%), Gaps = 1/151 (1%)
 Frame = +2

Query  230  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  409
             VDLR+DT+T+P   MR AM +A++ DDVL  DPT + LE   A ++GKEAGL+V SGTM
Sbjct  52   VVDLRTDTLTEPDSEMRNAMVNAKIGDDVLDEDPTVKELERTAAAMLGKEAGLYVLSGTM  111

Query  410  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  589
            GNL+SV+ HC  RG E++LGD SHI I+E GG + +GG+HPR + N  DGT DL ++E  
Sbjct  112  GNLLSVMCHCNHRGEEMLLGDQSHIFIHEQGGAAFLGGIHPRPVTNLPDGTFDLQELEEK  171

Query  590  IRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            IR P  +   P T+LICLENS+   GG  LS
Sbjct  172  IR-PDGDFHAPKTKLICLENSHNRCGGAVLS  201



>emb|CBN78642.1| Threonine aldolase [Ectocarpus siliculosus]
Length=1025

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 112/168 (67%), Gaps = 11/168 (7%)
 Frame = +2

Query  182  SSQFHLWFSRRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIA  361
            S +  LW  R      T+DLRSDTVT+PT  MR AM  AEV DDVLG DPT QRLEAE A
Sbjct  176  SERRGLWPGRP-----TIDLRSDTVTQPTGGMRKAMQKAEVGDDVLGEDPTVQRLEAETA  230

Query  362  KIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTI  541
            +++GKEA LFVPSGTM NLI  L  C  RGSE+I+GD SH  ++E    +  GG+  R +
Sbjct  231  ELLGKEAALFVPSGTMANLICHLIWCSNRGSEMIVGDQSHSFLWEQANAAQFGGIGYRPL  290

Query  542  KNNDDGTMDLDQIEAAIR--DPRFEICFPTTRLICLENSNAHSGGRCL  679
             N  DGTMDL  +EAA+R  +P    CFP +RL+ +EN++A  GG+ L
Sbjct  291  TNLPDGTMDLRAVEAAVRGNNP----CFPVSRLVTVENTHAQRGGKVL  334



>ref|XP_002121406.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X1 [Ciona intestinalis]
Length=365

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M   TVDLRSDT++ PT  MR AMA AE+ DDV G DPT  RL+   A++ GKE  LFVP
Sbjct  1    MEVVTVDLRSDTLSLPTADMRCAMAEAELGDDVYGEDPTVNRLQMLAAELFGKEDALFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            +GTMGNLISV+ HC  RGSE++LGD SHIH +E GGI+ + GVHP+TI+N  DGT  L +
Sbjct  61   TGTMGNLISVMCHCWQRGSEVLLGDQSHIHRFEQGGIAQLAGVHPKTIRNLPDGTFQLSE  120

Query  578  IEAAIRDPRFEICFPTTRLICLEN  649
            ++A  +    ++ F +T LIC+EN
Sbjct  121  LQAKYQTSA-DVHFASTSLICVEN  143



>ref|XP_001419158.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97451.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=368

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 107/150 (71%), Gaps = 1/150 (1%)
 Frame = +2

Query  230  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  409
             VD RSDTVTKPT  MR AMA AEV DDVLG D T + LE ++A++ G EA +F PSGTM
Sbjct  7    VVDARSDTVTKPTARMREAMARAEVGDDVLGDDRTVKALERKMAEMFGFEAAVFTPSGTM  66

Query  410  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  589
             NL+++ T C  RGSE I+GD SH+H+YE GG+S++ GVH RT+KN +DGT+ L+ I AA
Sbjct  67   ANLLAIATWCDERGSEAIIGDKSHVHLYEQGGMSSLMGVHSRTLKNREDGTLALEDIRAA  126

Query  590  IRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            IR    +  FP T+++ LEN+    GG+ L
Sbjct  127  IRTVSDD-HFPVTKVVTLENTQNKCGGKVL  155



>ref|XP_005794827.1| PREDICTED: uncharacterized protein R102.4-like [Xiphophorus maculatus]
Length=475

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 103/152 (68%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             R VDLRSDTVTKP  AMR AMA AEV DDV G DPT   L+   A++ G EA LFVPSG
Sbjct  108  VRVVDLRSDTVTKPGPAMRQAMAQAEVGDDVKGEDPTVNELQKLAAEMFGMEASLFVPSG  167

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NLI+V+ HC  RG E+I+GD SH+H+ E GG + + GVH  T+    DGT DL Q+E
Sbjct  168  TMSNLIAVMVHCRERGDEMIVGDLSHLHLCEQGGSAQLAGVHAPTVTTRPDGTFDLKQLE  227

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            + I+    +  +P TRLIC+EN++   GGR L
Sbjct  228  SKIQHGYPDSHYPHTRLICVENTHNIQGGRVL  259



>ref|WP_037564212.1| threonine aldolase [Spirochaeta sp. JC202]
 gb|KGM38782.1| threonine aldolase [Spirochaeta sp. JC202]
Length=345

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 101/143 (71%), Gaps = 3/143 (2%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VDLRSDT+T+PT AM  AMA A+V DDV G DPT  +LE   A  +GKEA L+V SGT
Sbjct  2    RIVDLRSDTMTRPTPAMSKAMAEADVGDDVFGEDPTVNKLEEMAAARLGKEAALYVASGT  61

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNL+S+L HC  RG EIILG  SH   +E GG + +GG+HPRTI N  DGT+ L +IEA
Sbjct  62   MGNLVSLLAHCG-RGEEIILGSLSHTFFFEQGGSAAVGGIHPRTIPNQPDGTLPLPEIEA  120

Query  587  AIRDPRFEICFPTTRLICLENSN  655
            AIR     + FP TRLI LEN++
Sbjct  121  AIRAD--NVHFPQTRLIVLENTH  141



>ref|XP_002777074.1| L-allo-threonine aldolase, putative [Perkinsus marinus ATCC 50983]
 gb|EER08890.1| L-allo-threonine aldolase, putative [Perkinsus marinus ATCC 50983]
Length=375

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 102/153 (67%), Gaps = 2/153 (1%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
            T  V+LRSDT T+PT  MR AMA AE  DDV G DPT    + E A+  G +  L++P+ 
Sbjct  4    THIVELRSDTFTQPTSEMRRAMAEAECGDDVWGLDPTVNAFQKEAAEKFGFKTALYLPTA  63

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NL+++L HC  +GSEIILGD +H+HIYE GG STI G H RT+ N  DGT+ L+ +E
Sbjct  64   TMSNLVAMLVHCEKKGSEIILGDKAHMHIYEQGGYSTIAGAHCRTVPNQPDGTLRLEDVE  123

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             AIR   FE  +P TR +C+EN+    GGR L+
Sbjct  124  FAIRP--FEPHYPITRAVCVENTQNVCGGRVLT  154



>emb|CEG01512.1| Aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Ostreococcus tauri]
Length=372

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            VD RSDTVTKPT  MR AMA A V DDVLG D T + LE  +AK  G E+ ++ PSGTM 
Sbjct  10   VDARSDTVTKPTANMRRAMADAVVGDDVLGDDATVKALERAMAKRFGFESAVYTPSGTMA  69

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL++V THC  RGSE I GD SH+H+YE GG+S++ GVH RT+ N DDGT+ ++ I+ AI
Sbjct  70   NLLAVATHCDERGSECICGDKSHVHLYEQGGMSSLMGVHSRTLANRDDGTIAIEDIKGAI  129

Query  593  RDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            R    +  FP T+++CLEN+    GG+ LS
Sbjct  130  R-AVGDDHFPVTKVVCLENTQNKCGGKVLS  158



>ref|XP_001625551.1| predicted protein [Nematostella vectensis]
 gb|EDO33451.1| predicted protein [Nematostella vectensis]
Length=353

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  239  LRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNL  418
            +RSDTVT+PT+ MR  MA+AEV DDV G DPT   L+ + AK+M KE  +FVPSG+MGNL
Sbjct  1    MRSDTVTQPTQEMRQFMAAAEVGDDVFGDDPTVNSLQEKAAKLMRKETAIFVPSGSMGNL  60

Query  419  ISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRD  598
            IS++ HCP RG E+I GD SHI  +E G  S  GGVH R ++ N DGT+DLD+I++ I D
Sbjct  61   ISMMAHCPHRGDELIAGDMSHIVQWEQGSASQFGGVHSRQVRTNPDGTLDLDEIKSKIHD  120

Query  599  PRFEICFPTTRLICLENSNAHSGGRCLS  682
               +  +  T++ICLE+S+  +GG  LS
Sbjct  121  GS-DSHYTHTKVICLESSHNATGGTVLS  147



>ref|XP_003385045.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Amphimedon 
queenslandica]
Length=366

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 108/153 (71%), Gaps = 0/153 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
            TR VD+RSDTVT PTE MRAAMA A V DDV G DPTA  L+ ++A ++GKEAGLF+P+G
Sbjct  4    TRVVDMRSDTVTTPTEPMRAAMAGAAVGDDVYGEDPTAIALQGKMASLLGKEAGLFLPTG  63

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NL +++ H   RG E+ILGD SHI I+E G I+++GG+ PR ++NN DGT+DLD++ 
Sbjct  64   TMSNLAALMCHANGRGEEVILGDRSHISIWEQGAIASLGGIFPRQVRNNPDGTLDLDELV  123

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            + I     +  +  T+ I +EN+    GG  +S
Sbjct  124  SKIHPGGHDGHYCLTKAIVIENTQNFCGGAPIS  156



>ref|XP_003080829.1| L-allo-threonine aldolase, putative (ISS) [Ostreococcus tauri]
Length=412

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            VD RSDTVTKPT  MR AMA A V DDVLG D T + LE  +AK  G E+ ++ PSGTM 
Sbjct  50   VDARSDTVTKPTANMRRAMADAVVGDDVLGDDATVKALERAMAKRFGFESAVYTPSGTMA  109

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL++V THC  RGSE I GD SH+H+YE GG+S++ GVH RT+ N DDGT+ ++ I+ AI
Sbjct  110  NLLAVATHCDERGSECICGDKSHVHLYEQGGMSSLMGVHSRTLANRDDGTIAIEDIKGAI  169

Query  593  RDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            R    +  FP T+++CLEN+    GG+ LS
Sbjct  170  R-AVGDDHFPVTKVVCLENTQNKCGGKVLS  198



>ref|WP_013218741.1| threonine aldolase [Dehalogenimonas lykanthroporepellens]
 gb|ADJ26605.1| Threonine aldolase [Dehalogenimonas lykanthroporepellens BL-DC-9]
Length=340

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDT+T PT  MR AM  AEV DDV G DPT  RLEA  A++ GKEAGL+ PSGTM 
Sbjct  4    IDLRSDTITHPTPEMRRAMFEAEVGDDVFGEDPTVNRLEALSAEMTGKEAGLYTPSGTMS  63

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NLI+VL H   RG EIILGD SHI + E GG +  GG+  RT+ N DDGT++LD IE A+
Sbjct  64   NLIAVLAHTR-RGDEIILGDRSHIFLNEAGGAAVFGGLSLRTVPNADDGTIELDVIEQAV  122

Query  593  RDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            RD    I FP + L+CLEN++   GG  LS
Sbjct  123  RDD--NIHFPPSTLLCLENTHNFCGGAPLS  150



>ref|XP_010795211.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Notothenia 
coriiceps]
Length=431

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 104/152 (68%), Gaps = 0/152 (0%)
 Frame = +2

Query  224  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  403
             R VDLRSDTVTKP  AMR AMA AEV DDV+  DP    L+   A++   EA LFVP+G
Sbjct  61   VRVVDLRSDTVTKPGPAMRQAMAVAEVGDDVMREDPCVNELQEIAAEMFQMEAALFVPTG  120

Query  404  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  583
            TM NLI+V+ HC  RG E+I+G+ SH+HIYE GG + + GVH  T+ N  DG+ DL+Q+E
Sbjct  121  TMSNLIAVMVHCRERGDEMIVGNLSHLHIYEQGGSAQLAGVHATTVDNLPDGSFDLEQLE  180

Query  584  AAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            + IR    +  +P +RLIC+EN++   GGR L
Sbjct  181  SKIRHGYPDPHYPRSRLICVENTHNIQGGRVL  212



>ref|WP_019902461.1| hypothetical protein [Chloroflexi bacterium SCGC AB-629-P13]
Length=344

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 7/154 (5%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            + +DLRSDTVT PT +MR+AMA+AE+ DD  G DPT   L+  +A +MGKE+ LFVPSGT
Sbjct  2    KEIDLRSDTVTHPTNSMRSAMANAELGDDGHGDDPTVNHLQERVADMMGKESALFVPSGT  61

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            M NL+++L+HC  RG EII+GD+SH+++YE GG S++GG+  R ++ + DGT+D  +IE 
Sbjct  62   MANLVAILSHCE-RGDEIIVGDWSHVYLYEYGGASSLGGLIYRQVETSRDGTLDPGKIED  120

Query  587  AIR--DPRFEICFPTTRLICLENSNAHSGGRCLS  682
            AIR   PR    FP T L+CLENS+    G  L+
Sbjct  121  AIRPSSPR----FPKTSLVCLENSHNRCSGAVLT  150



>ref|WP_018052780.1| hypothetical protein [Marinimicrobia bacterium SCGC AB-629-J13]
Length=342

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            + +DLRSDTVT P+  M  A+ SAE+ DDV   DPT   L+ +  +I GKEAGL VPSGT
Sbjct  2    KLIDLRSDTVTLPSPEMYEAIVSAELGDDVFAEDPTVNALQEKATEITGKEAGLLVPSGT  61

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNL+S+LTHC  RG+E ILGD SH  +YE GGIS  GG+H R +KN+ DGTM+L  I  
Sbjct  62   MGNLVSILTHCK-RGTEAILGDQSHTFLYECGGISAYGGIHSRQLKNHPDGTMELSDIRK  120

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
            A+R    +  FP T LICLEN++    G  LS
Sbjct  121  AVRS--HDDHFPVTSLICLENTHNRCSGAPLS  150



>ref|XP_002001285.1| GI10703 [Drosophila mojavensis]
 gb|EDW16746.1| GI10703 [Drosophila mojavensis]
Length=383

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            VDLRSDTV++PT  MRA MASA V DDV G DPT   LEA+ A I GKEAGLFVPSGTMG
Sbjct  10   VDLRSDTVSQPTPEMRARMASAVVGDDVYGEDPTLAELEAKTAAIFGKEAGLFVPSGTMG  69

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL++V+ HC  RGSE I+GD SHI +YE GG + + GV    ++N  DGT  L+++   I
Sbjct  70   NLLAVMVHCSRRGSEAIVGDLSHIFLYEQGGSAHLAGVQLAQLRNLPDGTFSLEELRHKI  129

Query  593  RDPRFEICF-PTTRLICLENSNAHSGGRCL  679
            R  ++E C  P T L+ +EN++   GG+ L
Sbjct  130  R--QYEDCHEPVTSLVVVENTHNMCGGKVL  157



>ref|XP_001989934.1| GH19068 [Drosophila grimshawi]
 gb|EDV92996.1| GH19068 [Drosophila grimshawi]
Length=379

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 102/155 (66%), Gaps = 3/155 (2%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M    VDLRSDTVT+PT  MR  MA+A V DDV G DPT   LE++ A I GKEAGLFVP
Sbjct  1    MSNNIVDLRSDTVTQPTPEMRQRMATAVVGDDVFGEDPTIAELESKTAAIFGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL++++ HC  RGSE I+GD SH  +YE GG S I GV   TI+N  DGT  L +
Sbjct  61   SGTMGNLLAIMVHCNRRGSEAIVGDLSHTFLYEQGGASFIAGVQLATIRNQPDGTFSLAE  120

Query  578  IEAAIRDPRFEICF-PTTRLICLENSNAHSGGRCL  679
            +   IR  ++E C  P T LI +EN+    GG+ +
Sbjct  121  LRQKIR--QYEDCHEPVTSLIVVENTQNICGGKVM  153



>gb|KDR08943.1| hypothetical protein L798_00871 [Zootermopsis nevadensis]
Length=404

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 104/156 (67%), Gaps = 1/156 (1%)
 Frame = +2

Query  215  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  394
            K   R VDLRSDTV++PT+ MR AM  A V DDV G DPT   LE + A ++GKE+GLFV
Sbjct  45   KGTVRVVDLRSDTVSQPTQEMRKAMFEAAVGDDVYGEDPTVNALEEKAAALLGKESGLFV  104

Query  395  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  574
            PSGTM NL++++ HC  RGSE+I G+ SH  ++E GG + I GV    ++NN DGT DLD
Sbjct  105  PSGTMANLLAIMVHCSQRGSEMICGEKSHTFLFEQGGPAQIAGVQIWPLRNNPDGTFDLD  164

Query  575  QIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCLS  682
             +E  +R+   +   P T LIC+EN+    GGR LS
Sbjct  165  DMEEKVRN-HTDDHEPMTSLICVENTQNWCGGRVLS  199



>ref|WP_004713360.1| threonine aldolase [Yersinia rohdei]
 gb|EEQ04671.1| L-allo-threonine aldolase [Yersinia rohdei ATCC 43380]
 gb|AJJ11649.1| low specificity L-threonine aldolase [Yersinia rohdei]
Length=339

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEAE AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPNAAMRQAMANAEVGDDVYGDDPTVNALEAEAAKLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVAAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|XP_784851.4| PREDICTED: probable low-specificity L-threonine aldolase 2, partial 
[Strongylocentrotus purpuratus]
Length=389

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = +2

Query  230  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  409
             VD RSDT+TKPT+AMR AM+ A V DDV G DPT   L+ ++AK++ K+A LFVP+GTM
Sbjct  25   VVDFRSDTITKPTDAMRKAMSEAVVGDDVFGEDPTVNELQRKVAKLLKKDAALFVPTGTM  84

Query  410  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  589
             NLI++++H   RG E++LGD  HI  +E GG++   GV P  +K   DGT+DLD++E+ 
Sbjct  85   SNLIALMSHTTGRGEEVLLGDQCHIFDWEQGGMAQFAGVCPHVVKTLPDGTLDLDELESK  144

Query  590  IRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            IR    +I   +TRLIC+EN++  SGG+ L
Sbjct  145  IRPS--DIHMASTRLICIENTHNSSGGKVL  172



>ref|XP_011559305.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Plutella 
xylostella]
Length=372

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 106/153 (69%), Gaps = 2/153 (1%)
 Frame = +2

Query  221  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  400
            +T  VDLRSDTVTKPT+AMR AM ++ V DDV G DPT   LE +IA ++ K+A LFVPS
Sbjct  1    MTHIVDLRSDTVTKPTDAMRHAMVNSAVGDDVYGEDPTVNALERKIATMLDKQAALFVPS  60

Query  401  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  580
            GTM NLI+V+ HC  RGSE ++G+ SHI  YE GG + +GGV   T++N  DGT DLD+ 
Sbjct  61   GTMANLIAVMVHCSQRGSEALVGNMSHIFKYEQGGAAHLGGVLLTTLENKPDGTFDLDEF  120

Query  581  EAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            E  IR    +I  P T ++ +EN++ + GG+ L
Sbjct  121  EKRIRGS--DIHEPVTAMVAVENTHNYCGGKVL  151



>ref|XP_011560012.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Plutella 
xylostella]
Length=372

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 106/153 (69%), Gaps = 2/153 (1%)
 Frame = +2

Query  221  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  400
            +T  VDLRSDTVTKPT+AMR AM ++ V DDV G DPT   LE +IA ++ K+A LFVPS
Sbjct  1    MTHIVDLRSDTVTKPTDAMRHAMVNSAVGDDVYGEDPTVNALERKIATMLDKQAALFVPS  60

Query  401  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  580
            GTM NLI+V+ HC  RGSE ++G+ SHI  YE GG + +GGV   T++N  DGT DLD+ 
Sbjct  61   GTMANLIAVMVHCSQRGSEALVGNMSHIFKYEQGGAAHLGGVLLTTLENKPDGTFDLDEF  120

Query  581  EAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
            E  IR    +I  P T ++ +EN++ + GG+ L
Sbjct  121  EKRIRGS--DIHEPVTAMVAVENTHNYCGGKVL  151



>ref|XP_008102407.1| PREDICTED: LOW QUALITY PROTEIN: probable low-specificity L-threonine 
aldolase 2 [Anolis carolinensis]
Length=446

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 106/159 (67%), Gaps = 0/159 (0%)
 Frame = +2

Query  203  FSRRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEA  382
              RR+   R VDLRSDTVT+P+ AMR AMA A+V  D  G DPT   L+  +A+++G E 
Sbjct  75   LPRRRCSHRVVDLRSDTVTRPSPAMRRAMAQAKVGQDDYGEDPTVNELQRVVAELLGMEE  134

Query  383  GLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGT  562
             LFVP+ TM NLI+V+ HC  RG++++LG  SHIH++E GG+S + GVH + ++   +GT
Sbjct  135  ALFVPTTTMANLIAVMCHCHRRGAQVLLGKKSHIHVFEQGGVSQVAGVHSQLLQELPNGT  194

Query  563  MDLDQIEAAIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
              LD++E  I++      +P   LICLEN++  +GGR L
Sbjct  195  FCLDEVERKIQESHRSKYYPCPELICLENTHCSAGGRIL  233



>ref|XP_001517050.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Ornithorhynchus 
anatinus]
Length=342

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 100/151 (66%), Gaps = 0/151 (0%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VDLRSDTVT+P   MR AMA A V DD  G DPT Q L+   A+++G E  LFVP+ T
Sbjct  37   RVVDLRSDTVTRPGPEMRRAMAQAVVGDDDYGEDPTVQELQYRAAELLGVERTLFVPTNT  96

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            M NLI+V+ HCP RGS+++LG  SH+H+YE GG++ I GVH   + +   GT+DLD++E 
Sbjct  97   MANLIAVMCHCPRRGSQLLLGQESHLHVYEQGGVAQIAGVHSHPLPDLPRGTLDLDELER  156

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
             +R        P   L+CLEN++  +GGR L
Sbjct  157  KVRQGHGSPYHPRCELVCLENTHNSAGGRAL  187



>emb|CCO67312.1| Low-specificity L-threonine aldolase [Yersinia enterocolitica 
IP 10393]
 emb|CCV62190.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:2) 
str. YE3094/96]
Length=351

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 109/155 (70%), Gaps = 6/155 (4%)
 Frame = +2

Query  203  FSRRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEA  382
            FS R+ V   +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA
Sbjct  6    FSSREKVM-LIDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEA  64

Query  383  GLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGT  562
             LF+P+GT  NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT
Sbjct  65   ALFLPTGTQANLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGT  123

Query  563  MDLDQIEAAIRDPRFEICFPTTRLICLENSNAHSG  667
            + LD++ AAI+    +I F  TRL+ LEN+  HSG
Sbjct  124  LPLDKVLAAIKPD--DIHFAQTRLLSLENT--HSG  154



>ref|WP_012119285.1| threonine aldolase [Roseiflexus castenholzii]
 gb|ABU56855.1| Threonine aldolase [Roseiflexus castenholzii DSM 13941]
Length=359

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 106/158 (67%), Gaps = 8/158 (5%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M ++ +DLRSDTVT PT AMR AMA AEV DDV G DPT  RLE   A+ +GK A +FVP
Sbjct  1    MPSKPIDLRSDTVTLPTPAMRTAMARAEVGDDVYGEDPTINRLEEFAAQRVGKAAAMFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL ++L HC  RG E+I+GD SHI+ YE GG S +GGV    + N  DGT+ LD 
Sbjct  61   SGTMGNLCALLAHCQ-RGDEVIVGDASHIYNYEAGGASVVGGVAFHVLPNQPDGTIALDH  119

Query  578  IEAAIR---DPRFEICFPTTRLICLENSNAHSGGRCLS  682
            + AA+R   DP    C   TRLICLEN++   GG  LS
Sbjct  120  LRAAVRWLDDPH---C-AETRLICLENTHNSCGGVALS  153



>emb|CFQ65831.1| L-threonine aldolase [Yersinia frederiksenii]
Length=339

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 106/145 (73%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P+ AMR+AMA+AEV DDV G DPT   LEAE A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPSAAMRSAMANAEVGDDVYGDDPTVNALEAEAARLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_023377740.1| Low-specificity L-threonine aldolase [Smithella sp. ME-1]
 gb|ESP63005.1| Low-specificity L-threonine aldolase [Smithella sp. ME-1]
Length=344

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 103/149 (69%), Gaps = 3/149 (2%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+PT+ MR AMA A+V DDV G DPT   LE   A  MGKEAGLF+PSGTMG
Sbjct  2    IDLRSDTVTQPTDEMRHAMALADVGDDVYGEDPTINYLEELSADRMGKEAGLFIPSGTMG  61

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NLI+ LTHC  RG E I+GD +H   YE GG+S +GG+   T+ N  DGT+ +  ++ AI
Sbjct  62   NLIAFLTHCQ-RGEEAIMGDQAHTFYYEVGGVSALGGIMVHTVPNQADGTIRISDLKNAI  120

Query  593  RDPRFEICFPTTRLICLENSNAHSGGRCL  679
            R    ++ FPTTRLI LEN++   GG  L
Sbjct  121  RIE--DVHFPTTRLIALENTHNRCGGVVL  147



>ref|XP_002053845.1| GJ23119 [Drosophila virilis]
 gb|EDW67365.1| GJ23119 [Drosophila virilis]
Length=379

 Score =   157 bits (396),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 103/155 (66%), Gaps = 3/155 (2%)
 Frame = +2

Query  218  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  397
            M    VDLRSDTV+ PT  MR  MA+A V DDV G DPT   L+ + A I GKEAGLFVP
Sbjct  1    MSVNIVDLRSDTVSLPTPEMRERMAAAVVGDDVYGEDPTVAELQEKTAAIFGKEAGLFVP  60

Query  398  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  577
            SGTMGNL++V+ HC  RGSE I+GD SHI +YE GG + + GV   TI+N  DGT  L++
Sbjct  61   SGTMGNLLAVMVHCNRRGSEAIVGDLSHIFLYEQGGAAHLAGVQLATIRNQQDGTFSLEE  120

Query  578  IEAAIRDPRFEICF-PTTRLICLENSNAHSGGRCL  679
            +   IR  ++E C  P T L+ +EN++   GG+ +
Sbjct  121  LRHKIR--QYEDCHEPVTSLVVVENTHNICGGKVM  153



>ref|XP_008483598.1| PREDICTED: probable low-specificity L-threonine aldolase 2, partial 
[Diaphorina citri]
Length=223

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 103/151 (68%), Gaps = 1/151 (1%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            RTVD+RSDT++KPT  M+  M + EV DDV   DPT + L+ + AK+ GKEA +FVPSGT
Sbjct  2    RTVDIRSDTISKPTMEMKNYMFNCEVGDDVYLEDPTCKELQEKAAKLAGKEAAIFVPSGT  61

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNLI+++THC  R SEII+GD SHI ++E GG S IG V  R + N  DGT DLD++EA
Sbjct  62   MGNLIAIMTHCDRRDSEIIVGDCSHIMLWEQGGASQIGRVLMRGVTNQKDGTFDLDEMEA  121

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGGRCL  679
                     C  +T L+C+EN++ + GG  L
Sbjct  122  KFSTADNIHC-ASTSLVCVENTHNYCGGTVL  151



>emb|CFQ43732.1| L-threonine aldolase [Yersinia aleksiciae]
Length=339

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEAE A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPNAAMRHAMANAEVGDDVYGDDPTVNALEAEAARLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>tpg|DAA34403.1| TPA_inf: threonine aldolase [Amblyomma variegatum]
Length=210

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 98/148 (66%), Gaps = 2/148 (1%)
 Frame = +2

Query  227  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  406
            R VDLRSDT+TKPT  MR AM  AEV DDV   DPT   LE  +A+++GKEA LFVP+GT
Sbjct  5    RVVDLRSDTMTKPTPEMRQAMRDAEVGDDVFKEDPTVNELERVVAELLGKEAALFVPTGT  64

Query  407  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  586
            MGNL SV+ HC  RG EI++GD SHI + E GG++ +  VH   +    DG + L+ +E+
Sbjct  65   MGNLASVMAHCDQRGQEILVGDASHIFLNEQGGVAQVASVHSWAVPTQKDGRLLLEDLES  124

Query  587  AIRDPRFEICFPTTRLICLENSNAHSGG  670
             +R  R +   P T L+CLEN++   GG
Sbjct  125  RVR--RRDFHCPKTSLLCLENTHNFCGG  150



>emb|CRF04697.1| L-threonine aldolase [Yersinia intermedia]
Length=339

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 105/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA++A + GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDTAMRNAMANAEVGDDVYGDDPTVNALEAKVASLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I+ NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIEANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_004873721.1| threonine aldolase [Yersinia mollaretii]
 gb|EEQ12086.1| L-allo-threonine aldolase [Yersinia mollaretii ATCC 43969]
Length=339

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEAE A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDTAMRNAMANAEVGDDVYGDDPTVNALEAEAARLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_042663615.1| threonine aldolase [Yersinia enterocolitica]
 gb|AJJ26706.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYETGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_032898062.1| threonine aldolase [Yersinia bercovieri]
Length=339

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 103/145 (71%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AM +AEV DDV G DPT   LEAE A++ GKEA LF+PSGT  
Sbjct  3    IDLRSDTVTQPDAAMRNAMVNAEVGDDVYGDDPTVNALEAEAARVSGKEAALFLPSGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|XP_009060249.1| hypothetical protein LOTGIDRAFT_154302 [Lottia gigantea]
 gb|ESO89212.1| hypothetical protein LOTGIDRAFT_154302 [Lottia gigantea]
Length=362

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +D RSDTVTKPT+ M  AM S+ + D V   DPT  +L+   A++ GKEA LFVP+GTM 
Sbjct  4    IDFRSDTVTKPTKEMYEAMVSSPLGDHVNNEDPTVNKLQERCAQLFGKEAALFVPTGTMA  63

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NLIS++ HC  R  E+I+G  SHI  YE G    + GV  R+++N DDGT DLD++ + I
Sbjct  64   NLISIMVHCESRFQEVIIGSKSHIVYYEVGNAGHLAGVQLRSVENKDDGTFDLDEVSSLI  123

Query  593  RDPRFEICFPTTRLICLENSNAHSGGRCL  679
            RD + ++ +P+TRLIC+EN++   GG+ L
Sbjct  124  RD-KNDVHYPSTRLICVENTHNKCGGKVL  151



>emb|CFQ29270.1| L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 103/145 (71%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AM +AEV DDV G DPT   LEAE A++ GKEA LF+PSGT  
Sbjct  3    IDLRSDTVTQPDAAMRNAMVNAEVGDDVYGDDPTVNALEAEAARVSGKEAALFLPSGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_019079898.1| threonine aldolase [Yersinia enterocolitica]
 emb|CFQ82450.1| L-threonine aldolase [Yersinia enterocolitica]
 emb|CRE54496.1| L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVNALEAQAARLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_019083465.1| threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVNALEAQAARLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_005162818.1| threonine aldolase [Yersinia enterocolitica]
 emb|CBY27800.1| low-specificity L-threonine aldolase [Yersinia enterocolitica 
subsp. palearctica Y11]
 gb|ADZ43113.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
105.5R(r)]
 gb|EHB20617.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
PhRBD_Ye1]
 emb|CCV37830.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:9) 
str. YE56/03]
 gb|EOR69656.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
YE-149]
 gb|EOR80767.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
YE-P1]
 gb|EOR81361.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
YE-150]
 gb|EOR83594.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
YE-P4]
 emb|CCV29351.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:9) 
str. YE212/02]
 gb|KGA62622.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
 gb|KGA67760.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
 emb|CFQ17976.1| L-threonine aldolase [Yersinia enterocolitica]
 emb|CFV28582.1| L-threonine aldolase [Yersinia enterocolitica]
 emb|CFW65679.1| L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_023161056.1| L-allo-threonine aldolase [Yersinia enterocolitica]
 emb|CCV54034.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:3) 
str. YE12/03]
Length=339

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_005171133.1| threonine aldolase [Yersinia enterocolitica]
 gb|EKA27233.1| L-threonine aldolase [Yersinia enterocolitica subsp. enterocolitica 
WA-314]
 gb|KGA70404.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
 gb|KGA76475.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
 gb|AJI81980.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
 emb|CFQ08605.1| L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVNALEAQAARLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_046050696.1| threonine aldolase [Yersinia enterocolitica]
 emb|CCQ40051.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:5) 
str. YE53/03]
Length=339

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVNALEAQAARLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



>ref|WP_011816022.1| threonine aldolase [Yersinia enterocolitica]
 ref|YP_001005802.1| L-threonine aldolase [Yersinia enterocolitica subsp. enterocolitica 
8081]
 emb|CAL11585.1| L-allo-threonine aldolase [Yersinia enterocolitica subsp. enterocolitica 
8081]
 gb|AJJ25309.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  233  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  412
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVSALEAQAARLSGKEAALFLPTGTQA  62

Query  413  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  592
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  593  RDPRFEICFPTTRLICLENSNAHSG  667
            +    +I F  TRL+ LEN+  HSG
Sbjct  122  KPD--DIHFAQTRLLSLENT--HSG  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1161397529311