BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1713

Length=798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086756.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    355   9e-117   Sesamum indicum [beniseed]
ref|XP_009615859.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    355   9e-117   Nicotiana tomentosiformis
ref|XP_009785204.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    354   3e-116   Nicotiana sylvestris
ref|XP_011086755.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    353   7e-116   Sesamum indicum [beniseed]
ref|NP_001275120.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    350   1e-114   Solanum tuberosum [potatoes]
gb|KJB50332.1|  hypothetical protein B456_008G164400                    348   7e-114   Gossypium raimondii
gb|KJB50333.1|  hypothetical protein B456_008G164400                    346   5e-113   Gossypium raimondii
ref|XP_009770074.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    346   6e-113   Nicotiana sylvestris
ref|XP_009609277.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    345   9e-113   Nicotiana tomentosiformis
ref|XP_004232268.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    345   1e-112   Solanum lycopersicum
ref|XP_010644983.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    345   4e-112   Vitis vinifera
ref|XP_002266661.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    343   6e-112   Vitis vinifera
gb|KJB08870.1|  hypothetical protein B456_001G109800                    343   7e-112   Gossypium raimondii
emb|CAN73193.1|  hypothetical protein VITISV_022287                     341   5e-111   Vitis vinifera
ref|XP_004310055.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    338   9e-110   Fragaria vesca subsp. vesca
ref|XP_011041538.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    337   1e-109   Populus euphratica
emb|CDP13320.1|  unnamed protein product                                339   1e-109   Coffea canephora [robusta coffee]
ref|XP_010248930.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    337   2e-109   Nelumbo nucifera [Indian lotus]
ref|XP_008222059.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    336   3e-109   Prunus mume [ume]
ref|XP_007045030.1|  51 kDa subunit of complex I                        335   7e-109   Theobroma cacao [chocolate]
ref|XP_002315622.1|  hypothetical protein POPTR_0010s06750g             335   1e-108   Populus trichocarpa [western balsam poplar]
ref|XP_011071205.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    335   1e-108   Sesamum indicum [beniseed]
ref|XP_012085644.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    334   2e-108   Jatropha curcas
ref|XP_010547695.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    334   2e-108   
gb|EYU42106.1|  hypothetical protein MIMGU_mgv1a005364mg                333   3e-108   Erythranthe guttata [common monkey flower]
ref|XP_010682836.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    333   8e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006484064.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    332   1e-107   Citrus sinensis [apfelsine]
ref|XP_004497858.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    332   2e-107   
ref|XP_008360129.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    331   4e-107   Malus domestica [apple tree]
ref|XP_002514955.1|  NADH-ubiquinone oxidoreductase flavoprotein,...    330   5e-107   Ricinus communis
gb|AES60212.2|  NADH-ubiquinone oxidoreductase 51 kDa subunit           330   9e-107   Medicago truncatula
ref|XP_004497859.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    329   1e-106   Cicer arietinum [garbanzo]
ref|XP_003535239.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    329   2e-106   Glycine max [soybeans]
ref|XP_008340188.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    329   3e-106   
ref|XP_006574505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    328   4e-106   Glycine max [soybeans]
ref|XP_008340187.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    329   5e-106   
ref|XP_009372324.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    327   8e-106   Pyrus x bretschneideri [bai li]
ref|XP_003589961.1|  NADH-quinone oxidoreductase subunit F              330   1e-105   
ref|XP_007145867.1|  hypothetical protein PHAVU_007G274700g             327   2e-105   Phaseolus vulgaris [French bean]
ref|XP_008443176.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    327   2e-105   Cucumis melo [Oriental melon]
gb|EPS65614.1|  hypothetical protein M569_09162                         327   3e-105   Genlisea aurea
ref|XP_009122464.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    326   4e-105   Brassica rapa
ref|XP_010546277.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    326   4e-105   Tarenaya hassleriana [spider flower]
ref|XP_006399353.1|  hypothetical protein EUTSA_v10013394mg             325   5e-105   Eutrema salsugineum [saltwater cress]
ref|NP_196470.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1        325   7e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65274.1|  NADH dehydrogenase                                      325   8e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452860.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    325   9e-105   
ref|XP_010423066.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    325   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010459420.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    325   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006287433.1|  hypothetical protein CARUB_v10000637mg             326   2e-104   
ref|XP_010491494.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    323   5e-104   Camelina sativa [gold-of-pleasure]
ref|XP_007222426.1|  hypothetical protein PRUPE_ppa004904mg             323   7e-104   Prunus persica
ref|XP_004136606.2|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    322   7e-104   Cucumis sativus [cucumbers]
ref|XP_002873369.1|  hypothetical protein ARALYDRAFT_487692             321   2e-103   
ref|XP_009131078.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    321   2e-103   Brassica rapa
gb|ADN33976.1|  NADH-ubiquinone oxidoreductase flavoprotein             318   5e-102   Cucumis melo subsp. melo
ref|XP_009403957.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    311   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407142.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    309   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010911159.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    310   2e-98    Elaeis guineensis
ref|XP_009385396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    308   3e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148767.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit      308   3e-98    Zea mays [maize]
ref|XP_003557368.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    308   7e-98    Brachypodium distachyon [annual false brome]
gb|EMS64088.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    307   7e-98    Triticum urartu
gb|EMT32185.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1, m...    307   9e-98    
gb|ACF84291.1|  unknown                                                 307   1e-97    Zea mays [maize]
ref|NP_001141093.1|  uncharacterized protein LOC100273176               307   1e-97    Zea mays [maize]
ref|XP_004958515.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    307   1e-97    Setaria italica
gb|ACL53142.1|  unknown                                                 306   3e-97    Zea mays [maize]
ref|XP_008799963.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    305   6e-97    
ref|XP_010025340.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    304   7e-97    Eucalyptus grandis [rose gum]
ref|XP_008799962.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    305   9e-97    
ref|XP_006658044.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    305   9e-97    Oryza brachyantha
ref|XP_008799961.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    305   1e-96    Phoenix dactylifera
ref|XP_008799960.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    305   1e-96    Phoenix dactylifera
ref|XP_006827286.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    303   2e-96    Amborella trichopoda
dbj|BAJ94094.1|  predicted protein                                      303   3e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006438083.1|  hypothetical protein CICLE_v10033600mg             301   4e-96    
ref|XP_010025338.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    302   5e-96    Eucalyptus grandis [rose gum]
dbj|BAG89406.1|  unnamed protein product                                300   5e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006838360.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    302   8e-96    Amborella trichopoda
gb|AHA84169.1|  NADH-quinone oxidoreductase subunit F                   301   2e-95    Phaseolus vulgaris [French bean]
gb|EAZ40868.1|  hypothetical protein OsJ_25349                          300   6e-95    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04909.1|  hypothetical protein OsI_27090                          300   8e-95    Oryza sativa Indica Group [Indian rice]
ref|NP_001060455.1|  Os07g0645400                                       300   9e-95    
gb|ACE96388.1|  esterase/lipase/thioesterase                            293   3e-93    Populus tremula [European aspen]
gb|ACE96363.1|  esterase/lipase/thioesterase                            292   4e-93    Populus tremula [European aspen]
gb|ACE96365.1|  esterase/lipase/thioesterase                            292   5e-93    Populus tremula [European aspen]
gb|ACE96369.1|  esterase/lipase/thioesterase                            290   3e-92    Populus tremula [European aspen]
ref|XP_001754412.1|  predicted protein                                  291   4e-92    
ref|XP_002977599.1|  hypothetical protein SELMODRAFT_443575             291   7e-92    Selaginella moellendorffii
ref|XP_001778863.1|  predicted protein                                  287   2e-90    
ref|XP_002975195.1|  hypothetical protein SELMODRAFT_150347             286   3e-90    
ref|XP_003058710.1|  predicted protein                                  270   1e-83    Micromonas pusilla CCMP1545
gb|ACE96395.1|  esterase/lipase/thioesterase                            268   1e-83    Populus tremula [European aspen]
gb|ACE96394.1|  esterase/lipase/thioesterase                            266   6e-83    Populus tremula [European aspen]
gb|ACE96393.1|  esterase/lipase/thioesterase                            265   8e-83    Populus tremula [European aspen]
gb|KIY99198.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1          267   2e-82    Monoraphidium neglectum
tpg|DAA41609.1|  TPA: NADH-ubiquinone oxidoreductase subunit, mRNA      266   5e-82    
ref|XP_005650585.1|  NADH-ubiquinone oxidoreductase                     264   2e-81    Coccomyxa subellipsoidea C-169
ref|XP_002503039.1|  predicted protein                                  261   8e-81    Micromonas commoda
ref|XP_005846008.1|  NADH:ubiquinone oxidoreductase 51 kD subunit       260   5e-80    Chlorella variabilis
ref|XP_007514630.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit      261   5e-80    Bathycoccus prasinos
gb|KDD75042.1|  respiratory-chain NADH dehydrogenase                    260   7e-80    Helicosporidium sp. ATCC 50920
ref|XP_003083193.1|  PREDICTED P0503D09.102 gene product [Oryza s...    258   7e-79    Ostreococcus tauri
ref|XP_001421384.1|  predicted protein                                  253   3e-77    Ostreococcus lucimarinus CCE9901
emb|CBI21762.3|  unnamed protein product                                245   1e-75    Vitis vinifera
ref|XP_010263147.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    249   3e-75    Nelumbo nucifera [Indian lotus]
ref|XP_011398745.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    248   3e-75    Auxenochlorella protothecoides
ref|XP_002948368.1|  NADH:ubiquinone oxidoreductase 51 kDa subunit      246   2e-74    Volvox carteri f. nagariensis
gb|AAL89893.1|  RE33648p                                                238   2e-74    Drosophila melanogaster
ref|XP_001702590.1|  NADH:ubiquinone oxidoreductase 51 kDa subunit      244   1e-73    Chlamydomonas reinhardtii
ref|XP_010276028.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    246   2e-73    
gb|KHJ94492.1|  NADH oxidoreductase, F subunit                          244   2e-73    Oesophagostomum dentatum [nodule worm]
gb|ETN67150.1|  NADH-ubiquinone oxidoreductase flavoprotein 1 (nd...    243   5e-73    Anopheles darlingi [American malaria mosquito]
emb|CEI93034.1|  Putative NADH dehydrogenase [ubiquinone] flavopr...    236   6e-73    Rhizopus microsporus
ref|XP_003451045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    242   7e-73    Oreochromis niloticus
ref|XP_006804891.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    242   7e-73    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005177827.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    242   8e-73    Musca domestica
ref|XP_004334975.1|  NADH oxidoreductase (quinone), F subunit           242   8e-73    Acanthamoeba castellanii str. Neff
ref|XP_005472675.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    242   8e-73    Oreochromis niloticus
ref|XP_004541258.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    241   1e-72    Maylandia zebra
ref|XP_004541259.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    241   2e-72    Maylandia zebra
gb|EFA77854.1|  ubiquinone oxidoreductase                               241   2e-72    Heterostelium album PN500
ref|XP_007439249.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    240   2e-72    Python bivittatus
gb|AGM32801.1|  NADH-ubiquinone oxidoreductase                          235   3e-72    Coptotermes formosanus
ref|XP_010103203.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1     239   3e-72    
gb|ABY55757.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1          233   3e-72    Drosophila silvestris
ref|XP_001847747.1|  NADH dehydrogenase flavoprotein 1, mitochond...    240   4e-72    Culex quinquefasciatus
emb|CEF69460.1|  NADH dehydrogenase (Ubiquinone) flavoprotein 1         239   7e-72    Strongyloides ratti
gb|AAQ63696.1|  NADH:ubiquinone oxidoreductase 51 kD subunit            240   7e-72    Chlamydomonas reinhardtii
ref|XP_002038046.1|  GM17964                                            238   8e-72    Drosophila sechellia
gb|ADI40704.1|  NADH dehydrogenase flavoprotein 1, 51kDa                233   9e-72    Cynopterus sphinx [greater short-nosed fruit bat]
ref|XP_003941287.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    236   1e-71    Saimiri boliviensis boliviensis
ref|XP_005063380.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   1e-71    
gb|ETE69752.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    238   1e-71    Ophiophagus hannah
ref|XP_005864550.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    238   1e-71    Myotis brandtii
gb|ADI40702.1|  NADH dehydrogenase flavoprotein 1, 51kDa                233   1e-71    Scotophilus kuhlii
ref|XP_006399352.1|  hypothetical protein EUTSA_v10013394mg             236   2e-71    
gb|ADI40703.1|  NADH dehydrogenase flavoprotein 1, 51kDa                232   2e-71    Miniopterus schreibersii [Common bent-wing bat]
dbj|GAM25560.1|  hypothetical protein SAMD00019534_087350               239   2e-71    Acytostelium subglobosum LB1
gb|KFH71991.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    238   2e-71    Mortierella verticillata NRRL 6337
ref|XP_001969499.1|  GG10139                                            238   2e-71    Drosophila erecta
ref|NP_608987.1|  CG9140, isoform A                                     238   2e-71    Drosophila melanogaster
ref|XP_002089130.1|  GE18950                                            238   2e-71    Drosophila yakuba
gb|ETN68323.1|  NADH oxidoreductase, F subunit                          238   2e-71    Necator americanus
ref|XP_011204925.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    238   2e-71    Bactrocera dorsalis [papaya fruit fly]
ref|XP_011204917.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    238   3e-71    Bactrocera dorsalis [papaya fruit fly]
ref|XP_005333391.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    238   3e-71    Ictidomys tridecemlineatus
gb|EMP26020.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1          241   3e-71    Chelonia mydas [green seaturtle]
ref|XP_004366877.1|  ubiquinone oxidoreductase                          238   3e-71    Cavenderia fasciculata
emb|CDW52647.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1         238   4e-71    Trichuris trichiura
ref|XP_007505720.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   4e-71    
gb|KFD48778.1|  hypothetical protein M513_10333                         237   5e-71    Trichuris suis
ref|XP_005702818.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1     238   5e-71    Galdieria sulphuraria
gb|KJH48793.1|  NADH oxidoreductase, F subunit                          237   6e-71    Dictyocaulus viviparus
gb|ACO10172.1|  NADH dehydrogenase flavoprotein 1, mitochondrial ...    237   7e-71    Osmerus mordax
ref|XP_008145081.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    236   9e-71    
ref|XP_008145080.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    236   1e-70    Eptesicus fuscus
ref|XP_002065333.1|  GK15392                                            236   1e-70    Drosophila willistoni
gb|KDR18342.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    236   1e-70    Zootermopsis nevadensis
ref|XP_003774247.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    235   2e-70    
ref|XP_002755638.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    236   2e-70    Callithrix jacchus [common marmoset]
emb|CAH65683.1|  NADH-quinone oxidoreductase                            236   2e-70    Nilaparvata lugens
ref|XP_003419441.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    236   2e-70    Loxodonta africana [African bush elephant]
ref|XP_002051457.1|  GJ12140                                            236   2e-70    Drosophila virilis
ref|NP_001164305.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    236   2e-70    Tribolium castaneum [rust-red flour beetle]
ref|XP_001962320.1|  GF15407                                            236   2e-70    Drosophila ananassae
ref|XP_002002293.1|  GI13499                                            236   2e-70    Drosophila mojavensis
ref|XP_008282052.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    236   2e-70    Stegastes partitus
ref|XP_008048441.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    236   2e-70    Carlito syrichta
ref|XP_002631183.1|  C. briggsae CBR-NUO-1 protein                      236   2e-70    Caenorhabditis briggsae
ref|XP_007518737.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    235   2e-70    Erinaceus europaeus [common hedgehog]
ref|XP_007518736.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    235   2e-70    Erinaceus europaeus [common hedgehog]
ref|NP_598427.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1,...    235   2e-70    Mus musculus [mouse]
ref|XP_003798357.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    235   2e-70    Otolemur garnettii
ref|XP_011379926.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   3e-70    Pteropus vampyrus
ref|XP_636489.1|  ubiquinone oxidoreductase                             235   3e-70    Dictyostelium discoideum AX4
ref|XP_004759596.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    235   3e-70    
ref|XP_004759595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    235   3e-70    Mustela putorius furo [black ferret]
gb|EGT44910.1|  CBN-NUO-1 protein                                       235   3e-70    Caenorhabditis brenneri
ref|XP_004393884.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   3e-70    Odobenus rosmarus divergens
ref|XP_006743665.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    235   3e-70    Leptonychotes weddellii
emb|CDJ87526.1|  unnamed protein product                                236   3e-70    Haemonchus contortus [red stomach worm]
ref|XP_004393883.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    235   4e-70    Odobenus rosmarus divergens
gb|EFB28979.1|  hypothetical protein PANDA_010233                       234   4e-70    Ailuropoda melanoleuca
ref|XP_006743666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   4e-70    Leptonychotes weddellii
ref|XP_864381.2|  PREDICTED: NADH dehydrogenase [ubiquinone] flav...    234   4e-70    
ref|XP_851761.2|  PREDICTED: NADH dehydrogenase [ubiquinone] flav...    234   4e-70    Canis lupus familiaris [dogs]
ref|XP_008707306.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   4e-70    Ursus maritimus [white bear]
ref|XP_011379925.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   4e-70    Pteropus vampyrus
ref|XP_011225862.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   5e-70    Ailuropoda melanoleuca
ref|XP_004682622.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   5e-70    
ref|XP_007505721.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   5e-70    Monodelphis domestica
ref|XP_004682621.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   5e-70    Condylura cristata
gb|AFK11344.1|  NADH dehydrogenase ubiquinone flavoprotein 1 prec...    234   5e-70    Callorhinchus milii [Australian ghost shark]
ref|XP_007962396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Chlorocebus sabaeus
ref|XP_006980586.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Peromyscus maniculatus bairdii
ref|XP_005598405.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Equus caballus [domestic horse]
gb|AEE61949.1|  unknown                                                 234   6e-70    Dendroctonus ponderosae
ref|XP_004329281.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    234   6e-70    
ref|XP_007450480.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Lipotes vexillifer [baiji]
ref|XP_006893311.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007171145.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Balaenoptera acutorostrata scammoni
ref|XP_001988013.1|  GH10936                                            234   6e-70    Drosophila grimshawi
emb|CEG66995.1|  Putative NADH-ubiquinone oxidoreductase 51 kDa s...    234   6e-70    Rhizopus microsporus
ref|XP_007450478.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Lipotes vexillifer [baiji]
ref|XP_001946240.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Acyrthosiphon pisum
ref|XP_004278073.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    
ref|XP_004278072.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Orcinus orca [Orca]
ref|XP_007126990.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    
ref|XP_006893310.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005351696.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    Microtus ochrogaster [prairie voles]
ref|XP_001917609.2|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   6e-70    
ref|XP_006771560.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   7e-70    Myotis davidii
ref|XP_006102550.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   7e-70    
ref|XP_006102549.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   7e-70    Myotis lucifugus
ref|NP_001266473.1|  NADH dehydrogenase (ubiquinone) flavoprotein...    234   7e-70    Gorilla gorilla [gorilla]
gb|EPQ06606.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    234   7e-70    Myotis brandtii
gb|ELV09500.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    234   8e-70    Tupaia chinensis
ref|NP_001011491.1|  NADH dehydrogenase ubiquinone flavoprotein 1       234   8e-70    Xenopus tropicalis [western clawed frog]
ref|XP_009183769.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   8e-70    
ref|NP_001080215.1|  NADH dehydrogenase ubiquinone flavoprotein 1       234   8e-70    Xenopus laevis [clawed frog]
ref|XP_004713642.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   8e-70    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_011842421.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   8e-70    Mandrillus leucophaeus
ref|XP_004713643.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   8e-70    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004437773.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   8e-70    
ref|XP_005384364.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   8e-70    
ref|XP_005351697.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   8e-70    
ref|XP_004437772.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   8e-70    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|AAB03672.1|  ndufv1                                                  234   9e-70    Dictyostelium discoideum
dbj|BAE90673.1|  unnamed protein product                                234   9e-70    Macaca fascicularis [crab eating macaque]
ref|XP_005384363.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   9e-70    Chinchilla lanigera
ref|XP_003509972.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   9e-70    Cricetulus griseus [Chinese hamsters]
gb|EAW74654.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1, 5...    233   9e-70    Homo sapiens [man]
gb|EHH56026.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    234   9e-70    Macaca fascicularis [crab eating macaque]
ref|NP_001274202.1|  NADH dehydrogenase (ubiquinone) flavoprotein...    234   9e-70    Macaca fascicularis [crab eating macaque]
ref|XP_011842422.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   9e-70    Mandrillus leucophaeus
ref|XP_006171329.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   9e-70    Tupaia chinensis
ref|XP_007942874.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   9e-70    Orycteropus afer afer
ref|XP_004383708.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   9e-70    
ref|XP_006861118.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   9e-70    Chrysochloris asiatica
emb|CAA76757.1|  NADH:ubiquinone oxidoreductase 51-kD subunit           234   9e-70    Homo sapiens [man]
sp|Q8HXQ9.1|NDUV1_MACFA  RecName: Full=NADH dehydrogenase [ubiqui...    234   9e-70    Macaca fascicularis [crab eating macaque]
ref|XP_010364628.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   9e-70    Rhinopithecus roxellana
ref|XP_008580125.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   9e-70    Galeopterus variegatus [Malayan flying lemur]
ref|NP_009034.2|  NADH dehydrogenase [ubiquinone] flavoprotein 1,...    234   9e-70    Homo sapiens [man]
ref|NP_001159574.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    233   9e-70    Homo sapiens [man]
dbj|BAD96781.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1, ...    234   1e-69    Homo sapiens [man]
ref|XP_004383707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   1e-69    Trichechus manatus latirostris
ref|XP_005577102.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   1e-69    
ref|XP_011719387.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    234   1e-69    Macaca nemestrina [pigtail macaque]
sp|Q0MQI4.1|NDUV1_PONPY  RecName: Full=NADH dehydrogenase [ubiqui...    233   1e-69    Pongo pygmaeus [orang utan]
ref|NP_001006973.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    233   1e-69    Rattus norvegicus [brown rat]
ref|XP_007942873.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   1e-69    Orycteropus afer afer
ref|XP_008821129.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   1e-69    Nannospalax galili
ref|XP_003117363.1|  CRE-NUO-1 protein                                  234   1e-69    Caenorhabditis remanei
ref|XP_003993754.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   1e-69    Felis catus [cat]
ref|XP_003122486.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   1e-69    Sus scrofa [pigs]
ref|XP_003122487.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    
ref|XP_004900065.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    
ref|XP_004900064.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    
ref|XP_004627196.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    
ref|XP_004481672.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    
ref|XP_005967115.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   2e-69    Pantholops hodgsonii [Tibetan antelope]
ref|XP_005534915.1|  NADH dehydrogenase I flavoprotein 51kDa subunit    233   2e-69    Cyanidioschyzon merolae strain 10D
ref|XP_004598276.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    Ochotona princeps [southern American pika]
ref|XP_006072788.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    
ref|XP_007094187.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    Panthera tigris altaica
ref|XP_004627195.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    Octodon degus
ref|XP_004481671.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    Dasypus novemcinctus
gb|KFO28327.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    233   2e-69    Fukomys damarensis [Damara mole rat]
ref|NP_496376.1|  Protein NUO-1                                         233   2e-69    Caenorhabditis elegans [roundworm]
ref|XP_006176052.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    
ref|XP_006210772.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   2e-69    
ref|XP_003293586.1|  ubiquinone oxidoreductase                          233   2e-69    Dictyostelium purpureum
ref|XP_010634093.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    Fukomys damarensis [Damara mole rat]
ref|NP_001065293.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    233   2e-69    Pan troglodytes
ref|XP_004618538.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   2e-69    
ref|XP_011957581.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    
ref|XP_006072787.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   2e-69    
ref|XP_004598277.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   3e-69    
ref|XP_006210771.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   3e-69    
ref|NP_777233.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1,...    233   3e-69    
ref|XP_004618539.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   3e-69    
ref|XP_006176053.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   3e-69    
sp|P25708.2|NDUV1_BOVIN  RecName: Full=NADH dehydrogenase [ubiqui...    233   3e-69    
ref|XP_010955042.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   3e-69    
ref|XP_004618537.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   3e-69    
ref|XP_010835982.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   3e-69    
ref|XP_004929189.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   3e-69    
ref|XP_005700086.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    231   3e-69    
gb|ETI31833.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    233   3e-69    
ref|XP_004656823.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   3e-69    
ref|XP_003468355.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   3e-69    
ref|XP_008914900.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    233   3e-69    
ref|XP_004656824.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   4e-69    
gb|EPY87516.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1-li...    233   4e-69    
gb|ELR50720.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    232   4e-69    
ref|XP_003468354.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   4e-69    
emb|CCA21752.1|  ubiquinone oxidoreductase putative                     233   4e-69    
gb|EYB94292.1|  hypothetical protein Y032_0173g404                      232   4e-69    
gb|EIE91504.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1          232   4e-69    
ref|XP_002115153.1|  conserved hypothetical protein                     231   4e-69    
gb|EPB78713.1|  NADH oxidoreductase, F subunit                          233   5e-69    
ref|XP_010819350.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   5e-69    
gb|KGB32486.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    232   6e-69    
ref|XP_011424780.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    231   6e-69    
ref|XP_005903647.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   6e-69    
ref|XP_011706846.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   6e-69    
gb|ETO35987.1|  hypothetical protein RFI_01076                          234   6e-69    
gb|AAA30661.1|  NADH dehydrogenase                                      232   6e-69    
emb|CCI46686.1|  unnamed protein product                                233   6e-69    
emb|CAX70517.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1         230   7e-69    
gb|EIE75829.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1          231   8e-69    
ref|XP_002904800.1|  NADH dehydrogenase flavoprotein 1, mitochond...    232   1e-68    
ref|XP_009520780.1|  hypothetical protein PHYSODRAFT_350142             231   1e-68    
emb|CDS13291.1|  Putative NADH-ubiquinone oxidoreductase 51 kDasu...    230   2e-68    
emb|CAX75358.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1         231   2e-68    
emb|CAX75357.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1         231   2e-68    
gb|AAW25108.1|  SJCHGC01665 protein                                     230   2e-68    
gb|KDO19863.1|  hypothetical protein SPRG_14893                         231   3e-68    
ref|XP_008873255.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    231   3e-68    
ref|XP_001746110.1|  hypothetical protein                               229   4e-68    
ref|XP_002608782.1|  hypothetical protein BRAFLDRAFT_273832             230   4e-68    
ref|XP_008543074.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    229   4e-68    
ref|XP_005097475.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    229   4e-68    
ref|XP_319184.4|  AGAP010039-PA                                         229   5e-68    
ref|XP_008211165.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    227   6e-68    
gb|KIH53381.1|  putative NADH oxidoreductase, F subunit                 231   7e-68    
emb|CDH52430.1|  nadh dehydrogenase                                     229   8e-68    
ref|XP_001637535.1|  predicted protein                                  229   9e-68    
gb|ABF18316.1|  mitochondrial NADH:ubiquinone oxidoreductase NDUF...    229   9e-68    
ref|XP_008611499.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1     229   9e-68    
gb|KFB35861.1|  hypothetical protein ZHAS_00002799                      236   1e-67    
ref|XP_002131638.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    228   1e-67    
ref|XP_001658587.1|  AAEL007681-PA                                      229   1e-67    
ref|XP_010739964.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    228   1e-67    
gb|AAU14244.1|  hydrogenosomal NADH dehydrogenase 51 kDa subunit        228   1e-67    
ref|XP_009837746.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    229   1e-67    
ref|XP_009173178.1|  hypothetical protein T265_08967                    231   2e-67    
ref|XP_011568243.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    228   2e-67    
gb|ELT92397.1|  hypothetical protein CAPTEDRAFT_225471                  227   2e-67    
gb|EJK59572.1|  hypothetical protein THAOC_20181                        228   2e-67    
emb|CDS08258.1|  Putative NADH dehydrogenase                            228   3e-67    
ref|XP_004531680.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    228   3e-67    
ref|XP_002162472.2|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    227   3e-67    
ref|XP_003691837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    227   3e-67    
gb|EFX78613.1|  hypothetical protein DAPPUDRAFT_53209                   226   3e-67    
ref|XP_011308020.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    227   3e-67    
ref|NP_001165788.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    227   4e-67    
ref|XP_391916.2|  PREDICTED: NADH dehydrogenase [ubiquinone] flav...    227   4e-67    
gb|KHN76766.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    233   4e-67    
ref|XP_008329578.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    227   4e-67    
ref|XP_006614078.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    227   4e-67    
ref|XP_010883102.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   5e-67    
gb|ACO12806.1|  NADH dehydrogenase flavoprotein 1, mitochondrial ...    226   5e-67    
ref|XP_005796523.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    227   5e-67    
ref|WP_018301185.1|  NADH dehydrogenase                                 226   5e-67    
gb|KFM58892.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    220   5e-67    
ref|XP_005140501.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   6e-67    
ref|XP_005796524.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   6e-67    
ref|XP_011194045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   6e-67    
ref|XP_006010402.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   7e-67    
ref|XP_011505585.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   8e-67    
ref|XP_006641742.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    219   8e-67    
ref|WP_021097547.1|  NADH dehydrogenase subunit F                       225   8e-67    
ref|WP_029639590.1|  NADH dehydrogenase                                 225   8e-67    
ref|XP_008550105.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   9e-67    
ref|XP_003707795.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   9e-67    
gb|EHJ68778.1|  NADH dehydrogenase flavoprotein 1 ubiquinone            226   1e-66    
ref|XP_002014219.1|  GL19080                                            226   1e-66    
ref|XP_008420425.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   1e-66    
ref|XP_001357188.1|  GA21571                                            226   1e-66    
ref|XP_011685095.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   1e-66    
ref|XP_008420426.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   1e-66    
ref|XP_003969349.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   1e-66    
ref|XP_003215041.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   1e-66    
ref|WP_043143607.1|  NADH dehydrogenase                                 224   1e-66    
ref|XP_007565012.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    226   1e-66    
ref|XP_003398732.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   1e-66    
ref|WP_007205178.1|  NADH dehydrogenase                                 224   2e-66    
ref|XP_003486092.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   2e-66    
ref|XP_011685096.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   2e-66    
ref|XP_012059027.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   2e-66    
emb|CAG05422.1|  unnamed protein product                                216   2e-66    
ref|XP_002430129.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    225   2e-66    
ref|XP_005046765.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   2e-66    
ref|XP_005529102.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    224   2e-66    
ref|XP_011055216.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   2e-66    
ref|WP_019964675.1|  NADH dehydrogenase                                 224   2e-66    
gb|EKC98180.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit           226   3e-66    
ref|WP_026380108.1|  NADH dehydrogenase                                 224   3e-66    
ref|XP_002435466.1|  NADH:ubiquinone oxidoreductase, NDUFV1/51kDa...    225   3e-66    
ref|XP_005243468.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    224   3e-66    
ref|XP_010883100.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   4e-66    
ref|XP_010731123.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    224   4e-66    
ref|WP_021693264.1|  NADH-ubiquinone oxidoreductase chain F             223   4e-66    
gb|EJY76658.1|  NADH-quinone oxidoreductase, F subunit family pro...    230   4e-66    
ref|WP_020038706.1|  NADH dehydrogenase                                 223   4e-66    
ref|WP_037080528.1|  NADH dehydrogenase                                 223   4e-66    
gb|KKA67363.1|  nuo-1                                                   225   4e-66    
gb|AAU14243.1|  hydrogenosomal NADH dehydrogenase 51 kDa subunit        224   5e-66    
ref|WP_038541986.1|  NADH dehydrogenase                                 223   5e-66    
ref|XP_002293580.1|  hypothetical protein THAPSDRAFT_29850              225   5e-66    
ref|XP_010790716.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    224   6e-66    
ref|NP_001032653.1|  uncharacterized protein LOC641566                  224   6e-66    
ref|XP_010562605.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    224   6e-66    
ref|WP_008836443.1|  NADH dehydrogenase I subunit F                     215   6e-66    
ref|XP_011163399.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    224   6e-66    
ref|WP_037281194.1|  NADH dehydrogenase                                 223   7e-66    
emb|CEP08398.1|  hypothetical protein                                   224   7e-66    
ref|XP_011150216.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    224   7e-66    
ref|XP_011595767.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    223   7e-66    
ref|WP_037150193.1|  NADH dehydrogenase                                 223   8e-66    
ref|XP_010773860.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    224   8e-66    
ref|XP_006276947.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    223   9e-66    
gb|EPB92081.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    224   9e-66    
emb|CDS26336.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1         223   9e-66    
ref|WP_015915653.1|  NADH dehydrogenase                                 223   1e-65    
ref|XP_003977673.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    223   1e-65    
gb|AAU14240.1|  hydrogenosomal NADH dehydrogenase 51 kDa subunit        223   1e-65    
ref|WP_045444035.1|  NADH dehydrogenase                                 222   1e-65    
ref|WP_007754583.1|  NADH dehydrogenase                                 222   1e-65    
ref|WP_027486180.1|  NADH dehydrogenase                                 222   1e-65    
ref|NP_001026754.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    223   1e-65    
ref|XP_007550020.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    223   1e-65    
ref|WP_013652816.1|  NADH dehydrogenase                                 222   1e-65    
ref|WP_006934713.1|  NADH dehydrogenase                                 222   1e-65    
ref|WP_043749431.1|  NADH dehydrogenase                                 222   1e-65    
ref|XP_004342489.2|  NADH:ubiquinone oxidoreductase NDUFV1              223   1e-65    
ref|WP_019955761.1|  NADH dehydrogenase                                 222   1e-65    
ref|XP_011870822.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    223   1e-65    
ref|WP_022998431.1|  MULTISPECIES: NADH dehydrogenase                   222   1e-65    
ref|XP_011330910.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    223   1e-65    
ref|WP_009804309.1|  NADH dehydrogenase                                 222   2e-65    
ref|XP_006788169.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    222   2e-65    
ref|WP_037389048.1|  NADH dehydrogenase                                 222   2e-65    
ref|XP_010709117.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    222   2e-65    
emb|CBJ48598.1|  NUOF homolog, NADH dehydrogenase (ubiquinone) su...    224   2e-65    
ref|XP_011640600.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    223   2e-65    
ref|WP_037433381.1|  NADH dehydrogenase                                 222   2e-65    
ref|WP_042709215.1|  NADH dehydrogenase                                 218   2e-65    
ref|XP_009898255.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    222   2e-65    
ref|WP_028480891.1|  NADH dehydrogenase                                 221   2e-65    
ref|WP_037121874.1|  NADH dehydrogenase                                 221   2e-65    
ref|WP_024811833.1|  NADH dehydrogenase                                 221   2e-65    
ref|WP_037271622.1|  NADH dehydrogenase                                 221   3e-65    
ref|WP_008280993.1|  NADH dehydrogenase                                 221   3e-65    
ref|WP_018208670.1|  NADH dehydrogenase                                 221   3e-65    
emb|CDS22456.1|  NADH dehydrogenase ubiquinone flavoprotein 1           222   3e-65    
ref|WP_011975087.1|  MULTISPECIES: NADH dehydrogenase                   221   3e-65    
emb|CDI99272.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1         222   3e-65    
ref|WP_043626148.1|  NADH dehydrogenase                                 221   3e-65    
gb|EFN65028.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    222   3e-65    
ref|WP_024311652.1|  NADH dehydrogenase                                 221   3e-65    
ref|WP_018239396.1|  NADH dehydrogenase                                 221   3e-65    
emb|CDH54053.1|  nadh dehydrogenase                                     232   3e-65    
dbj|GAN02266.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, m...    222   3e-65    
ref|WP_014327990.1|  NADH dehydrogenase                                 221   3e-65    
ref|XP_003745829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    222   4e-65    
ref|WP_037153541.1|  NADH dehydrogenase                                 221   4e-65    
ref|XP_004549159.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    222   4e-65    
ref|XP_003746033.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    222   4e-65    
ref|WP_008235391.1|  NADH dehydrogenase                                 221   4e-65    
ref|WP_005984043.1|  NADH dehydrogenase                                 221   4e-65    
ref|XP_011261248.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    222   4e-65    
ref|XP_003452502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    222   4e-65    
ref|WP_011048476.1|  NADH dehydrogenase                                 221   4e-65    
ref|WP_009818951.1|  NADH dehydrogenase                                 221   4e-65    
ref|WP_025045083.1|  NADH dehydrogenase                                 221   4e-65    
ref|WP_029063401.1|  NADH dehydrogenase                                 221   4e-65    
ref|WP_045685729.1|  NADH dehydrogenase                                 221   4e-65    
ref|WP_037243881.1|  NADH dehydrogenase                                 221   4e-65    
ref|WP_017927382.1|  NADH dehydrogenase                                 221   4e-65    
ref|WP_034854091.1|  NADH dehydrogenase                                 221   4e-65    
ref|WP_038367709.1|  NADH dehydrogenase                                 221   5e-65    
ref|XP_009012163.1|  hypothetical protein HELRODRAFT_104983             220   5e-65    
gb|EFO33618.1|  NADH-quinone oxidoreductase subunit f 1                 217   5e-65    
ref|WP_034803581.1|  NADH dehydrogenase                                 221   5e-65    
ref|XP_001435452.1|  hypothetical protein                               221   5e-65    
ref|WP_037212602.1|  NADH dehydrogenase                                 220   5e-65    
ref|WP_026612514.1|  NADH dehydrogenase                                 220   6e-65    
ref|XP_004073740.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    221   6e-65    
ref|XP_008429845.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    221   6e-65    
ref|WP_037107756.1|  NADH dehydrogenase                                 220   6e-65    
ref|XP_001455133.1|  hypothetical protein                               221   7e-65    
ref|WP_008327918.1|  NADH dehydrogenase                                 220   7e-65    
ref|WP_044049696.1|  NADH dehydrogenase                                 220   7e-65    
ref|WP_025426586.1|  NADH dehydrogenase                                 220   7e-65    
ref|WP_037165288.1|  MULTISPECIES: NADH dehydrogenase                   220   7e-65    
ref|WP_029618597.1|  NADH dehydrogenase                                 220   8e-65    
ref|WP_028754009.1|  NADH dehydrogenase                                 220   9e-65    
ref|WP_018325969.1|  NADH dehydrogenase                                 220   9e-65    
ref|WP_026619312.1|  NADH dehydrogenase                                 220   9e-65    
ref|WP_036636757.1|  NADH dehydrogenase                                 220   9e-65    
ref|WP_037169323.1|  NADH dehydrogenase                                 220   9e-65    
ref|WP_009814874.1|  NADH dehydrogenase                                 220   1e-64    
ref|WP_008546776.1|  MULTISPECIES: NADH dehydrogenase                   220   1e-64    
ref|XP_006677383.1|  hypothetical protein BATDEDRAFT_31463              221   1e-64    
ref|WP_037063422.1|  NADH dehydrogenase                                 220   1e-64    



>ref|XP_011086756.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=487

 Score =   355 bits (912),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQRTALV+R  + WGL+ R +S+QAA++ +TPQ+PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRTALVRRSRENWGLSSRLFSSQAATSPSTPQAPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEIKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  121  KWSFMPKASDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLEKAR+
Sbjct  181  IRGEYVNERKNLEKARR  197



>ref|XP_009615859.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=487

 Score =   355 bits (912),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KGLLSLQRTALVQR S++WGL GR +S QAASTA+TPQ  PPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGLLSLQRTALVQRSSERWGLYGRLFSTQAASTASTPQPTPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPKT+DGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  121  KWSFMPKTTDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERK+LEKARK
Sbjct  181  IRGEYVNERKSLEKARK  197



>ref|XP_009785204.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nicotiana sylvestris]
Length=487

 Score =   354 bits (909),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KGLLSLQRTALVQR S++WGL GR ++ QAASTA+TPQ  PPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGLLSLQRTALVQRSSERWGLYGRLFNTQAASTASTPQPTPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPKT+DGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  121  KWSFMPKTTDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERK+LEKARK
Sbjct  181  IRGEYVNERKSLEKARK  197



>ref|XP_011086755.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=488

 Score =   353 bits (906),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDE  390
            AP+KG+LSLQRTALV+R  + WGL+ R +S+QAA++ +TPQ+PPPPPPPEKTHFGGLKDE
Sbjct  3    APIKGILSLQRTALVRRSRENWGLSSRLFSSQAATSPSTPQAPPPPPPPEKTHFGGLKDE  62

Query  391  DRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLK  570
            DRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGLK
Sbjct  63   DRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEIKKSGLRGRGGAGFPSGLK  122

Query  571  WSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYI  750
            WSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIYI
Sbjct  123  WSFMPKASDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIYI  182

Query  751  RGEYVNERKNLEKARK  798
            RGEYVNERKNLEKAR+
Sbjct  183  RGEYVNERKNLEKARR  198



>ref|NP_001275120.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Solanum tuberosum]
 emb|CAA58823.1| NADH dehydrogenase [Solanum tuberosum]
Length=487

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KGLLSLQRTAL QR S++WGL GR +S QAASTA+TPQ  PPPPPPE+THFGGLKD
Sbjct  1    MAPIKGLLSLQRTALAQRSSERWGLYGRLFSTQAASTASTPQPTPPPPPPERTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLV+KG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVIKGSDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPKT+DGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  121  KWSFMPKTTDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAKAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERK+L+KAR+
Sbjct  181  IRGEYVNERKSLQKARQ  197



>gb|KJB50332.1| hypothetical protein B456_008G164400 [Gossypium raimondii]
Length=486

 Score =   348 bits (893),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL++ C ++W L  R +S Q A+TA+ PQ+PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALLRACGERWKLGTRSFSTQGATTADAPQAPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLE+ARK
Sbjct  181  IRGEYVNERKNLERARK  197



>gb|KJB50333.1| hypothetical protein B456_008G164400 [Gossypium raimondii]
Length=493

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDE  390
            AP+KG+LSLQR AL++ C ++W L  R +S Q A+TA+ PQ+PPPPPPPEKTHFGGLKDE
Sbjct  9    APIKGILSLQRAALLRACGERWKLGTRSFSTQGATTADAPQAPPPPPPPEKTHFGGLKDE  68

Query  391  DRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLK  570
            DRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGLK
Sbjct  69   DRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGLK  128

Query  571  WSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYI  750
            WSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYI
Sbjct  129  WSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYI  188

Query  751  RGEYVNERKNLEKARK  798
            RGEYVNERKNLE+ARK
Sbjct  189  RGEYVNERKNLERARK  204



>ref|XP_009770074.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nicotiana sylvestris]
 ref|XP_009770075.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nicotiana sylvestris]
Length=486

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQRTALV R S++WGL GR +S QAASTA+    P PP PPEKTHFG LKD
Sbjct  1    MAPIKGILSLQRTALVLRSSERWGLYGRLFSTQAASTASN-PQPTPPAPPEKTHFGDLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  60   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGL  119

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPKT+DGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  120  KWSFMPKTTDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIY  179

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERK+LEKARK
Sbjct  180  IRGEYVNERKSLEKARK  196



>ref|XP_009609277.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nicotiana tomentosiformis]
 ref|XP_009609278.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nicotiana tomentosiformis]
Length=487

 Score =   345 bits (886),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQRTALV R S++ GL GR +S QAASTA+TPQ  PPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRTALVLRSSERLGLYGRLFSTQAASTASTPQPTPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDP+LK A+KRGDWYRTKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPYLKDAMKRGDWYRTKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPKT+DGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  121  KWSFMPKTTDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERK+LEKARK
Sbjct  181  IRGEYVNERKSLEKARK  197



>ref|XP_004232268.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Solanum lycopersicum]
Length=487

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KGLLSLQRTAL QR S++WG  GR +S QAASTA+TPQ  PPPPPPE+THFGGLKD
Sbjct  1    MAPIKGLLSLQRTALAQRSSERWGQYGRLFSTQAASTASTPQPTPPPPPPERTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLV+KG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVIKGSDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPKT+DGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  121  KWSFMPKTTDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER +L+KAR+
Sbjct  181  IRGEYVNERLSLQKARQ  197



>ref|XP_010644983.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Vitis vinifera]
Length=511

 Score =   345 bits (884),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  196  LSPAMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFG  375
            ++  MAP++G+L+LQR ALV R S+KWG   R +S QAA+TA+  Q PPPPPPPEKTHFG
Sbjct  21   ITSQMAPIRGILTLQRMALVSRQSKKWGPGCRAFSTQAATTASASQPPPPPPPPEKTHFG  80

Query  376  GLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGF  555
            GLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTKD+VLKG+DWIVNE+KKSGLRGRGGAGF
Sbjct  81   GLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKSGLRGRGGAGF  140

Query  556  PSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQA  735
            PSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  
Sbjct  141  PSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATT  200

Query  736  AYIYIRGEYVNERKNLEKARK  798
            AYIYIRGEYVNERKNLE+ARK
Sbjct  201  AYIYIRGEYVNERKNLERARK  221



>ref|XP_002266661.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Vitis vinifera]
Length=487

 Score =   343 bits (880),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+L+LQR ALV R S+KWG   R +S QAA+TA+  Q PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGILTLQRMALVSRQSKKWGPGCRAFSTQAATTASASQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKD+VLKG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  AYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATTAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLE+ARK
Sbjct  181  IRGEYVNERKNLERARK  197



>gb|KJB08870.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
 gb|KJB08871.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
 gb|KJB08872.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
 gb|KJB08873.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
Length=486

 Score =   343 bits (880),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR A+ +  S++W L  R +S Q A+TA  PQ+PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAAMFRASSERWKLGIRSFSTQGATTAGAPQAPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLE+ARK
Sbjct  181  IRGEYVNERKNLERARK  197



>emb|CAN73193.1| hypothetical protein VITISV_022287 [Vitis vinifera]
Length=489

 Score =   341 bits (875),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDE  390
            AP++G+L+LQR ALV R S+KWG   R +S QAA+TA+  Q PPPPPPPEKTHFGGLKDE
Sbjct  4    APIRGILTLQRMALVSRQSKKWGPGCRAFSTQAATTASASQPPPPPPPPEKTHFGGLKDE  63

Query  391  DRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLK  570
            DRIFTN+YGLHDPFLKGA+KRGDWYRTKD+VLKG+DWIVNE+KKSGLRGRGGAGFPSGLK
Sbjct  64   DRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKSGLRGRGGAGFPSGLK  123

Query  571  WSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYI  750
            WSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  AYIYI
Sbjct  124  WSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATTAYIYI  183

Query  751  RGEYVNERKNLEKARK  798
            RGEYVNERKNLE+ARK
Sbjct  184  RGEYVNERKNLERARK  199



>ref|XP_004310055.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=486

 Score =   338 bits (866),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR  L +    KWGL  R  S QAASTA TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAVLARHHGAKWGLGYRLLSTQAASTATTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER +LEKARK
Sbjct  181  IRGEYVNERLSLEKARK  197



>ref|XP_011041538.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Populus euphratica]
 ref|XP_011016388.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Populus euphratica]
Length=485

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 184/197 (93%), Gaps = 1/197 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+ SLQRTALV++ S++ G+  R +S QA + A  PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGIFSLQRTALVRQ-SERLGVGFRSFSTQAPTNAGAPQPPPPPPPPEKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTNVYGLHDPFLKGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL
Sbjct  60   EDRIFTNVYGLHDPFLKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  119

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  120  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  179

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLE+ARK
Sbjct  180  IRGEYVNERKNLERARK  196



>emb|CDP13320.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 184/197 (93%), Gaps = 1/197 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LS QR +LV++ S+ W L  R +S QAASTA+TPQ PPPPPPPEKTHFGGLKD
Sbjct  20   MAPIKGILSSQRISLVKQ-SEHWVLGSRLFSTQAASTASTPQPPPPPPPPEKTHFGGLKD  78

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTNVYGLHDPFLKGA+KRGDW+RTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  79   EDRIFTNVYGLHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGL  138

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  139  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIY  198

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLEKAR+
Sbjct  199  IRGEYVNERKNLEKARR  215



>ref|XP_010248930.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nelumbo nucifera]
 ref|XP_010248931.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nelumbo nucifera]
Length=487

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP K +LSL R ALV+R S+KW    R +S Q A+T++TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPFKSILSLPRVALVRRSSEKWDSICRSFSTQFATTSSTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLEKARK
Sbjct  181  IRGEYVNERKNLEKARK  197



>ref|XP_008222059.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Prunus mume]
Length=486

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSL R AL +   +KWGL  R +S Q A+TANTPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLPRAALARHHGEKWGLGLRSFSTQGATTANTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKD+V+KG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDIVIKGADWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKARK
Sbjct  181  IRGEYVNERINLEKARK  197



>ref|XP_007045030.1| 51 kDa subunit of complex I [Theobroma cacao]
 gb|EOY00862.1| 51 kDa subunit of complex I [Theobroma cacao]
Length=486

 Score =   335 bits (860),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL +  S++WGL  R +S Q A+T   PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALFRNSSERWGLGIRSFSTQGATTTGAPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA KRGDW+RTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAQKRGDWHRTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLE+ARK
Sbjct  181  IRGEYVNERKNLERARK  197



>ref|XP_002315622.1| hypothetical protein POPTR_0010s06750g [Populus trichocarpa]
 gb|EEF01793.1| hypothetical protein POPTR_0010s06750g [Populus trichocarpa]
Length=485

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 183/197 (93%), Gaps = 1/197 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+ SLQRTALV++ S++ G+  R +S QA + A  PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGIFSLQRTALVRQ-SERLGVGFRSFSTQAPTNAGAPQPPPPPPPPEKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTNVYGLHDPFLKGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL
Sbjct  60   EDRIFTNVYGLHDPFLKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  119

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  120  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  179

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLE+ARK
Sbjct  180  IRGEYVNERINLERARK  196



>ref|XP_011071205.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Sesamum indicum]
Length=486

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+LSLQRTAL+QR ++ W    R ++  AA+T+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGILSLQRTALIQRSAENWSQARRLFNT-AATTSTTPQPPPPPPPPEKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTNVYGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  60   EDRIFTNVYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEIKKSGLRGRGGAGFPSGL  119

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  120  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIY  179

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLEKAR+
Sbjct  180  IRGEYVNERKNLEKARR  196



>ref|XP_012085644.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Jatropha curcas]
 gb|KDP26775.1| hypothetical protein JCGZ_17933 [Jatropha curcas]
Length=486

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+LSLQR A+++R S +  +  R  S QAA+ A +PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGILSLQRAAMIRRHSDRLDIGFRSLSTQAATNAGSPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER+NLE+ARK
Sbjct  181  IRGEYVNERRNLERARK  197



>ref|XP_010547695.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Tarenaya hassleriana]
Length=486

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L+LQR A   + S ++    R +SAQAA+T+NTPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILALQRAASTWKQSNRFCPVVRSFSAQAATTSNTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLEKARK
Sbjct  181  IRGEYVNERKNLEKARK  197



>gb|EYU42106.1| hypothetical protein MIMGU_mgv1a005364mg [Erythranthe guttata]
Length=487

 Score =   333 bits (855),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+K +LSL+RTA  QR  + WGL  + +S QAA+T+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKSILSLRRTAYAQRSGENWGLARKLFSTQAATTSPTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTNVYGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNVYGLHDPFLKGAMKRGDWHRTKDLVIKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKARK
Sbjct  181  IRGEYVNERLNLEKARK  197



>ref|XP_010682836.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=495

 Score =   333 bits (854),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLN-GRFYSAQAASTANTPQSpppppppEKTHFGGLK  384
            MAP++G+L LQR   +QR  + WG    R +S QAAST+NTPQ PPPPPPPEKTHFGGLK
Sbjct  1    MAPLRGILKLQRIGQLQRHYETWGAGYSRLFSTQAASTSNTPQPPPPPPPPEKTHFGGLK  60

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSG  564
            DEDRIFTN+YG+HDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSG
Sbjct  61   DEDRIFTNLYGIHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSG  120

Query  565  LKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYI  744
            LKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYI
Sbjct  121  LKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYI  180

Query  745  YIRGEYVNERKNLEKARK  798
            YIRGEYVNER NLEKARK
Sbjct  181  YIRGEYVNERLNLEKARK  198



>ref|XP_006484064.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Citrus sinensis]
 gb|KDO81963.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
 gb|KDO81964.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
 gb|KDO81965.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
 gb|KDO81966.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
Length=486

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR +LV+  S++  +  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPMKGVLSLQRASLVRCYSERLSVGLRSFSTQGASTASTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YG+HDPFLKGA+KRGDW+RTKDLVLKG DWIVNEVKKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGMHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEVKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLE+AR+
Sbjct  181  IRGEYVNERKNLERARQ  197



>ref|XP_004497858.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=492

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  196  LSPAMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFG  375
            L P    ++G+LSL+R  LV++ S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFG
Sbjct  3    LLPGRITMRGILSLKRAVLVRQQSEKVGLGCRLFSTQGASTASTPQPPPPPPPPEKTHFG  62

Query  376  GLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGF  555
            GLKDEDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKSGLRGRGGAGF
Sbjct  63   GLKDEDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVVKGTDWIVNEMKKSGLRGRGGAGF  122

Query  556  PSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQA  735
            PSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA A
Sbjct  123  PSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATA  182

Query  736  AYIYIRGEYVNERKNLEKARK  798
            AYIYIRGEYVNER NLEKARK
Sbjct  183  AYIYIRGEYVNERLNLEKARK  203



>ref|XP_008360129.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Malus domestica]
Length=486

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL +    KWGL  R +S Q A+ + TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALARHHGAKWGLGFRSFSTQGAAPSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKAR  795
            IRGEYVNER NL KAR
Sbjct  181  IRGEYVNERLNLVKAR  196



>ref|XP_002514955.1| NADH-ubiquinone oxidoreductase flavoprotein, putative [Ricinus 
communis]
 gb|EEF47509.1| NADH-ubiquinone oxidoreductase flavoprotein, putative [Ricinus 
communis]
Length=486

 Score =   330 bits (847),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+ +LQR AL++R S +  +  R +S +A  +A + Q  PPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGIFNLQRAALIRRQSDRLAVGIRSFSTEATKSAGSSQPLPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNEVKKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEVKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLE+ARK
Sbjct  181  IRGEYVNERINLERARK  197



>gb|AES60212.2| NADH-ubiquinone oxidoreductase 51 kDa subunit [Medicago truncatula]
Length=483

 Score =   330 bits (845),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++G+LSL+R  LV++ S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MRGILSLKRAVLVRQHSEKLGLGVRLFSTQGASTASTPQPPPPPPPPEKTHFGGLKDEDR  60

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWS  576
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKSGLRGRGGAGFPSGLKWS
Sbjct  61   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVIKGTDWIVNEMKKSGLRGRGGAGFPSGLKWS  120

Query  577  FMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRG  756
            FMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRG
Sbjct  121  FMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRG  180

Query  757  EYVNERKNLEKARK  798
            EYVNER NLEKARK
Sbjct  181  EYVNERLNLEKARK  194



>ref|XP_004497859.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=483

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++G+LSL+R  LV++ S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MRGILSLKRAVLVRQQSEKVGLGCRLFSTQGASTASTPQPPPPPPPPEKTHFGGLKDEDR  60

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWS  576
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKSGLRGRGGAGFPSGLKWS
Sbjct  61   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVVKGTDWIVNEMKKSGLRGRGGAGFPSGLKWS  120

Query  577  FMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRG  756
            FMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRG
Sbjct  121  FMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRG  180

Query  757  EYVNERKNLEKARK  798
            EYVNER NLEKARK
Sbjct  181  EYVNERLNLEKARK  194



>ref|XP_003535239.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform 1 [Glycine max]
 gb|KHN10057.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Glycine soja]
Length=482

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++G+LS+ RTALVQ  S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MRGILSV-RTALVQHHSEKLGLGFRVFSTQGASTASTPQPPPPPPPPEKTHFGGLKDEDR  59

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWS  576
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKSGLRGRGGAGFPSGLKWS
Sbjct  60   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVVKGTDWIVNEMKKSGLRGRGGAGFPSGLKWS  119

Query  577  FMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRG  756
            FMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRG
Sbjct  120  FMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRG  179

Query  757  EYVNERKNLEKARK  798
            EYVNERKNLEKAR+
Sbjct  180  EYVNERKNLEKARE  193



>ref|XP_008340188.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
flavoprotein 1, mitochondrial-like isoform X2 [Malus domestica]
Length=502

 Score =   329 bits (843),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 175/196 (89%), Gaps = 1/196 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL +    KWGL  R +S Q A+ + T Q PPPPPP EKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALARHHGXKWGLAFRSFSTQGAAPSTTAQPPPPPPP-EKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  60   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGL  119

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  120  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  179

Query  748  IRGEYVNERKNLEKAR  795
            IRGEYVNER NL KAR
Sbjct  180  IRGEYVNERLNLVKAR  195



>ref|XP_006574505.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Glycine max]
 gb|KHN00283.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Glycine soja]
Length=482

 Score =   328 bits (841),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++G+LS+ RTALVQ  S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MRGILSV-RTALVQHRSEKLGLGFRLFSTQGASTASTPQPPPPPPPPEKTHFGGLKDEDR  59

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWS  576
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIV+E+KKSGLRGRGGAGFPSGLKWS
Sbjct  60   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVSEMKKSGLRGRGGAGFPSGLKWS  119

Query  577  FMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRG  756
            FMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRG
Sbjct  120  FMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRG  179

Query  757  EYVNERKNLEKARK  798
            EYVNERKNLEKAR+
Sbjct  180  EYVNERKNLEKARQ  193



>ref|XP_008340187.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
flavoprotein 1, mitochondrial-like isoform X1 [Malus domestica]
Length=510

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 175/196 (89%), Gaps = 1/196 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL +    KWGL  R +S Q A+ + T Q PPPPPP EKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALARHHGXKWGLAFRSFSTQGAAPSTTAQPPPPPPP-EKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  60   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGL  119

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  120  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  179

Query  748  IRGEYVNERKNLEKAR  795
            IRGEYVNER NL KAR
Sbjct  180  IRGEYVNERLNLVKAR  195



>ref|XP_009372324.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Pyrus x bretschneideri]
Length=487

 Score =   327 bits (839),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 175/197 (89%), Gaps = 1/197 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSppppppp-EKTHFGGLK  384
            MAP+KG+LSLQR AL      KWGL  R +S Q A+ + T Q PPPPPPP EKTHFGGLK
Sbjct  1    MAPLKGILSLQRAALACHHGAKWGLAFRSFSTQGAAPSTTAQPPPPPPPPPEKTHFGGLK  60

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSG  564
            DEDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSG
Sbjct  61   DEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSG  120

Query  565  LKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYI  744
            LKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYI
Sbjct  121  LKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYI  180

Query  745  YIRGEYVNERKNLEKAR  795
            YIRGEYVNER NL KAR
Sbjct  181  YIRGEYVNERLNLVKAR  197



>ref|XP_003589961.1| NADH-quinone oxidoreductase subunit F [Medicago truncatula]
Length=568

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  196  LSPAMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFG  375
            +S +   ++G+LSL+R  LV++ S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFG
Sbjct  1    MSISWITMRGILSLKRAVLVRQHSEKLGLGVRLFSTQGASTASTPQPPPPPPPPEKTHFG  60

Query  376  GLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGF  555
            GLKDEDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKSGLRGRGGAGF
Sbjct  61   GLKDEDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVIKGTDWIVNEMKKSGLRGRGGAGF  120

Query  556  PSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQA  735
            PSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA A
Sbjct  121  PSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATA  180

Query  736  AYIYIRGEYVNERKNLEKARK  798
            AYIYIRGEYVNER NLEKARK
Sbjct  181  AYIYIRGEYVNERLNLEKARK  201



>ref|XP_007145867.1| hypothetical protein PHAVU_007G274700g [Phaseolus vulgaris]
 gb|ESW17861.1| hypothetical protein PHAVU_007G274700g [Phaseolus vulgaris]
Length=482

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +1

Query  238  QRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYG  417
            QRTALVQ  S+K GL  R +S Q ASTA +PQ PPPPPPPEKTHFGGLKDEDRIFTN+YG
Sbjct  7    QRTALVQHRSEKLGLGLRLFSTQGASTATSPQPPPPPPPPEKTHFGGLKDEDRIFTNLYG  66

Query  418  LHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSD  597
            LHDPFLKGA+KRGDWYRTKDLV+KGTDWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SD
Sbjct  67   LHDPFLKGAMKRGDWYRTKDLVIKGTDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSD  126

Query  598  GRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERK  777
            GRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNERK
Sbjct  127  GRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYVNERK  186

Query  778  NLEKAR  795
            NLE AR
Sbjct  187  NLETAR  192



>ref|XP_008443176.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cucumis melo]
 ref|XP_008443177.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cucumis melo]
Length=486

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP +G+L LQ   L +R   +WG+  R +S+Q A+   +PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPFRGMLYLQHRTLARRYIDQWGIGLRAFSSQGAAAPGSPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKG DWIVNEVKKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEVKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLEKARK
Sbjct  181  IRGEYVNERKNLEKARK  197



>gb|EPS65614.1| hypothetical protein M569_09162 [Genlisea aurea]
Length=512

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 191/228 (84%), Gaps = 10/228 (4%)
 Frame = +1

Query  121  IQSLGSQFLTSRPSHQRSVALRLRYLSPA--MAPVKGLLSLQRTALVQRCSQKWGLNGRF  294
            + ++GS   T R    R V   +    P   MAP+KG++SLQR ALV+    ++ +  RF
Sbjct  3    LSAVGS-ISTPRAIACRGVCSVIDVAKPVDPMAPIKGIVSLQRAALVR---NRY-IASRF  57

Query  295  YSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTK  474
            +SAQAA+    P +  PPPPPE+THFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTK
Sbjct  58   FSAQAATD---PANQQPPPPPERTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTK  114

Query  475  DLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCK  654
            DL+LKGTDWIVNE+KKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCK
Sbjct  115  DLILKGTDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCK  174

Query  655  DREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            DREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNERKNLE AR+
Sbjct  175  DREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERKNLEIARR  222



>ref|XP_009122464.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Brassica rapa]
Length=486

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   V + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSVWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKAR+
Sbjct  181  IRGEYVNERLNLEKARR  197



>ref|XP_010546277.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=487

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L+LQR     +   ++    R +SAQ+A+T++TPQ PPPPPPPEKTHFGGL D
Sbjct  1    MAPVRGILALQRAVSNLKQCNRFCPALRSFSAQSATTSSTPQPPPPPPPPEKTHFGGLTD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRARAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLEKARK
Sbjct  181  IRGEYVNERKNLEKARK  197



>ref|XP_006399353.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
 gb|ESQ40806.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
Length=486

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSIWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKAR+
Sbjct  181  IRGEYVNERLNLEKARR  197



>ref|NP_196470.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Arabidopsis thaliana]
 sp|Q9FNN5.1|NDUV1_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10002.1| NADH dehydrogenase [Arabidopsis thaliana]
 gb|AAM12970.1| NADH dehydrogenase [Arabidopsis thaliana]
 gb|AAP31964.1| At5g08530 [Arabidopsis thaliana]
 gb|AED91315.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Arabidopsis thaliana]
Length=486

 Score =   325 bits (833),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSIWKESNRLTPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKAR+
Sbjct  181  IRGEYVNERLNLEKARR  197



>gb|AAM65274.1| NADH dehydrogenase [Arabidopsis thaliana]
Length=486

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSIWKESNRLTPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKAR+
Sbjct  181  IRGEYVNERLNLEKARR  197



>ref|XP_010452860.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Camelina sativa]
Length=486

 Score =   325 bits (832),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSLWKDSNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKAR+
Sbjct  181  IRGEYVNERLNLEKARR  197



>ref|XP_010423066.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Camelina sativa]
Length=486

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSLWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKAR+
Sbjct  181  IRGEYVNERLNLEKARR  197



>ref|XP_010459420.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Camelina sativa]
Length=486

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSLWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKAR+
Sbjct  181  IRGEYVNERLNLEKARR  197



>ref|XP_006287433.1| hypothetical protein CARUB_v10000637mg, partial [Capsella rubella]
 gb|EOA20331.1| hypothetical protein CARUB_v10000637mg, partial [Capsella rubella]
Length=546

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +1

Query  205  AMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLK  384
            +MAPV+G+L LQR   V + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLK
Sbjct  60   SMAPVRGILGLQRAVSVWKESNRLTPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLK  119

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSG  564
            DEDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSG
Sbjct  120  DEDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSG  179

Query  565  LKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYI  744
            LKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYI
Sbjct  180  LKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYI  239

Query  745  YIRGEYVNERKNLEKARK  798
            YIRGEYVNER NLEKAR+
Sbjct  240  YIRGEYVNERLNLEKARR  257



>ref|XP_010491494.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Camelina sativa]
Length=486

 Score =   323 bits (827),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MA V+G+L LQR   V + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAAVRGILGLQRAVSVWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKAR+
Sbjct  181  IRGEYVNERLNLEKARR  197



>ref|XP_007222426.1| hypothetical protein PRUPE_ppa004904mg [Prunus persica]
 gb|EMJ23625.1| hypothetical protein PRUPE_ppa004904mg [Prunus persica]
Length=486

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSL R AL +   +KWGL  R +S Q A+TA TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLPRAALARHHGEKWGLGLRSFSTQGATTATTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YG HDPFLKGA+KRGDW+RTKD+V+KG DWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGSHDPFLKGAMKRGDWHRTKDIVIKGADWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKARK
Sbjct  181  IRGEYVNERINLEKARK  197



>ref|XP_004136606.2| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cucumis sativus]
 gb|KGN59382.1| hypothetical protein Csa_3G815460 [Cucumis sativus]
Length=486

 Score =   322 bits (826),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP +G+L LQR +L +    +WG+  R +S+Q A+   +PQ P PPPPPEKTHFGGLKD
Sbjct  1    MAPFRGMLYLQRRSLARCYIDQWGIGLRAFSSQGAAAPGSPQPPAPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKG DWIVNEVKKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEVKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNERKNLEKARK
Sbjct  181  IRGEYVNERKNLEKARK  197



>ref|XP_002873369.1| hypothetical protein ARALYDRAFT_487692 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49628.1| hypothetical protein ARALYDRAFT_487692 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + +   +     R +S QAAST+ TPQ PPPPPPPEKTHFGGL D
Sbjct  1    MAPVRGILGLQRAVSIWKEINRVAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLTD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGL
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGL  120

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  121  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  180

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLEKAR+
Sbjct  181  IRGEYVNERLNLEKARR  197



>ref|XP_009131078.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Brassica rapa]
Length=487

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 178/198 (90%), Gaps = 1/198 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGR-FYSAQAASTANTPQSpppppppEKTHFGGLK  384
            MAP++G+L LQR   + + S +   + R F + Q AST+ TPQ PPPPPPPEKTHFGGLK
Sbjct  1    MAPMRGILGLQRAVSIWKESNRLAPSLRSFSTTQGASTSTTPQPPPPPPPPEKTHFGGLK  60

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSG  564
            DEDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSG
Sbjct  61   DEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSG  120

Query  565  LKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYI  744
            LKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYI
Sbjct  121  LKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYI  180

Query  745  YIRGEYVNERKNLEKARK  798
            YIRGEYVNER NLEKAR+
Sbjct  181  YIRGEYVNERLNLEKARR  198



>gb|ADN33976.1| NADH-ubiquinone oxidoreductase flavoprotein [Cucumis melo subsp. 
melo]
Length=480

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +1

Query  226  LLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFT  405
            +L LQ   L +R   +WG+  R +S+Q A+   +PQ PPPPPPPEKTHFGGLKDEDRIFT
Sbjct  1    MLYLQHRTLARRYIDQWGIGLRAFSSQGAAAPGSPQPPPPPPPPEKTHFGGLKDEDRIFT  60

Query  406  NVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP  585
            N+YGLHDPFLKGA+KRGDW+RTKDLVLKG DWIVNEVKKSGLRGRGGAGFPSGLKWSFMP
Sbjct  61   NLYGLHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEVKKSGLRGRGGAGFPSGLKWSFMP  120

Query  586  KTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYV  765
            K SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYV
Sbjct  121  KVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYV  180

Query  766  NERKNLEKARK  798
            NERKNLEKARK
Sbjct  181  NERKNLEKARK  191



>ref|XP_009403957.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=509

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 179/214 (84%), Gaps = 1/214 (0%)
 Frame = +1

Query  160  SHQRSVALRLRYLSPAMAPVKGLLSLQRTALVQRCSQKWGLNG-RFYSAQAASTANTPQS  336
            + +R V+  L  +     P+K L S+ R  L++  S     +  R +S Q A+T +TPQ 
Sbjct  6    ASRRVVSTSLPAIKSGSVPLKNLSSIYRAGLIRHSSGWRSFSACRSFSTQTATTGSTPQP  65

Query  337  pppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEV  516
            PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYRTKDLV+KG+DWIVNE+
Sbjct  66   PPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYRTKDLVVKGSDWIVNEM  125

Query  517  KKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLE  696
            KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLE
Sbjct  126  KKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLE  185

Query  697  GCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            GCLIAGVGMRA AAYIY+RGEYVNER  LEKARK
Sbjct  186  GCLIAGVGMRATAAYIYVRGEYVNERLTLEKARK  219



>ref|XP_009407142.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=495

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 172/198 (87%), Gaps = 3/198 (2%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNG--RFYSAQAASTANTPQSpppppppEKTHFGGLK  384
            AP+K   S  +  L+    + W LN   R  S QAA+T +TPQ PPPPPPPEKTHFGGLK
Sbjct  9    APLKNFSSRYKAELLHH-FKTWRLNSACRSLSTQAATTGSTPQPPPPPPPPEKTHFGGLK  67

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSG  564
            DEDRIFTN+YGLHDP LKGA+KRGDWYRTKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSG
Sbjct  68   DEDRIFTNLYGLHDPLLKGAMKRGDWYRTKDLVLKGSDWIVNEIKKSGLRGRGGAGFPSG  127

Query  565  LKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYI  744
            LKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYI
Sbjct  128  LKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYI  187

Query  745  YIRGEYVNERKNLEKARK  798
            YIRGEYVNER  LEKARK
Sbjct  188  YIRGEYVNERLTLEKARK  205



>ref|XP_010911159.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Elaeis guineensis]
Length=523

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ P PPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYR
Sbjct  64   RSFSTQAATTASTPQPPSPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWYR  123

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  124  TKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  183

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            CKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER  LEKARK
Sbjct  184  CKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYVNERLTLEKARK  233



>ref|XP_009385396.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=495

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 173/198 (87%), Gaps = 3/198 (2%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNGRFYS--AQAASTANTPQSpppppppEKTHFGGLK  384
            AP+K L  L RT LV   S  W L+    S   QAA+T NTPQ PPPPPPPEKTHFGGLK
Sbjct  9    APIKNLCLLYRTELVHHFS-GWRLSSASRSLSTQAATTGNTPQPPPPPPPPEKTHFGGLK  67

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSG  564
            DEDRIFTN+YGLHDP LKGA+KRGDWYRTKDLV+KG+DWIVNE+KKSGLRGRGGAGFPSG
Sbjct  68   DEDRIFTNLYGLHDPLLKGAMKRGDWYRTKDLVIKGSDWIVNEIKKSGLRGRGGAGFPSG  127

Query  565  LKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYI  744
            LKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGM+A AAYI
Sbjct  128  LKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMKATAAYI  187

Query  745  YIRGEYVNERKNLEKARK  798
            YIRGEYVNER  LEKARK
Sbjct  188  YIRGEYVNERLTLEKARK  205



>ref|NP_001148767.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Zea mays]
 gb|ACG32826.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Zea mays]
Length=504

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYR
Sbjct  46   RSFSTQAATTSSTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAVKRGDWYR  105

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  106  TKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  165

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            CKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR+
Sbjct  166  CKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQ  215



>ref|XP_003557368.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Brachypodium distachyon]
Length=535

 Score =   308 bits (790),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            GR +S QAAST++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YGLHDPFLKGA+KRGDWY
Sbjct  75   GRSFSTQAASTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGLHDPFLKGAMKRGDWY  134

Query  466  RTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPG  645
            RTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPG
Sbjct  135  RTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPG  194

Query  646  TCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKAR  795
            TCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR
Sbjct  195  TCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKAR  244



>gb|EMS64088.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Triticum urartu]
Length=500

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            GR +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YGLHDPFLKGA+KRGDWY
Sbjct  40   GRSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGLHDPFLKGAMKRGDWY  99

Query  466  RTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPG  645
            RTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPG
Sbjct  100  RTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPG  159

Query  646  TCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            TCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR+
Sbjct  160  TCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQ  210



>gb|EMT32185.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, mitochondrial 
[Aegilops tauschii]
Length=500

 Score =   307 bits (787),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            GR +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YGLHDPFLKGA+KRGDWY
Sbjct  40   GRSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGLHDPFLKGAMKRGDWY  99

Query  466  RTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPG  645
            RTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPG
Sbjct  100  RTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPG  159

Query  646  TCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            TCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR+
Sbjct  160  TCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQ  210



>gb|ACF84291.1| unknown [Zea mays]
 gb|ACG32615.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Zea mays]
 gb|ACR36181.1| unknown [Zea mays]
 tpg|DAA63904.1| TPA: NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=504

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 177/215 (82%), Gaps = 7/215 (3%)
 Frame = +1

Query  175  VALRLRYLSPAMAPVKGLLSLQRTALVQRCSQKWGLNG-------RFYSAQAASTANTPQ  333
            +ALR   L  A    +   +++    + R      LNG       R  S QAA+T++TPQ
Sbjct  1    MALRRALLRSAEISFERKAAIEYIHSLSRAQPARSLNGAGLCPASRSLSTQAATTSSTPQ  60

Query  334  SpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNE  513
             PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE
Sbjct  61   PPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNE  120

Query  514  VKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLL  693
            +KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLL
Sbjct  121  MKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLL  180

Query  694  EGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            EGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR+
Sbjct  181  EGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQ  215



>ref|NP_001141093.1| uncharacterized protein LOC100273176 [Zea mays]
 gb|ACF85385.1| unknown [Zea mays]
Length=504

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 177/215 (82%), Gaps = 7/215 (3%)
 Frame = +1

Query  175  VALRLRYLSPAMAPVKGLLSLQRTALVQRCSQKWGLNG-------RFYSAQAASTANTPQ  333
            +ALR   L  A    +   +++    + R      LNG       R  S QAA+T++TPQ
Sbjct  1    MALRRALLRSAEISFERKAAIEYIHSLSRAQPARSLNGAGLCPASRSLSTQAATTSSTPQ  60

Query  334  SpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNE  513
             PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE
Sbjct  61   PPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNE  120

Query  514  VKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLL  693
            +KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLL
Sbjct  121  MKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLL  180

Query  694  EGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            EGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR+
Sbjct  181  EGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQ  215



>ref|XP_004958515.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Setaria italica]
Length=504

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDW+R
Sbjct  46   RSFSTQAATTSSTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWHR  105

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  106  TKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  165

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            CKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR+
Sbjct  166  CKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQ  215



>gb|ACL53142.1| unknown [Zea mays]
 tpg|DAA41608.1| TPA: LOW QUALITY PROTEIN: NADH-ubiquinone oxidoreductase subunit 
[Zea mays]
Length=504

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYR
Sbjct  46   RSFSTQAATTSSTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAVKRGDWYR  105

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  106  TKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  165

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            CKDREIMR DPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR+
Sbjct  166  CKDREIMRQDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQ  215



>ref|XP_008799963.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X4 [Phoenix dactylifera]
Length=488

 Score =   305 bits (780),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYR
Sbjct  29   RSFSTQAATTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYR  88

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  89   TKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  148

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            CKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER  LEKAR+
Sbjct  149  CKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYVNERLTLEKARR  198



>ref|XP_010025340.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Eucalyptus grandis]
Length=483

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 177/198 (89%), Gaps = 5/198 (3%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSppppppp-EKTHFGGLK  384
            MAP++GLLSL++T L++      G+  R +S + A TA+ P SPPPPPPP EKTHFGGLK
Sbjct  1    MAPMRGLLSLRKTILLR----GQGIGVRSFSTEGAKTASAPPSPPPPPPPPEKTHFGGLK  56

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSG  564
            DEDRIFTN+YG+ DPFLKGA+KRGDWYRTKDLVLKGTDWIV+EVKKSGLRGRGGAGF +G
Sbjct  57   DEDRIFTNLYGMRDPFLKGAMKRGDWYRTKDLVLKGTDWIVSEVKKSGLRGRGGAGFSAG  116

Query  565  LKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYI  744
            LKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYI
Sbjct  117  LKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYI  176

Query  745  YIRGEYVNERKNLEKARK  798
            YIRGEYVNER NLE+ARK
Sbjct  177  YIRGEYVNERINLERARK  194



>ref|XP_008799962.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X3 [Phoenix dactylifera]
Length=502

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYR
Sbjct  43   RSFSTQAATTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYR  102

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  103  TKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  162

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            CKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER  LEKAR+
Sbjct  163  CKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYVNERLTLEKARR  212



>ref|XP_006658044.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Oryza brachyantha]
Length=504

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            G+ +S QAA+T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDW+
Sbjct  45   GKSFSTQAATTSSTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWH  104

Query  466  RTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPG  645
            RTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPG
Sbjct  105  RTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPG  164

Query  646  TCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            TCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NL KAR+
Sbjct  165  TCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLLKARE  215



>ref|XP_008799961.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Phoenix dactylifera]
Length=523

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYR
Sbjct  64   RSFSTQAATTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYR  123

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  124  TKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  183

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            CKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER  LEKAR+
Sbjct  184  CKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYVNERLTLEKARR  233



>ref|XP_008799960.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Phoenix dactylifera]
Length=531

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYR
Sbjct  72   RSFSTQAATTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYR  131

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  132  TKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  191

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            CKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER  LEKAR+
Sbjct  192  CKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYVNERLTLEKARR  241



>ref|XP_006827286.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Amborella trichopoda]
 gb|ERM94523.1| hypothetical protein AMTR_s00010p00264240 [Amborella trichopoda]
Length=487

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R+ + QA +T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YG+HDPFLKGA+KRGDW R
Sbjct  25   RYLNTQAPTTSSTPQLPPPPPPPEKTHFGGLKDEDRIFTNLYGMHDPFLKGAMKRGDWCR  84

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLVLKG+DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  85   TKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  144

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            CKDREIMRHDPHKLLEGCLIAGV MRA AAYIYIRGEYVNER NL KARK
Sbjct  145  CKDREIMRHDPHKLLEGCLIAGVAMRASAAYIYIRGEYVNERLNLLKARK  194



>dbj|BAJ94094.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90021.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            GR +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YGLHDPFLKGA+KRGDW 
Sbjct  45   GRSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGLHDPFLKGAMKRGDWN  104

Query  466  RTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPG  645
            RTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPG
Sbjct  105  RTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPG  164

Query  646  TCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            TCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR+
Sbjct  165  TCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARQ  215



>ref|XP_006438083.1| hypothetical protein CICLE_v10033600mg, partial [Citrus clementina]
 gb|ESR51323.1| hypothetical protein CICLE_v10033600mg, partial [Citrus clementina]
Length=454

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +1

Query  310  ASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLK  489
            ASTA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YG+HDPFLKGA+KRGDW+RTKDLVLK
Sbjct  3    ASTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGMHDPFLKGAMKRGDWHRTKDLVLK  62

Query  490  GTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIM  669
            G DWIVNEVKKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIM
Sbjct  63   GADWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIM  122

Query  670  RHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            RHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNERKNLE+AR+
Sbjct  123  RHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERKNLERARQ  165



>ref|XP_010025338.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Eucalyptus grandis]
 gb|KCW61975.1| hypothetical protein EUGRSUZ_H04659 [Eucalyptus grandis]
Length=484

 Score =   302 bits (774),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 176/197 (89%), Gaps = 5/197 (3%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSppppppp-EKTHFGGLKD  387
            AP++GLLSL++T L++      G+  R +S + A TA+ P SPPPPPPP EKTHFGGLKD
Sbjct  3    APMRGLLSLRKTILLR----GQGIGVRSFSTEGAKTASAPPSPPPPPPPPEKTHFGGLKD  58

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGL  567
            EDRIFTN+YG+ DPFLKGA+KRGDWYRTKDLVLKGTDWIV+EVKKSGLRGRGGAGF +GL
Sbjct  59   EDRIFTNLYGMRDPFLKGAMKRGDWYRTKDLVLKGTDWIVSEVKKSGLRGRGGAGFSAGL  118

Query  568  KWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIY  747
            KWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIY
Sbjct  119  KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY  178

Query  748  IRGEYVNERKNLEKARK  798
            IRGEYVNER NLE+ARK
Sbjct  179  IRGEYVNERINLERARK  195



>dbj|BAG89406.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94744.1| unnamed protein product [Oryza sativa Japonica Group]
Length=411

 Score =   300 bits (767),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            G+ +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YG HDPFLKGA+KRGDW+
Sbjct  45   GKSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGQHDPFLKGAMKRGDWH  104

Query  466  RTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPG  645
            RTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPG
Sbjct  105  RTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPG  164

Query  646  TCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            TCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NL KAR+
Sbjct  165  TCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLLKARE  215



>ref|XP_006838360.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Amborella trichopoda]
 gb|ERN00929.1| hypothetical protein AMTR_s00002p00015430 [Amborella trichopoda]
Length=485

 Score =   302 bits (773),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++ LLS  R++L Q  S+      R +S QA +T++TPQ P PPPPPEKTHFGGLKDEDR
Sbjct  1    MRNLLSFPRSSLTQHYSKGLVPFNRSFSTQAPTTSSTPQPPSPPPPPEKTHFGGLKDEDR  60

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWS  576
            IFTN+YG++DPFLKGA+KRGDWY+TKDL+LKG+DWIVNE+KKSGLRGRGGAGFPSGLKWS
Sbjct  61   IFTNLYGINDPFLKGAMKRGDWYQTKDLILKGSDWIVNEMKKSGLRGRGGAGFPSGLKWS  120

Query  577  FMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRG  756
            FMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRG
Sbjct  121  FMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRG  180

Query  757  EYVNERKNLEKARK  798
            EYVNER NL KARK
Sbjct  181  EYVNERLNLLKARK  194



>gb|AHA84169.1| NADH-quinone oxidoreductase subunit F [Phaseolus vulgaris]
Length=482

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            +K  LSL RTALVQ   +  GL  R +S Q ASTA +PQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MKRFLSL-RTALVQHRIENLGLGLRLFSTQGASTATSPQPPPPPPPPEKTHFGGLKDEDR  59

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWS  576
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKSGLRGRGGAGFPS LKWS
Sbjct  60   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVIKGTDWIVNEMKKSGLRGRGGAGFPSRLKWS  119

Query  577  FMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRG  756
            FMPK SDGRPSYLVVNADESEPGTCKDR+IMR DPH+LLEGCLIAGV M+A AAYIYIRG
Sbjct  120  FMPKVSDGRPSYLVVNADESEPGTCKDRKIMRRDPHQLLEGCLIAGVEMKATAAYIYIRG  179

Query  757  EYVNERKNLEK  789
            EYVNER NLE+
Sbjct  180  EYVNERNNLER  190



>gb|EAZ40868.1| hypothetical protein OsJ_25349 [Oryza sativa Japonica Group]
Length=514

 Score =   300 bits (769),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            G+ +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YG HDPFLKGA+KRGDW+
Sbjct  55   GKSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGQHDPFLKGAMKRGDWH  114

Query  466  RTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPG  645
            RTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPG
Sbjct  115  RTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPG  174

Query  646  TCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            TCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NL KAR+
Sbjct  175  TCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLLKARE  225



>gb|EAZ04909.1| hypothetical protein OsI_27090 [Oryza sativa Indica Group]
Length=529

 Score =   300 bits (769),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 181/227 (80%), Gaps = 5/227 (2%)
 Frame = +1

Query  130  LGSQFLTSRPSHQRSVALRLRYLSP--AMAPVKGLLSLQRTALVQRCSQKWGL--NGRFY  297
            L   F     +  R + L++    P    A ++ L SL R A   R     GL   G+ +
Sbjct  15   LSFYFAYKTTTTNRKIVLQILKTCPLSGQAALEYLHSLSR-AQPTRSLTGAGLYSAGKSF  73

Query  298  SAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKD  477
            S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YG HDPFLKGA+KRGDW+RTKD
Sbjct  74   STQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGQHDPFLKGAMKRGDWHRTKD  133

Query  478  LVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKD  657
            LVLKG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGTCKD
Sbjct  134  LVLKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKD  193

Query  658  REIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            REIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NL KAR+
Sbjct  194  REIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLLKARE  240



>ref|NP_001060455.1| Os07g0645400 [Oryza sativa Japonica Group]
 dbj|BAC16718.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF22369.1| Os07g0645400 [Oryza sativa Japonica Group]
Length=504

 Score =   300 bits (767),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            G+ +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YG HDPFLKGA+KRGDW+
Sbjct  45   GKSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGQHDPFLKGAMKRGDWH  104

Query  466  RTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPG  645
            RTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPG
Sbjct  105  RTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPG  164

Query  646  TCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            TCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NL KAR+
Sbjct  165  TCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLLKARE  215



>gb|ACE96388.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FGGLKDEDRIFTNVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA
Sbjct  1    FGGLKDEDRIFTNVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  60

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA
Sbjct  61   GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  120

Query  730  QAAYIYIRGEYVNERKNLEKARK  798
             AAYIYIRGEYVNER NLE+ARK
Sbjct  121  SAAYIYIRGEYVNERINLERARK  143



>gb|ACE96363.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96364.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96367.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96368.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96370.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96371.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96373.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96374.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96375.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96376.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96377.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96378.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96379.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96380.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96381.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96382.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96383.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96384.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96385.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96386.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96389.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96391.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FGGLKDEDRIFTNVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA
Sbjct  1    FGGLKDEDRIFTNVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  60

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA
Sbjct  61   GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  120

Query  730  QAAYIYIRGEYVNERKNLEKARK  798
             AAYIYIRGEYVNER NLE+ARK
Sbjct  121  SAAYIYIRGEYVNERINLERARK  143



>gb|ACE96365.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96366.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FGGLKDEDRIFTNVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA
Sbjct  1    FGGLKDEDRIFTNVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  60

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA
Sbjct  61   GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  120

Query  730  QAAYIYIRGEYVNERKNLEKARK  798
             AAYIYIRGEYVNER NLE+ARK
Sbjct  121  SAAYIYIRGEYVNERINLERARK  143



>gb|ACE96369.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96372.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96387.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96390.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96392.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FGGLKDEDRIFTNVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA
Sbjct  1    FGGLKDEDRIFTNVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  60

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA
Sbjct  61   GFPSGLKWSFMPKISDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  120

Query  730  QAAYIYIRGEYVNERKNLEKARK  798
             AAYIYIRGEYVNER NLE+ARK
Sbjct  121  SAAYIYIRGEYVNERINLERARK  143



>ref|XP_001754412.1| predicted protein [Physcomitrella patens]
 gb|EDQ80862.1| predicted protein [Physcomitrella patens]
Length=462

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +1

Query  301  AQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDL  480
            A + S A  P  PPPPPP EKTHFGGLKDEDRIFTN+YGLHDPFL GA KRGDWYRTKDL
Sbjct  5    ATSGSQATAPPPPPPPPPAEKTHFGGLKDEDRIFTNLYGLHDPFLAGAKKRGDWYRTKDL  64

Query  481  VLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDR  660
            V KGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDR
Sbjct  65   VHKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDR  124

Query  661  EIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            EIMRHDPHKLLEGCLIAGVGMRA+AAYIYIRGEYVNER NL+KA
Sbjct  125  EIMRHDPHKLLEGCLIAGVGMRARAAYIYIRGEYVNERLNLQKA  168



>ref|XP_002977599.1| hypothetical protein SELMODRAFT_443575 [Selaginella moellendorffii]
 gb|EFJ21603.1| hypothetical protein SELMODRAFT_443575 [Selaginella moellendorffii]
Length=483

 Score =   291 bits (746),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 158/173 (91%), Gaps = 1/173 (1%)
 Frame = +1

Query  283  NGRFYSAQAAS-TANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGD  459
            + RF S QAAS +A    +PPPPP  E+T FGGLKDEDRIFTN+YG+HDPFLKGA+ RGD
Sbjct  20   SSRFMSVQAASKSATPQPAPPPPPATERTSFGGLKDEDRIFTNLYGIHDPFLKGAMARGD  79

Query  460  WYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESE  639
            W+RTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESE
Sbjct  80   WHRTKDLVLKGPDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESE  139

Query  640  PGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            PGTCKDREIMRHDPHKL+EGCLIAGVGMRA+AAYIYIRGEYVNERKNLE+A K
Sbjct  140  PGTCKDREIMRHDPHKLVEGCLIAGVGMRARAAYIYIRGEYVNERKNLERAVK  192



>ref|XP_001778863.1| predicted protein [Physcomitrella patens]
 gb|EDQ56313.1| predicted protein [Physcomitrella patens]
Length=463

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 153/167 (92%), Gaps = 2/167 (1%)
 Frame = +1

Query  298  SAQAAS--TANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRT  471
            SAQA S   A  P  PPPPPP EKT FGGLKDEDRIFTN+YG+HDPFL GA KRGDW+RT
Sbjct  2    SAQATSGPQATAPPPPPPPPPAEKTQFGGLKDEDRIFTNLYGIHDPFLAGAKKRGDWHRT  61

Query  472  KDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTC  651
            KDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGTC
Sbjct  62   KDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTC  121

Query  652  KDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            KDREIMRHDPHKLLEGCLIAGVGMRA+AAYIYIRGEYVNER NL+KA
Sbjct  122  KDREIMRHDPHKLLEGCLIAGVGMRARAAYIYIRGEYVNERLNLQKA  168



>ref|XP_002975195.1| hypothetical protein SELMODRAFT_150347 [Selaginella moellendorffii]
 gb|EFJ23980.1| hypothetical protein SELMODRAFT_150347 [Selaginella moellendorffii]
Length=460

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            E+T FGGLKDEDRIFTN+YG+HDPFLKGA+ RGDW+RTKDLVLKG DWIVNE+KKSGLRG
Sbjct  23   ERTSFGGLKDEDRIFTNLYGIHDPFLKGAMARGDWHRTKDLVLKGPDWIVNEMKKSGLRG  82

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKL+EGCLIAGV
Sbjct  83   RGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLVEGCLIAGV  142

Query  718  GMRAQAAYIYIRGEYVNERKNLEKARK  798
            GMRA+AAYIYIRGEYVNERKNLE+A K
Sbjct  143  GMRARAAYIYIRGEYVNERKNLERAVK  169



>ref|XP_003058710.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57165.1| predicted protein [Micromonas pusilla CCMP1545]
Length=468

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +1

Query  373  GGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAG  552
            GGLKDEDRIFTN+YG HDPFLKGA+KRGDWY TKDL+L G DWIVNE+K SGLRGRGGAG
Sbjct  40   GGLKDEDRIFTNLYGKHDPFLKGAMKRGDWYNTKDLMLMGPDWIVNEIKASGLRGRGGAG  99

Query  553  FPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQ  732
            FPSGLKWSFMPK SDGRPSYLV+NADESEPGTCKDREIMRHDPHKLLEGCLIAG  MRA+
Sbjct  100  FPSGLKWSFMPKVSDGRPSYLVINADESEPGTCKDREIMRHDPHKLLEGCLIAGTAMRAR  159

Query  733  AAYIYIRGEYVNERKNLEKAR  795
            A YIYIRGEYVNER NLE+AR
Sbjct  160  ACYIYIRGEYVNERLNLERAR  180



>gb|ACE96395.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96396.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96397.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96398.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=396

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  406  NVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP  585
            NVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP
Sbjct  1    NVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP  60

Query  586  KTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYV  765
            KTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYV
Sbjct  61   KTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYV  120

Query  766  NERKNLEKARK  798
            NER NLE+ARK
Sbjct  121  NERINLERARK  131



>gb|ACE96394.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96399.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=396

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  406  NVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP  585
            NVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP
Sbjct  1    NVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP  60

Query  586  KTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYV  765
            K SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYV
Sbjct  61   KASDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYV  120

Query  766  NERKNLEKARK  798
            NER NLE+ARK
Sbjct  121  NERINLERARK  131



>gb|ACE96393.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96400.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=396

 Score =   265 bits (678),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +1

Query  406  NVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP  585
            NVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP
Sbjct  1    NVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMP  60

Query  586  KTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYV  765
            K SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYV
Sbjct  61   KISDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYV  120

Query  766  NERKNLEKARK  798
            NER NLE+ARK
Sbjct  121  NERINLERARK  131



>gb|KIY99198.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Monoraphidium 
neglectum]
Length=462

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            E+T FGGLKD+DRIFTN+YG HDP++KGA+ RGDWYRTKDLVLKG+DW+V+++KKSGLRG
Sbjct  14   ERTSFGGLKDDDRIFTNIYGRHDPYIKGAMARGDWYRTKDLVLKGSDWVVDQMKKSGLRG  73

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFPSGLKWSFMPK SDGRPSYLVVN DESEPGTCKDREIMRH+PHKL+EGCLIAGV
Sbjct  74   RGGAGFPSGLKWSFMPKVSDGRPSYLVVNGDESEPGTCKDREIMRHEPHKLVEGCLIAGV  133

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
            GMRA+A YIYIRGE+VNER ++++A
Sbjct  134  GMRARAGYIYIRGEFVNERLSVQRA  158



>tpg|DAA41609.1| TPA: NADH-ubiquinone oxidoreductase subunit, mRNA [Zea mays]
Length=468

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWS  576
             FTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKSGLRGRGGAGFPSGLKWS
Sbjct  46   FFTNLYGLHDPFLKGAVKRGDWYRTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGLKWS  105

Query  577  FMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRG  756
            FMPK SDGRPSYLVVNADESEPGTCKDREIMR DPHKLLEGCLIAGVGMRA AAYIYIRG
Sbjct  106  FMPKVSDGRPSYLVVNADESEPGTCKDREIMRQDPHKLLEGCLIAGVGMRASAAYIYIRG  165

Query  757  EYVNERKNLEKARK  798
            EYVNER NLEKAR+
Sbjct  166  EYVNERLNLEKARQ  179



>ref|XP_005650585.1| NADH-ubiquinone oxidoreductase [Coccomyxa subellipsoidea C-169]
 gb|EIE26041.1| NADH-ubiquinone oxidoreductase [Coccomyxa subellipsoidea C-169]
Length=467

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 142/168 (85%), Gaps = 6/168 (4%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +SAQA+    TP         EKT +GGL+DEDRIFTN+Y   DPF+KGA+ RGDWYR
Sbjct  19   RSFSAQASPPPPTPPPS------EKTTYGGLRDEDRIFTNLYRQGDPFIKGAMARGDWYR  72

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TKDLV KG+DWIV E+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  73   TKDLVEKGSDWIVGEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT  132

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            CKDREIMRHDPHKL+EGCLIAGVGMRA+A YIYIRGEY NER  LE+A
Sbjct  133  CKDREIMRHDPHKLIEGCLIAGVGMRARAGYIYIRGEYYNERLALERA  180



>ref|XP_002503039.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64297.1| predicted protein [Micromonas sp. RCC299]
Length=441

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            +TH GGL DEDRIFTN+YG HDPFLKGA+KRGDWY TK+L+L G DWIVNE+K SGLRGR
Sbjct  10   RTH-GGLSDEDRIFTNLYGKHDPFLKGAMKRGDWYNTKELMLMGPDWIVNEMKASGLRGR  68

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFPSGLKWSFMPK SDGRPSYLV+NADESEPGTCKDREIMRHDPHKLLEGCLIAG  
Sbjct  69   GGAGFPSGLKWSFMPKVSDGRPSYLVINADESEPGTCKDREIMRHDPHKLLEGCLIAGTA  128

Query  721  MRAQAAYIYIRGEYVNERKNLEKAR  795
            MRA+A YIYIRGEYVNER  L KAR
Sbjct  129  MRARACYIYIRGEYVNERLALMKAR  153



>ref|XP_005846008.1| NADH:ubiquinone oxidoreductase 51 kD subunit, partial [Chlorella 
variabilis]
 gb|EFN53906.1| NADH:ubiquinone oxidoreductase 51 kD subunit, partial [Chlorella 
variabilis]
Length=444

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            E+T FGGL D+DRIFTN+YG HDPF+KGA KRGDWYRTKD+V KG+DW+V+++KKSGLRG
Sbjct  1    ERTTFGGLADKDRIFTNIYGRHDPFIKGAEKRGDWYRTKDIVSKGSDWVVDQMKKSGLRG  60

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFPSGLKWSFMPK SDGRPSYLVVN DESEPGTCKDREIMRH+PHKL+EGCLIAGV
Sbjct  61   RGGAGFPSGLKWSFMPKVSDGRPSYLVVNGDESEPGTCKDREIMRHEPHKLVEGCLIAGV  120

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
            GMRA+A YIYIRGE+V ERK + +A
Sbjct  121  GMRARAGYIYIRGEFVEERKAVMRA  145



>ref|XP_007514630.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Bathycoccus prasinos]
 emb|CCO14870.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Bathycoccus prasinos]
Length=512

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 2/146 (1%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            +TH GGL D+DRIFTN+YG HDPF+KGA+KRGDWY TK+LVL G DWI+NE+K SGLRGR
Sbjct  80   RTH-GGLTDQDRIFTNLYGKHDPFIKGAMKRGDWYNTKELVLMGADWIINEIKASGLRGR  138

Query  541  GGAGFPSGLKWSFMPKTS-DGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            GGAGFPSGLKWSFMPK S DGRP+YLVVNADESEPGTCKDREIMRHDPHKLLEGCL+AGV
Sbjct  139  GGAGFPSGLKWSFMPKVSADGRPNYLVVNADESEPGTCKDREIMRHDPHKLLEGCLLAGV  198

Query  718  GMRAQAAYIYIRGEYVNERKNLEKAR  795
            GMRA+A YIYIRGEYVNER  LE+AR
Sbjct  199  GMRARACYIYIRGEYVNERLALERAR  224



>gb|KDD75042.1| respiratory-chain NADH dehydrogenase [Helicosporidium sp. ATCC 
50920]
Length=458

 Score =   260 bits (664),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            EKT FGGL+D+DRIFTN+YG HDPF+KGA KRGDWYRTKD+++KG DWIV+++KKSGLRG
Sbjct  25   EKTSFGGLEDKDRIFTNLYGKHDPFIKGAEKRGDWYRTKDILVKGADWIVDQMKKSGLRG  84

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFPSGLKWSFMPK SDGRPSYLVVN DESEPGTCKDREIMRHDPHKL+EGCLIAG 
Sbjct  85   RGGAGFPSGLKWSFMPKVSDGRPSYLVVNGDESEPGTCKDREIMRHDPHKLVEGCLIAGT  144

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             MRA+A YIYIRGE+V ERK + +A
Sbjct  145  AMRARAGYIYIRGEFVEERKAVMRA  169



>ref|XP_003083193.1| PREDICTED P0503D09.102 gene product [Oryza sativa (ISS) [Ostreococcus 
tauri]
 emb|CAL57468.1| NADH ubiquinone oxidoreductase, F subunit, iron sulphur binding 
[Ostreococcus tauri]
Length=491

 Score =   258 bits (659),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            E+TH G L D DRIFTN+YG HDPFLKGA+ RGDWY TK LV  G DWIVNE+K SGLRG
Sbjct  59   ERTH-GNLSDADRIFTNLYGRHDPFLKGAMARGDWYETKKLVELGADWIVNEMKASGLRG  117

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFPSGLKWSFMPK SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAG 
Sbjct  118  RGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGT  177

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             MRA+AAYIYIRGEYVNER  LE+A
Sbjct  178  AMRARAAYIYIRGEYVNERLALERA  202



>ref|XP_001421384.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99677.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=449

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            E+ H G LKD+DRIFTN+YG HDPFLKGA+KRGDW+ TK LV  G DWI++E+K SGLRG
Sbjct  15   ERAH-GDLKDQDRIFTNLYGKHDPFLKGAMKRGDWHNTKSLVELGADWIISEMKASGLRG  73

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFPSGLKWSFMP+ SDGRP+YLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAG 
Sbjct  74   RGGAGFPSGLKWSFMPRVSDGRPNYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGT  133

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             MRA+AAYIYIRGEYVNER  LE+A
Sbjct  134  AMRARAAYIYIRGEYVNERLALERA  158



>emb|CBI21762.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +1

Query  196  LSPAMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFG  375
            ++  MAP++G+L+LQR ALV R S+KWG   R +S QAA+TA+  Q PPPPPPPEKTHFG
Sbjct  116  ITSQMAPIRGILTLQRMALVSRQSKKWGPGCRAFSTQAATTASASQPPPPPPPPEKTHFG  175

Query  376  GLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGF  555
            GLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTKD+VLKG+DWIVNE+KKSGLRGRGGAGF
Sbjct  176  GLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKSGLRGRGGAGF  235

Query  556  PSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            PSGLKWSFMPK SDGRPSYLVVNADESEPGT
Sbjct  236  PSGLKWSFMPKVSDGRPSYLVVNADESEPGT  266



>ref|XP_010263147.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nelumbo nucifera]
Length=500

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  409  VYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPK  588
            V GLH PFL GA+KRGD YRTKD VLKG +WIVNE+KKSGLRGRGGAGFPSGLKWSFMPK
Sbjct  209  VNGLHGPFLNGAMKRGDCYRTKDSVLKGFNWIVNEMKKSGLRGRGGAGFPSGLKWSFMPK  268

Query  589  TSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVN  768
             SDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVN
Sbjct  269  VSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYVN  328

Query  769  ERKNLEKARK  798
            ERKNLEKAR+
Sbjct  329  ERKNLEKARR  338



>ref|XP_011398745.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Auxenochlorella protothecoides]
 gb|KFM25849.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Auxenochlorella protothecoides]
Length=462

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 131/154 (85%), Gaps = 9/154 (6%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            EKT FGGL+D+DRIFTN+YG HDPFLKGA KRGDW+RTKDLV KG DWIV+++KKSGLRG
Sbjct  19   EKTSFGGLEDKDRIFTNIYGRHDPFLKGAEKRGDWHRTKDLVSKGADWIVDQMKKSGLRG  78

Query  538  RGGAGFPSGLKW---------SFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKL  690
            RGGAGFPSGLKW         SFMPK SDGRP YLVVN DESEPGTCKDREIMRH+PHKL
Sbjct  79   RGGAGFPSGLKWCVDGLTDWGSFMPKVSDGRPGYLVVNGDESEPGTCKDREIMRHEPHKL  138

Query  691  LEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            +EGCLIAG  MRA+A YIY+RGE+V ER  L++A
Sbjct  139  VEGCLIAGTAMRARAGYIYVRGEFVAERLALQRA  172



>ref|XP_002948368.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Volvox carteri 
f. nagariensis]
 gb|EFJ50775.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Volvox carteri 
f. nagariensis]
Length=489

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 155/194 (80%), Gaps = 5/194 (3%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            V  L S+Q T  +Q    K G+  R +S QA +  N    PPPPPPP KT FGGLKD+DR
Sbjct  8    VAQLASVQLTGALQEL--KTGVL-RAFSTQAPAAGNVAAPPPPPPPPAKTSFGGLKDDDR  64

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWS  576
            IF N+YG HD  +KGA+ RGDWY TK+LVLKG DWI++++KKSGLRGRGGAGFPSGLKWS
Sbjct  65   IFQNIYGRHDTSIKGAMSRGDWYMTKELVLKGRDWIIDQMKKSGLRGRGGAGFPSGLKWS  124

Query  577  FMPK--TSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYI  750
            FMPK   SDGRPSYLVVN DESEPGTCKDREIMRH+PHKL+EGCLIAGV M A+A YIYI
Sbjct  125  FMPKAMASDGRPSYLVVNGDESEPGTCKDREIMRHEPHKLVEGCLIAGVAMGARAGYIYI  184

Query  751  RGEYVNERKNLEKA  792
            RGE+VNER+++ +A
Sbjct  185  RGEFVNERRSVMRA  198



>gb|AAL89893.1| RE33648p [Drosophila melanogaster]
Length=239

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K SGLRGRGGA
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTSGLRGRGGA  106

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  107  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  166

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  167  QAAYIYIRGEFYNEASNMQLA  187



>ref|XP_001702590.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDP06369.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Chlamydomonas 
reinhardtii]
Length=484

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT FGGLKDEDRIF N+YG HD  +KGA+ RGDWY TK+++ KG DWI++++KKSGLRGR
Sbjct  50   KTSFGGLKDEDRIFQNIYGRHDLSIKGAMSRGDWYMTKEIIGKGRDWIIDQMKKSGLRGR  109

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFPSGLKWSFMPK SDGRPSYLVVN DESEPGTCKDREIMRH+PHKL+EGCL+AGV 
Sbjct  110  GGAGFPSGLKWSFMPKASDGRPSYLVVNGDESEPGTCKDREIMRHEPHKLVEGCLMAGVA  169

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M A+A YIYIRGE+V ER+ +E+A
Sbjct  170  MGARAGYIYIRGEFVQERRAVERA  193



>ref|XP_010276028.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like, 
partial [Nelumbo nucifera]
Length=572

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  409  VYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPK  588
            V GLH+PFL GA+K GDWYRTKDLVLKG++WIVNE+KKSGLRGRGGA FPSGLKWSFMPK
Sbjct  240  VNGLHNPFLNGAMKWGDWYRTKDLVLKGSNWIVNEMKKSGLRGRGGAAFPSGLKWSFMPK  299

Query  589  TSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVN  768
             SDG PSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYI+IRGEYVN
Sbjct  300  VSDGCPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIHIRGEYVN  359

Query  769  ERKNLEKARK  798
            E+KNLEKAR+
Sbjct  360  EQKNLEKARR  369



>gb|KHJ94492.1| NADH oxidoreductase, F subunit [Oesophagostomum dentatum]
Length=477

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 5/162 (3%)
 Frame = +1

Query  307  AASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVL  486
            AA+ A TPQ  P     EKT FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TKD++L
Sbjct  23   AATAAPTPQKKP-----EKTSFGNLKDSDRIFTNLYGRHDYRLKGALARGDWYKTKDIIL  77

Query  487  KGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREI  666
            KG++WI+NEV+ SGLRGRGGAGFP+G+KWSFM K  DGRP YLVVNADE EPGTCKDREI
Sbjct  78   KGSEWIINEVRTSGLRGRGGAGFPAGMKWSFMSKPFDGRPKYLVVNADEGEPGTCKDREI  137

Query  667  MRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            MRHDPHKL+EGCLIAGV M A+AAYIYIRGE+ NE   L++A
Sbjct  138  MRHDPHKLIEGCLIAGVAMGARAAYIYIRGEFYNEACILQEA  179



>gb|ETN67150.1| NADH-ubiquinone oxidoreductase flavoprotein 1 (ndufv1) [Anopheles 
darlingi]
Length=489

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 137/168 (82%), Gaps = 10/168 (6%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R  SAQA  +A  PQ+        +T FGGL D+DRIFTN+YG HD  LKGA+KRGDWY+
Sbjct  41   RRQSAQA--SAPPPQT--------RTKFGGLADQDRIFTNLYGRHDWRLKGALKRGDWYK  90

Query  469  TKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGT  648
            TK+++LKGTDWI+NE+K SGLRGRGGAGFP+G+KWSFM K SDGRP YLVVNADE EPGT
Sbjct  91   TKEILLKGTDWILNEIKVSGLRGRGGAGFPTGMKWSFMNKPSDGRPKYLVVNADEGEPGT  150

Query  649  CKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            CKDREIMRHDPHKL+EGCLIAG  M A+AAYIYIRGE+ NE  N++ A
Sbjct  151  CKDREIMRHDPHKLIEGCLIAGKAMGARAAYIYIRGEFYNEASNMQLA  198



>emb|CEI93034.1| Putative NADH dehydrogenase [ubiquinone] flavoprotein 1 [Rhizopus 
microsporus]
 emb|CEI91903.1| Putative NADH dehydrogenase [ubiquinone] flavoprotein 1 [Rhizopus 
microsporus]
Length=277

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT FG L DEDRIFTN+Y  HD  LKGA+KRGDWY+TK+LVLKG +WI+NE+K+SGLRGR
Sbjct  46   KTTFGSLSDEDRIFTNLYSKHDYRLKGALKRGDWYKTKELVLKGPEWIINEMKESGLRGR  105

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFP+GLKWSFM K +DGRP YLV+NADE EPGTCKDREI+R DPHKL+EGCLIAG  
Sbjct  106  GGAGFPTGLKWSFMNKPADGRPRYLVINADEGEPGTCKDREILRGDPHKLIEGCLIAGSA  165

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M+A AAYIYIRGE+ NE  NL+ A
Sbjct  166  MKANAAYIYIRGEFYNEAANLQTA  189



>ref|XP_003451045.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Oreochromis niloticus]
Length=472

 Score =   242 bits (618),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ   P    +KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQQVKP----KKTKFGPLSDQDRIFTNLYGRHDWRLKGALK  63

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNAD  630
            RGDWY+TK+++LKG DWI+NEVK SGLRGRGGAGFP+G+KWSFM K SDGRP YLVVNAD
Sbjct  64   RGDWYKTKEIILKGQDWILNEVKISGLRGRGGAGFPTGMKWSFMNKPSDGRPKYLVVNAD  123

Query  631  ESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            E EPGTCKDREIMRHDPHKL+EGCL+AG GM A+AAYIYIRGE+ NE  NL+ A
Sbjct  124  EGEPGTCKDREIMRHDPHKLIEGCLVAGRGMGARAAYIYIRGEFYNESSNLQVA  177



>ref|XP_006804891.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Neolamprologus brichardi]
Length=471

 Score =   242 bits (617),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ       P+KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQ-----VKPKKTKFGPLSDQDRIFTNLYGRHDWRLKGALK  62

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNAD  630
            RGDWY+TK+++LKG DWI+NEVK SGLRGRGGAGFP+G+KWSFM K SDGRP YLVVNAD
Sbjct  63   RGDWYKTKEIILKGQDWILNEVKISGLRGRGGAGFPTGMKWSFMNKPSDGRPKYLVVNAD  122

Query  631  ESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            E EPGTCKDREIMRHDPHKL+EGCL+AG GM A+AAYIYIRGE+ NE  NL+ A
Sbjct  123  EGEPGTCKDREIMRHDPHKLIEGCLVAGRGMGARAAYIYIRGEFYNESSNLQVA  176



>ref|XP_005177827.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Musca domestica]
Length=474

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FGGL D+DRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWI+NE+K SGLRGRGGA
Sbjct  47   FGGLADQDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIINEIKTSGLRGRGGA  106

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  107  GFPSGMKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  166

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  167  QAAYIYIRGEFYNEASNMQLA  187



>ref|XP_004334975.1| NADH oxidoreductase (quinone), F subunit [Acanthamoeba castellanii 
str. Neff]
 gb|ELR12962.1| NADH oxidoreductase (quinone), F subunit [Acanthamoeba castellanii 
str. Neff]
Length=469

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            +G LKD DRIFTN+YG HD F+KGA+ RGDWY+TK+L+ KG DWI+ E+K SGLRGRGGA
Sbjct  15   YGNLKDSDRIFTNLYGEHDIFIKGALARGDWYKTKELLRKGEDWIIKEIKNSGLRGRGGA  74

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSGLKWSFMPK SDGRPSYLV+NADE EPGTCKDREIMRHDPHKL+EGCL+AG  M+A
Sbjct  75   GFPSGLKWSFMPKVSDGRPSYLVINADEGEPGTCKDREIMRHDPHKLVEGCLLAGFSMKA  134

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            +AAYIY+RGE+V E  NL++A
Sbjct  135  KAAYIYVRGEFVYEINNLQRA  155



>ref|XP_005472675.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Oreochromis niloticus]
Length=471

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ       P+KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQ-----VKPKKTKFGPLSDQDRIFTNLYGRHDWRLKGALK  62

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNAD  630
            RGDWY+TK+++LKG DWI+NEVK SGLRGRGGAGFP+G+KWSFM K SDGRP YLVVNAD
Sbjct  63   RGDWYKTKEIILKGQDWILNEVKISGLRGRGGAGFPTGMKWSFMNKPSDGRPKYLVVNAD  122

Query  631  ESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            E EPGTCKDREIMRHDPHKL+EGCL+AG GM A+AAYIYIRGE+ NE  NL+ A
Sbjct  123  EGEPGTCKDREIMRHDPHKLIEGCLVAGRGMGARAAYIYIRGEFYNESSNLQVA  176



>ref|XP_004541258.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Maylandia zebra]
 ref|XP_005732102.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Pundamilia nyererei]
 ref|XP_005946692.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Haplochromis burtoni]
Length=472

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ   P    +KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQQVKP----KKTIFGPLSDQDRIFTNLYGRHDWRLKGALK  63

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNAD  630
            RGDWY+TK+++LKG DWI+NEVK SGLRGRGGAGFP+G+KWSFM K SDGRP YLVVNAD
Sbjct  64   RGDWYKTKEIILKGQDWILNEVKISGLRGRGGAGFPTGMKWSFMNKPSDGRPKYLVVNAD  123

Query  631  ESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            E EPGTCKDREIMRHDPHKL+EGCL+AG GM A+AAYIYIRGE+ NE  NL+ A
Sbjct  124  EGEPGTCKDREIMRHDPHKLIEGCLVAGRGMGARAAYIYIRGEFYNESSNLQVA  177



>ref|XP_004541259.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Maylandia zebra]
 ref|XP_005732103.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Pundamilia nyererei]
 ref|XP_005946693.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Haplochromis burtoni]
Length=471

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ       P+KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQ-----VKPKKTIFGPLSDQDRIFTNLYGRHDWRLKGALK  62

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNAD  630
            RGDWY+TK+++LKG DWI+NEVK SGLRGRGGAGFP+G+KWSFM K SDGRP YLVVNAD
Sbjct  63   RGDWYKTKEIILKGQDWILNEVKISGLRGRGGAGFPTGMKWSFMNKPSDGRPKYLVVNAD  122

Query  631  ESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            E EPGTCKDREIMRHDPHKL+EGCL+AG GM A+AAYIYIRGE+ NE  NL+ A
Sbjct  123  EGEPGTCKDREIMRHDPHKLIEGCLVAGRGMGARAAYIYIRGEFYNESSNLQVA  176



>gb|EFA77854.1| ubiquinone oxidoreductase [Polysphondylium pallidum PN500]
Length=481

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = +1

Query  307  AASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVL  486
            AA+   TPQ        +   +GGLKD+DRIFTN+YG HD +LKGA KRGDWYRTKD++ 
Sbjct  32   AAAGGPTPQQQVQNASIKT--YGGLKDQDRIFTNLYGEHDVYLKGAEKRGDWYRTKDIIG  89

Query  487  KGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREI  666
            KG DWI+ E+  SGLRGRGGAGFPSGLKWSFMPK S GRP YLV+NADE EPGTCKDREI
Sbjct  90   KGKDWILKEMMASGLRGRGGAGFPSGLKWSFMPKQSTGRPQYLVINADEGEPGTCKDREI  149

Query  667  MRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            MRHDPHKL+EGCLIAG  MRA AAYIYIRGE+ +E K LEKA
Sbjct  150  MRHDPHKLIEGCLIAGFAMRACAAYIYIRGEFHHEAKVLEKA  191



>ref|XP_007439249.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Python bivittatus]
Length=466

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KTHFG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+NE+K SGLRG
Sbjct  31   KKTHFGPLKDEDRIFTNLYGRHDWKLKGALSRGDWYKTKEILLKGIDWILNEIKISGLRG  90

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG 
Sbjct  91   RGGAGFPTGLKWSFMNKPPDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLIEGCLVAGR  150

Query  718  GMRAQAAYIYIRGEYVNERKNLEKARK  798
             M A+AAYIYIRGE+ NE  NL+ A K
Sbjct  151  SMGARAAYIYIRGEFYNEASNLQVAIK  177



>gb|AGM32801.1| NADH-ubiquinone oxidoreductase, partial [Coptotermes formosanus]
Length=299

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            K+ FG L D+DRI TN+YG HD  LKGA+KRGDWY+TK+++LKG+DWI+NE+K SGLRGR
Sbjct  38   KSKFGPLHDDDRISTNLYGRHDWRLKGALKRGDWYKTKEILLKGSDWIINEIKASGLRGR  97

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFPSGLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG  
Sbjct  98   GGAGFPSGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGRS  157

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M AQAAYIYIRGE+ NE  N++ A
Sbjct  158  MGAQAAYIYIRGEFYNEASNMQVA  181



>ref|XP_010103203.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Morus notabilis]
 gb|EXB94989.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Morus notabilis]
Length=408

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  445  IKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVN  624
            +KRGDWYRTKDLVLKG DWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVN
Sbjct  1    MKRGDWYRTKDLVLKGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVN  60

Query  625  ADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            ADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNERKNLE+ARK
Sbjct  61   ADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYVNERKNLERARK  118



>gb|ABY55757.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Drosophila silvestris]
Length=222

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA KRGDWY+TK++VLKG +WI+NEVK SGLRGRGGA
Sbjct  46   FGPLADEDRIFTNLYGRHDWRLKGAQKRGDWYKTKEIVLKGPEWIINEVKTSGLRGRGGA  105

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDR+IMRHDPHKL+EGCLIAG  M A
Sbjct  106  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDRDIMRHDPHKLVEGCLIAGRAMGA  165

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  166  QAAYIYIRGEFYNEASNMQLA  186



>ref|XP_001847747.1| NADH dehydrogenase flavoprotein 1, mitochondrial [Culex quinquefasciatus]
 gb|EDS26851.1| NADH dehydrogenase flavoprotein 1, mitochondrial [Culex quinquefasciatus]
Length=474

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 135/171 (79%), Gaps = 8/171 (5%)
 Frame = +1

Query  280  LNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGD  459
            LN +    QA  TA  PQ+        +T FGGL D+DRIFTN+YG HD  LKGA+KRGD
Sbjct  23   LNKQQVRHQAQLTAPPPQT--------RTTFGGLADQDRIFTNLYGRHDWRLKGALKRGD  74

Query  460  WYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESE  639
            WY+TK+++LKGT+WI+NE K SGLRGRGGAGFP+G+KWSFM K  DGRP YLVVNADE E
Sbjct  75   WYKTKEILLKGTEWIINETKASGLRGRGGAGFPTGMKWSFMNKPGDGRPKYLVVNADEGE  134

Query  640  PGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            PGTCKDREIMRHDPHKL+EGCLIAG  M A+AAYIYIRGE+ NE  N++ A
Sbjct  135  PGTCKDREIMRHDPHKLIEGCLIAGRCMGARAAYIYIRGEFYNEASNMQLA  185



>emb|CEF69460.1| NADH dehydrogenase (Ubiquinone) flavoprotein 1 [Strongyloides 
ratti]
Length=479

 Score =   239 bits (611),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            EKTHFG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK+++LKG DWI+ E+  SGLRG
Sbjct  36   EKTHFGDLSDEDRIFTNLYGKHDYRLKGALKRGDWYKTKEIILKGQDWIIKEISTSGLRG  95

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFPSG+KW FM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAGV
Sbjct  96   RGGAGFPSGMKWGFMKKPFDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLIEGCLIAGV  155

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE   L++A
Sbjct  156  AMGARAAYIYIRGEFYNEACILQEA  180



>gb|AAQ63696.1| NADH:ubiquinone oxidoreductase 51 kD subunit [Chlamydomonas reinhardtii]
Length=484

 Score =   240 bits (612),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT FGGLKDEDRIF N+YG HD  +KGA+ RGDWY TK+++ KG DWI++++KKSGLRGR
Sbjct  50   KTSFGGLKDEDRIFQNIYGRHDLSIKGAMSRGDWYMTKEIIGKGRDWIIDQMKKSGLRGR  109

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFPSGLKWSFMPK SD RP YLVVN DESEPGTCKDREIMRH+PHKL+EGCL+AGV 
Sbjct  110  GGAGFPSGLKWSFMPKASDSRPIYLVVNGDESEPGTCKDREIMRHEPHKLVEGCLMAGVA  169

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M A+A YIYIRGE+V ER+ +E+A
Sbjct  170  MGARAGYIYIRGEFVQERRAVERA  193



>ref|XP_002038046.1| GM17964 [Drosophila sechellia]
 gb|EDW54464.1| GM17964 [Drosophila sechellia]
Length=435

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K SGLRGRGGA
Sbjct  36   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTSGLRGRGGA  95

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  96   GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  155

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  156  QAAYIYIRGEFYNEASNMQLA  176



>gb|ADI40704.1| NADH dehydrogenase flavoprotein 1, 51kDa [Cynopterus sphinx]
 gb|ADI40705.1| NADH dehydrogenase flavoprotein 1, 51kDa [Rousettus leschenaultii]
Length=275

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  8    KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKASGLRG  67

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  68   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  127

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  128  AMGARAAYIYIRGEFYNEASNLQVA  152



>ref|XP_003941287.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial, 
partial [Saimiri boliviensis boliviensis]
Length=358

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_005063380.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Mesocricetus auratus]
Length=263

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>gb|ETE69752.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Ophiophagus hannah]
Length=465

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+NE+K SGLRG
Sbjct  31   KKTQFGPLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGVDWILNEIKTSGLRG  90

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG 
Sbjct  91   RGGAGFPTGLKWSFMNKPPDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLIEGCLVAGR  150

Query  718  GMRAQAAYIYIRGEYVNERKNLEKARK  798
             M A+AAYIYIRGE+ NE  NL+ A K
Sbjct  151  SMGARAAYIYIRGEFYNEASNLQVAIK  177



>ref|XP_005864550.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Myotis brandtii]
Length=466

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +1

Query  304  QAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLV  483
            +A S+A  P        P+KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++
Sbjct  12   KAQSSAGPPDPLCLQTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEIL  71

Query  484  LKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDRE  663
            LKG DWI+ E+K SGLRGRGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDRE
Sbjct  72   LKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDRE  131

Query  664  IMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            IMRHDPHKL+EGCL+ G  M A+AAYIYIRGE+ NE  NL+ A
Sbjct  132  IMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVA  174



>gb|ADI40702.1| NADH dehydrogenase flavoprotein 1, 51kDa [Scotophilus kuhlii]
Length=275

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  8    KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  67

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  68   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  127

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  128  AMGARAAYIYIRGEFYNEASNLQVA  152



>ref|XP_006399352.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
 gb|ESQ40805.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
Length=407

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  445  IKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVN  624
            +KRGDW+RTKDLVLKGTDWIVNE+KKSGLRGRGGAGFPSGLKWSFMPK SDGRPSYLVVN
Sbjct  1    MKRGDWHRTKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVN  60

Query  625  ADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKARK  798
            ADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA AAYIYIRGEYVNER NLEKAR+
Sbjct  61   ADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARR  118



>gb|ADI40703.1| NADH dehydrogenase flavoprotein 1, 51kDa [Miniopterus schreibersii]
Length=275

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  8    KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  67

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  68   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  127

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  128  AMGARAAYIYIRGEFYNEASNLQVA  152



>dbj|GAM25560.1| hypothetical protein SAMD00019534_087350, partial [Acytostelium 
subglobosum LB1]
Length=492

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            +GGLKD+DRIFTN+YG HD +LKGA++RGDWYRTKD++ KG DWI+ E+  SGLRGRGGA
Sbjct  62   YGGLKDKDRIFTNLYGEHDVYLKGAMQRGDWYRTKDIINKGVDWILKEMMASGLRGRGGA  121

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSGLKWSFMPK S GRP YLV+NADE EPGTCKDREIMRHDPHKL+EGCLIAG  MRA
Sbjct  122  GFPSGLKWSFMPKVSTGRPQYLVINADEGEPGTCKDREIMRHDPHKLIEGCLIAGFAMRA  181

Query  730  QAAYIYIRGEYVNERKNLEKA  792
             AAYIYIRGE+  E K LE+A
Sbjct  182  CAAYIYIRGEFHYEAKVLERA  202



>gb|KFH71991.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Mortierella verticillata NRRL 6337]
Length=473

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            +T FG LKDEDRIFTN+YG HD  LKGA+KRGDWY+TK+++LKG DWI++E+K SGLRGR
Sbjct  41   RTSFGSLKDEDRIFTNIYGFHDYKLKGALKRGDWYKTKEILLKGHDWILDEMKASGLRGR  100

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFPSGLKWSFM K SDGRP YLVVNADE EPGTCKDREIMR DPHKL+EGCL+AG  
Sbjct  101  GGAGFPSGLKWSFMNKPSDGRPRYLVVNADEGEPGTCKDREIMRGDPHKLIEGCLVAGRA  160

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M A AAYIYIRGE+ NE  NL+ A
Sbjct  161  MNANAAYIYIRGEFYNEASNLQVA  184



>ref|XP_001969499.1| GG10139 [Drosophila erecta]
 gb|EDV58558.1| GG10139 [Drosophila erecta]
Length=474

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K SGLRGRGGA
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGAMKRGDWYKTKEIVLKGADWIVNEIKTSGLRGRGGA  106

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  107  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  166

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  167  QAAYIYIRGEFYNEASNMQLA  187



>ref|NP_608987.1| CG9140, isoform A [Drosophila melanogaster]
 ref|NP_001285657.1| CG9140, isoform B [Drosophila melanogaster]
 gb|AAF52334.1| CG9140, isoform A [Drosophila melanogaster]
 gb|AAK93066.1| GM14163p [Drosophila melanogaster]
 gb|ACL85431.1| CG9140-PA, partial [synthetic construct]
 gb|ACL90279.1| CG9140-PA [synthetic construct]
 gb|AHN54172.1| CG9140, isoform B [Drosophila melanogaster]
Length=474

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K SGLRGRGGA
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTSGLRGRGGA  106

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  107  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  166

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  167  QAAYIYIRGEFYNEASNMQLA  187



>ref|XP_002089130.1| GE18950 [Drosophila yakuba]
 gb|EDW88842.1| GE18950 [Drosophila yakuba]
Length=474

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K SGLRGRGGA
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTSGLRGRGGA  106

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  107  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  166

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  167  QAAYIYIRGEFYNEASNMQLA  187



>gb|ETN68323.1| NADH oxidoreductase, F subunit [Necator americanus]
Length=469

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            EKT FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TKD++LKG++WI+NEV+ SGLRG
Sbjct  27   EKTSFGNLKDSDRIFTNLYGRHDYHLKGALARGDWYKTKDIILKGSEWIINEVRTSGLRG  86

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+G+KW FM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAGV
Sbjct  87   RGGAGFPAGMKWGFMNKPFDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLIEGCLIAGV  146

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE   L++A
Sbjct  147  AMGARAAYIYIRGEFYNEACILQEA  171



>ref|XP_011204925.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Bactrocera dorsalis]
Length=474

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT FG L D+DRIFTN+YG HD  LKGA+KRGDW+RTK+++LKG+DWI+NE+K SGLRGR
Sbjct  44   KTKFGPLADQDRIFTNLYGRHDWRLKGALKRGDWHRTKEIILKGSDWIINELKTSGLRGR  103

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFPSG+KWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG  
Sbjct  104  GGAGFPSGMKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGKA  163

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M A+AAYIYIRGE+ NE  N++ A
Sbjct  164  MGARAAYIYIRGEFYNEASNMQLA  187



>ref|XP_011204917.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Bactrocera dorsalis]
Length=479

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT FG L D+DRIFTN+YG HD  LKGA+KRGDW+RTK+++LKG+DWI+NE+K SGLRGR
Sbjct  49   KTKFGPLADQDRIFTNLYGRHDWRLKGALKRGDWHRTKEIILKGSDWIINELKTSGLRGR  108

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFPSG+KWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG  
Sbjct  109  GGAGFPSGMKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGKA  168

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M A+AAYIYIRGE+ NE  N++ A
Sbjct  169  MGARAAYIYIRGEFYNEASNMQLA  192



>ref|XP_005333391.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Ictidomys tridecemlineatus]
Length=494

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +1

Query  313  STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKG  492
            S+A +P +  P   P+KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG
Sbjct  43   SSAGSPDTGSPQTAPKKTTFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKG  102

Query  493  TDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMR  672
             DWI+ E+K SGLRGRGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMR
Sbjct  103  PDWILGEIKASGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMR  162

Query  673  HDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            HDPHKL+EGCL+ G  M A+AAYIYIRGE+ NE  NL+ A
Sbjct  163  HDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVA  202



>gb|EMP26020.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Chelonia mydas]
Length=583

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+NE+K SGLRG
Sbjct  148  KKTQFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGIDWILNEIKTSGLRG  207

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG 
Sbjct  208  RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGR  267

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  268  SMGARAAYIYIRGEFYNEASNLQVA  292



>ref|XP_004366877.1| ubiquinone oxidoreductase [Dictyostelium fasciculatum]
 gb|EGG19894.1| ubiquinone oxidoreductase [Dictyostelium fasciculatum]
Length=473

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            +GGLKD+DRIFTN+YG HD +LKGAI RGDWYRTKDL+ KG DWI+ E+  SGLRGRGGA
Sbjct  43   YGGLKDKDRIFTNLYGEHDVYLKGAIARGDWYRTKDLIGKGKDWIIKEMMASGLRGRGGA  102

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSGLKWSFMPK S GRP YLV+NADE EPGTCKDREIMRHDPHKL+EGCL+AG  MRA
Sbjct  103  GFPSGLKWSFMPKQSTGRPQYLVINADEGEPGTCKDREIMRHDPHKLIEGCLVAGFAMRA  162

Query  730  QAAYIYIRGEYVNERKNLEKA  792
             AAYIYIRGE+  E K +E+A
Sbjct  163  CAAYIYIRGEFHLEAKVMEQA  183



>emb|CDW52647.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Trichuris trichiura]
Length=481

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG++WI+ EVK+SGLRG
Sbjct  38   QKTTFGPLKDEDRIFTNLYGRHDWKLKGALSRGDWYKTKEILLKGSEWIIQEVKESGLRG  97

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+G+KWSFM K  DGRP YLV+NADE EPGTCKDREIMRHDPHKLLEGCLIAG 
Sbjct  98   RGGAGFPAGMKWSFMCKPHDGRPRYLVINADEGEPGTCKDREIMRHDPHKLLEGCLIAGS  157

Query  718  GMRAQAAYIYIRGEYVNERKNLEKARK  798
             M A+AAYIYIRGE+ NE  NL+ A K
Sbjct  158  AMGARAAYIYIRGEFYNESINLQMAIK  184



>ref|XP_007505720.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Monodelphis domestica]
Length=370

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 131/166 (79%), Gaps = 10/166 (6%)
 Frame = +1

Query  295  YSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTK  474
            +++Q A TA+           +K  FG LKDEDRIFTN+YG H+  LKGA  RGDWY+TK
Sbjct  19   FTSQEAGTASP----------KKVTFGSLKDEDRIFTNLYGRHEWRLKGAQSRGDWYKTK  68

Query  475  DLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCK  654
            +++LKG DWI+NE+K SGLRGRGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCK
Sbjct  69   EILLKGPDWILNEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCK  128

Query  655  DREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            DREIMRHDPHKL+EGCLI G  M A+AAYIYIRGE+ NE  NL+ A
Sbjct  129  DREIMRHDPHKLVEGCLIGGRAMGARAAYIYIRGEFYNEASNLQVA  174



>gb|KFD48778.1| hypothetical protein M513_10333 [Trichuris suis]
 gb|KFD69329.1| hypothetical protein M514_10333 [Trichuris suis]
 gb|KHJ41823.1| NADH oxidoreductase, F subunit [Trichuris suis]
Length=477

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG++WI+ EVK+SGLRG
Sbjct  34   QKTTFGPLKDEDRIFTNLYGRHDWKLKGALSRGDWYKTKEILLKGSEWIIREVKESGLRG  93

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+G+KWSFM K  DGRP YLV+NADE EPGTCKDREIMRHDPHKLLEGCLIAG 
Sbjct  94   RGGAGFPAGMKWSFMCKPHDGRPRYLVINADEGEPGTCKDREIMRHDPHKLLEGCLIAGS  153

Query  718  GMRAQAAYIYIRGEYVNERKNLEKARK  798
             M A+AAYIYIRGE+ NE  NL+ A K
Sbjct  154  AMGARAAYIYIRGEFYNESINLQMAIK  180



>ref|XP_005702818.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Galdieria sulphuraria]
 gb|EME26298.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Galdieria sulphuraria]
Length=491

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FGGL+D+DRIFTN+YG  D  +KGA KRGDWY TKDLVLKG DW++NE+K SGLRGRGGA
Sbjct  48   FGGLQDKDRIFTNLYGELDWTIKGAEKRGDWYATKDLVLKGRDWLINEIKASGLRGRGGA  107

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSGLK+SFMPK SDGRP+YLVVNADESEPGTCKDREIMR+DPHKL+EGCL+ G  M A
Sbjct  108  GFPSGLKYSFMPKVSDGRPNYLVVNADESEPGTCKDREIMRNDPHKLVEGCLLVGRAMGA  167

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            +AAYIYIRGEYV+ERK LE A
Sbjct  168  RAAYIYIRGEYVHERKRLEHA  188



>gb|KJH48793.1| NADH oxidoreductase, F subunit [Dictyocaulus viviparus]
Length=477

 Score =   237 bits (605),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            EK+ FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG+DWI++EV+KSGLRG
Sbjct  35   EKSSFGNLKDSDRIFTNLYGRHDYHLKGALARGDWYKTKEIILKGSDWIIDEVRKSGLRG  94

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+G+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAGV
Sbjct  95   RGGAGFPAGMKWSFMKKPFDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLIEGCLIAGV  154

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE   L++ 
Sbjct  155  AMGARAAYIYIRGEFYNEACILQEV  179



>gb|ACO10172.1| NADH dehydrogenase flavoprotein 1, mitochondrial precursor [Osmerus 
mordax]
Length=472

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG L D+DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+NE+K SGLRG
Sbjct  39   KKTTFGPLSDQDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGVDWIINEIKSSGLRG  98

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+G+KWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG 
Sbjct  99   RGGAGFPTGMKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGR  158

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  159  CMGARAAYIYIRGEFYNESSNLQVA  183



>ref|XP_008145081.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Eptesicus fuscus]
Length=455

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEVKASGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_008145080.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Eptesicus fuscus]
Length=464

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEVKASGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_002065333.1| GK15392 [Drosophila willistoni]
 gb|EDW76319.1| GK15392 [Drosophila willistoni]
Length=478

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWI+NE+K SGLRGRGGA
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGPDWIINEIKTSGLRGRGGA  106

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDR+IMRHDPHKL+EGCLIAG  M A
Sbjct  107  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDRDIMRHDPHKLVEGCLIAGRAMGA  166

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  167  QAAYIYIRGEFYNEASNMQLA  187



>gb|KDR18342.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Zootermopsis nevadensis]
Length=472

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT FG L D DRIFTN+YG  D  LKGA+KRGDWY+TK+++LKG+DWI+NE+K SGLRGR
Sbjct  38   KTKFGPLHDNDRIFTNLYGRFDWRLKGALKRGDWYKTKEILLKGSDWIINEIKTSGLRGR  97

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFPSG+KWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG  
Sbjct  98   GGAGFPSGMKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGRA  157

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M AQAAYIYIRGE+ NE  N++ A
Sbjct  158  MGAQAAYIYIRGEFYNEASNMQLA  181



>ref|XP_003774247.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial, 
partial [Sarcophilus harrisii]
Length=438

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  3    KKTTFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  62

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLI G 
Sbjct  63   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIGGR  122

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  123  AMGARAAYIYIRGEFYNEASNLQVA  147



>ref|XP_002755638.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Callithrix jacchus]
Length=464

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>emb|CAH65683.1| NADH-quinone oxidoreductase [Nilaparvata lugens]
Length=462

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT +G L D DRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG D+I+NEVK SGLRGR
Sbjct  37   KTKYGPLNDSDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADFIINEVKASGLRGR  96

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFPSGLKWSFM K SDGRP YL VNADE EPGTCKDREIMRHDPHKL+EGCLIAG  
Sbjct  97   GGAGFPSGLKWSFMNKPSDGRPKYLCVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRA  156

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M AQAAYIYIRGE+ NE  N++ A
Sbjct  157  MGAQAAYIYIRGEFYNEASNMQVA  180



>ref|XP_003419441.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Loxodonta africana]
Length=464

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  SMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_002051457.1| GJ12140 [Drosophila virilis]
 gb|EDW63612.1| GJ12140 [Drosophila virilis]
Length=476

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA KRGDWY+TK++VLKG DWI+NE+K SGLRGRGGA
Sbjct  46   FGPLADEDRIFTNLYGRHDWRLKGAQKRGDWYKTKEIVLKGPDWIINEIKTSGLRGRGGA  105

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  106  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  165

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  166  QAAYIYIRGEFYNEASNMQLA  186



>ref|NP_001164305.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Tribolium castaneum]
 gb|EFA04664.1| hypothetical protein TcasGA2_TC014119 [Tribolium castaneum]
Length=478

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK+++LKG+DWI+NE+K SGLRGRGGA
Sbjct  47   FGPLSDEDRIFTNLYGKHDWRLKGALKRGDWYKTKEILLKGSDWIINEIKTSGLRGRGGA  106

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  107  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  166

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            +AAYIYIRGE+ NE  N++ A
Sbjct  167  KAAYIYIRGEFYNEASNMQVA  187



>ref|XP_001962320.1| GF15407 [Drosophila ananassae]
 gb|EDV31541.1| GF15407 [Drosophila ananassae]
Length=477

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA KRGDWY+TK++VLKG DWI+NE+K SGLRGRGGA
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGAQKRGDWYKTKEIVLKGPDWIINEIKTSGLRGRGGA  106

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  107  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  166

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  167  QAAYIYIRGEFYNEASNMQLA  187



>ref|XP_002002293.1| GI13499 [Drosophila mojavensis]
 gb|EDW11735.1| GI13499 [Drosophila mojavensis]
Length=476

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA KRGDWY+TK++VLKG DWI+NE+K SGLRGRGGA
Sbjct  46   FGPLADEDRIFTNLYGRHDWRLKGAQKRGDWYKTKEIVLKGPDWIINEIKTSGLRGRGGA  105

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  M A
Sbjct  106  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGA  165

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  166  QAAYIYIRGEFYNEASNMQLA  186



>ref|XP_008282052.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Stegastes partitus]
Length=472

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 141/191 (74%), Gaps = 10/191 (5%)
 Frame = +1

Query  226  LLSLQRTAL--VQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRI  399
            +LSL R  +  V R        G     +  STA +P         +KT +G L DEDRI
Sbjct  1    MLSLSRAVVSGVARAPAAVSPGGVTALTRFNSTAQSPP--------KKTTYGPLADEDRI  52

Query  400  FTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSF  579
            FTN+YG HD  LKGA+KRGDWY+TK+++LKG DWI+NE+K SGLRGRGGAGFP+G+KWSF
Sbjct  53   FTNLYGRHDWRLKGALKRGDWYKTKEILLKGVDWILNEIKVSGLRGRGGAGFPTGMKWSF  112

Query  580  MPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGE  759
            M K SDGRP YLVVNADE EPGTCKDREIMR+DPHKL+EGCL+AG  M A+AAYIYIRGE
Sbjct  113  MNKPSDGRPKYLVVNADEGEPGTCKDREIMRNDPHKLVEGCLVAGKAMGARAAYIYIRGE  172

Query  760  YVNERKNLEKA  792
            + NE  NL+ A
Sbjct  173  FYNESSNLQVA  183



>ref|XP_008048441.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Tarsius syrichta]
Length=464

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_002631183.1| C. briggsae CBR-NUO-1 protein [Caenorhabditis briggsae]
 emb|CAP23643.1| Protein CBR-NUO-1 [Caenorhabditis briggsae]
Length=479

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  301  AQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDL  480
             ++A  ANTP         EKT FG LKD DRIFTN+YG HD  LKGA  RGDWY+TK++
Sbjct  26   VKSAQNANTPAKQ------EKTSFGNLKDSDRIFTNLYGRHDYRLKGAQARGDWYKTKEI  79

Query  481  VLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDR  660
            +LKG+DWI+ E+K SGLRGRGGAGFPSG+KW FM K  DGRP YLVVNADE EPGTCKDR
Sbjct  80   ILKGSDWILGELKTSGLRGRGGAGFPSGMKWGFMNKPFDGRPKYLVVNADEGEPGTCKDR  139

Query  661  EIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            EIMRHDPHKL+EGCLI GV M A+AAYIYIRGE+ NE   L++A
Sbjct  140  EIMRHDPHKLIEGCLIGGVAMGARAAYIYIRGEFYNEACILQEA  183



>ref|XP_007518737.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Erinaceus europaeus]
Length=455

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI++EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILSEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_007518736.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Erinaceus europaeus]
Length=464

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI++EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILSEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|NP_598427.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
precursor [Mus musculus]
 sp|Q91YT0.1|NDUV1_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH-ubiquinone oxidoreductase 51 kDa subunit; 
Flags: Precursor [Mus musculus]
 gb|AAH14818.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Mus musculus]
 dbj|BAC35893.1| unnamed protein product [Mus musculus]
 gb|AAH41682.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Mus musculus]
 gb|EDL32990.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, isoform CRA_b 
[Mus musculus]
Length=464

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA++RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALRRGDWYKTKEILLKGPDWILGEMKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_003798357.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Otolemur garnettii]
Length=464

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_011379926.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Pteropus vampyrus]
Length=421

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKASGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_636489.1| ubiquinone oxidoreductase [Dictyostelium discoideum AX4]
 sp|Q54I90.1|NDUV1_DICDI RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH-ubiquinone oxidoreductase 51 kDa subunit; 
Flags: Precursor [Dictyostelium discoideum]
 gb|EAL62961.1| ubiquinone oxidoreductase [Dictyostelium discoideum AX4]
Length=479

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = +1

Query  238  QRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYG  417
             R   V + +   GL G+ + A   +T +T Q            +GGLKD+DRIFTN+YG
Sbjct  6    NRVKSVIKLTSTTGLTGKDFQATKVATFSTAQVQQAQENVRS--YGGLKDKDRIFTNLYG  63

Query  418  LHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPK-TS  594
             HD +LKGAI RGDWY+TK+++ KG DWI+ E+  SGLRGRGGAGFPSGLKWSFMPK TS
Sbjct  64   EHDVYLKGAIARGDWYKTKNIIDKGKDWILKEMMASGLRGRGGAGFPSGLKWSFMPKTTS  123

Query  595  DGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNER  774
              RP YLV+NADE EPGTCKDREIMRHDPHKL+EGCL+AG  MRA AAYIYIRGE+  E 
Sbjct  124  KDRPQYLVINADEGEPGTCKDREIMRHDPHKLIEGCLLAGFAMRACAAYIYIRGEFHYEA  183

Query  775  KNLEKA  792
            K LE+A
Sbjct  184  KVLEQA  189



>ref|XP_004759596.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Mustela putorius furo]
 ref|XP_004808426.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Mustela putorius furo]
Length=455

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_004759595.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Mustela putorius furo]
 ref|XP_004808425.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Mustela putorius furo]
Length=464

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>gb|EGT44910.1| CBN-NUO-1 protein [Caenorhabditis brenneri]
Length=479

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = +1

Query  316  TANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGT  495
               + Q+       EKT FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG+
Sbjct  25   VVTSAQNANAQVKQEKTSFGNLKDSDRIFTNLYGRHDYRLKGALSRGDWYKTKEIILKGS  84

Query  496  DWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRH  675
            DWI+ E+K SGLRGRGGAGFPSG+KW FM K  DGRP YLVVNADE EPGTCKDREIMRH
Sbjct  85   DWILGELKTSGLRGRGGAGFPSGMKWGFMNKPFDGRPKYLVVNADEGEPGTCKDREIMRH  144

Query  676  DPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            DPHKL+EGCLI GV M A+AAYIYIRGE+ NE   L++A
Sbjct  145  DPHKLIEGCLIGGVAMGARAAYIYIRGEFYNEACILQEA  183



>ref|XP_004393884.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 2 [Odobenus rosmarus divergens]
Length=455

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_006743665.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Leptonychotes weddellii]
Length=464

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>emb|CDJ87526.1| unnamed protein product [Haemonchus contortus]
Length=513

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            EKT FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG++WI+NEV+KSGLRG
Sbjct  69   EKTTFGNLKDTDRIFTNLYGRHDYRLKGALARGDWYKTKEIILKGSEWIINEVRKSGLRG  128

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+G+KW FM K  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAGV
Sbjct  129  RGGAGFPAGMKWGFMSKPFDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLIEGCLIAGV  188

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE   L++ 
Sbjct  189  AMGARAAYIYIRGEFYNESCILQEV  213



>ref|XP_004393883.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 1 [Odobenus rosmarus divergens]
Length=464

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>gb|EFB28979.1| hypothetical protein PANDA_010233, partial [Ailuropoda melanoleuca]
Length=440

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  4    KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  63

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  64   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  123

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  124  AMGARAAYIYIRGEFYNEASNLQVA  148



>ref|XP_006743666.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Leptonychotes weddellii]
Length=455

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_864381.2| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 7 [Canis lupus familiaris]
Length=455

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_851761.2| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 2 [Canis lupus familiaris]
Length=464

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_008707306.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Ursus maritimus]
Length=464

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_011379925.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Pteropus vampyrus]
Length=464

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKASGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_011225862.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Ailuropoda melanoleuca]
Length=465

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  29   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  88

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  89   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  148

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  149  AMGARAAYIYIRGEFYNEASNLQVA  173



>ref|XP_004682622.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Condylura cristata]
Length=454

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKASGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_007505721.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Monodelphis domestica]
Length=454

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 131/166 (79%), Gaps = 10/166 (6%)
 Frame = +1

Query  295  YSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTK  474
            +++Q A TA+           +K  FG LKDEDRIFTN+YG H+  LKGA  RGDWY+TK
Sbjct  19   FTSQEAGTASP----------KKVTFGSLKDEDRIFTNLYGRHEWRLKGAQSRGDWYKTK  68

Query  475  DLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCK  654
            +++LKG DWI+NE+K SGLRGRGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCK
Sbjct  69   EILLKGPDWILNEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCK  128

Query  655  DREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNERKNLEKA  792
            DREIMRHDPHKL+EGCLI G  M A+AAYIYIRGE+ NE  NL+ A
Sbjct  129  DREIMRHDPHKLVEGCLIGGRAMGARAAYIYIRGEFYNEASNLQVA  174



>ref|XP_004682621.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Condylura cristata]
Length=463

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKASGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>gb|AFK11344.1| NADH dehydrogenase ubiquinone flavoprotein 1 precursor [Callorhinchus 
milii]
Length=465

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT +G L D DRIFTN+YGLHD  LKGA+ RGDWY+TK+++LKG DWI++EVKKSGLRGR
Sbjct  33   KTKYGPLSDSDRIFTNLYGLHDWGLKGALSRGDWYKTKEILLKGVDWILDEVKKSGLRGR  92

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFP+G+KW FM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKLLEGCL+AG  
Sbjct  93   GGAGFPTGMKWGFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLLEGCLVAGRC  152

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M A+AAYIYIRGE+ NE  N++ A
Sbjct  153  MGARAAYIYIRGEFYNESANVQVA  176



>ref|XP_007962396.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Chlorocebus sabaeus]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_006980586.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Peromyscus maniculatus bairdii]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_005598405.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Equus caballus]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>gb|AEE61949.1| unknown [Dendroctonus ponderosae]
 gb|ENN72318.1| hypothetical protein YQE_11061, partial [Dendroctonus ponderosae]
 gb|ERL85747.1| hypothetical protein D910_03162 [Dendroctonus ponderosae]
Length=473

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT FG L DEDR+FTN+YG HD  LKGA+KRGDWY+TK+++LKG+DWIVNE+K SGLRGR
Sbjct  40   KTSFGPLADEDRVFTNLYGRHDWRLKGAMKRGDWYKTKEILLKGSDWIVNELKTSGLRGR  99

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFP+G+KWSFM +  DGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCLIAG  
Sbjct  100  GGAGFPTGMKWSFMNRPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRA  159

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            + A+AAYIYIRGE+ NE  N++ A
Sbjct  160  IGAKAAYIYIRGEFYNEASNMQVA  183



>ref|XP_004329281.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
flavoprotein 1, mitochondrial [Tursiops truncatus]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_007450480.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X3 [Lipotes vexillifer]
 ref|XP_007450481.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X4 [Lipotes vexillifer]
Length=455

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_006893311.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Elephantulus edwardii]
Length=455

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_007171145.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Balaenoptera acutorostrata scammoni]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIY+RGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYVRGEFYNEASNLQVA  172



>ref|XP_001988013.1| GH10936 [Drosophila grimshawi]
 gb|EDW02880.1| GH10936 [Drosophila grimshawi]
Length=476

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGA  549
            FG L DEDRIFTN+YG HD  LKGA KRGDWY+TK++VLKG DWI+NEVK SGLRGRGGA
Sbjct  46   FGPLADEDRIFTNLYGRHDWRLKGAQKRGDWYKTKEIVLKGPDWIINEVKTSGLRGRGGA  105

Query  550  GFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA  729
            GFPSG+KWSFM K  DGRP YLVVNADE EPGTCKDR+IMRHDPHKL+EGCLIAG  M A
Sbjct  106  GFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDRDIMRHDPHKLVEGCLIAGRAMGA  165

Query  730  QAAYIYIRGEYVNERKNLEKA  792
            QAAYIYIRGE+ NE  N++ A
Sbjct  166  QAAYIYIRGEFYNEASNMQLA  186



>emb|CEG66995.1| Putative NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial 
[Rhizopus microsporus]
Length=476

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            KT FG L DEDRIFTN+Y  HD  LKGA+KRGDWY+TK+LVLKG +WI+NE+K+SGLRGR
Sbjct  46   KTTFGSLSDEDRIFTNLYSKHDYRLKGALKRGDWYKTKELVLKGPEWIINEMKESGLRGR  105

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFP+GLKWSFM K +DGRP YLV+NADE EPGTCKDREI+R DPHKL+EGCLIAG  
Sbjct  106  GGAGFPTGLKWSFMNKPADGRPRYLVINADEGEPGTCKDREILRGDPHKLIEGCLIAGSA  165

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M+A AAYIYIRGE+ NE  NL+ A
Sbjct  166  MKANAAYIYIRGEFYNEAANLQTA  189



>ref|XP_007450478.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Lipotes vexillifer]
 ref|XP_007450479.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Lipotes vexillifer]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_001946240.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Acyrthosiphon pisum]
Length=482

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGR  540
            K  +G L D DRIFTN+YG HD  LKGA+KRGDWY+TK++++KGTD+I+NEVK SGLRGR
Sbjct  47   KASYGNLSDSDRIFTNLYGRHDWQLKGALKRGDWYKTKEILIKGTDYIINEVKTSGLRGR  106

Query  541  GGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVG  720
            GGAGFP+G+KWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG  
Sbjct  107  GGAGFPTGMKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLIEGCLVAGRA  166

Query  721  MRAQAAYIYIRGEYVNERKNLEKA  792
            M A AAYIYIRGE+ NE  NL++A
Sbjct  167  MGACAAYIYIRGEFYNEASNLQQA  190



>ref|XP_004278073.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 2 [Orcinus orca]
Length=455

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_004278072.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 1 [Orcinus orca]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_007126990.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Physeter catodon]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_006893310.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Elephantulus edwardii]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_005351696.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Microtus ochrogaster]
Length=464

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_001917609.2| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Equus caballus]
Length=455

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_006771560.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Myotis davidii]
 gb|ELK24257.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Myotis davidii]
Length=464

 Score =   234 bits (597),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_006102550.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Myotis lucifugus]
Length=455

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_006102549.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Myotis lucifugus]
Length=464

 Score =   234 bits (597),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|NP_001266473.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [Gorilla 
gorilla]
 sp|Q0MQI5.1|NDUV1_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH-ubiquinone oxidoreductase 51 kDa subunit; 
Flags: Precursor [Gorilla gorilla gorilla]
 gb|ABH12158.1| mitochondrial complex I subunit NDUFV1 [Gorilla gorilla]
Length=464

 Score =   234 bits (597),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>gb|EPQ06606.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Myotis brandtii]
Length=459

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  23   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  82

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  83   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  142

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  143  AMGARAAYIYIRGEFYNEASNLQVA  167



>gb|ELV09500.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Tupaia chinensis]
Length=460

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|NP_001011491.1| NADH dehydrogenase ubiquinone flavoprotein 1 [Xenopus (Silurana) 
tropicalis]
 gb|AAH88876.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [Xenopus 
(Silurana) tropicalis]
 emb|CAJ83800.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Xenopus (Silurana) 
tropicalis]
Length=468

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +K+ FG L DEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  33   KKSKFGPLSDEDRIFTNLYGRHDWGLKGALSRGDWYKTKEILLKGVDWILGEIKASGLRG  92

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG 
Sbjct  93   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGR  152

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  153  SMGARAAYIYIRGEFYNEASNLQVA  177



>ref|XP_009183769.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Papio anubis]
Length=464

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|NP_001080215.1| NADH dehydrogenase ubiquinone flavoprotein 1 [Xenopus laevis]
 gb|AAH41320.1| Ndufv1 protein [Xenopus laevis]
 gb|AAI06321.1| Ndufv1 protein [Xenopus laevis]
Length=471

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG L DEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI  EVK SGLRG
Sbjct  34   KKTKFGPLSDEDRIFTNLYGRHDWGLKGALSRGDWYKTKEILLKGVDWIQGEVKTSGLRG  93

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+AG 
Sbjct  94   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGR  153

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  154  SMGARAAYIYIRGEFYNEASNLQVA  178



>ref|XP_004713642.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Echinops telfairi]
Length=464

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_011842421.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Mandrillus leucophaeus]
 ref|XP_011896805.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cercocebus atys]
Length=464

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_004713643.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Echinops telfairi]
Length=455

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_004437773.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 2 [Ceratotherium simum simum]
Length=455

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIY+RGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYVRGEFYNEASNLQVA  163



>ref|XP_005384364.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Chinchilla lanigera]
Length=455

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_005351697.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Microtus ochrogaster]
Length=455

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_004437772.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 1 [Ceratotherium simum simum]
Length=464

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIY+RGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYVRGEFYNEASNLQVA  172



>gb|AAB03672.1| ndufv1 [Dictyostelium discoideum]
Length=479

 Score =   234 bits (597),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = +1

Query  238  QRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYG  417
             R   V + +   GL G+ + A   +T +T Q            +GGLKD+DRIFTN+YG
Sbjct  6    NRVKSVIKLTSTTGLTGKNFQATKVATFSTAQVQQAQENVRS--YGGLKDKDRIFTNLYG  63

Query  418  LHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRGRGGAGFPSGLKWSFMPK-TS  594
             HD +LKGAI RGDWY+TK+++ KG DWI+ E+  SGLRGRGGAGFPSGLKWSFMP+ TS
Sbjct  64   EHDVYLKGAIARGDWYKTKNIIDKGKDWILKEMMASGLRGRGGAGFPSGLKWSFMPETTS  123

Query  595  DGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRAQAAYIYIRGEYVNER  774
              RP YLV+NADE EPGTCKDREIMRHDPHKL+EGCL+AG  MRA AAYIYIRGE+  E 
Sbjct  124  KDRPQYLVINADEGEPGTCKDREIMRHDPHKLIEGCLLAGFAMRACAAYIYIRGEFHYEA  183

Query  775  KNLEKA  792
            K LE+A
Sbjct  184  KVLEQA  189



>dbj|BAE90673.1| unnamed protein product [Macaca fascicularis]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_005384363.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Chinchilla lanigera]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_003509972.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cricetulus griseus]
 ref|XP_007624705.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cricetulus griseus]
 gb|EGW12368.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cricetulus griseus]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKASGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>gb|EAW74654.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa, isoform 
CRA_c [Homo sapiens]
Length=457

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKG++ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  21   KKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRG  80

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKLLEGCL+ G 
Sbjct  81   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGR  140

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  141  AMGARAAYIYIRGEFYNEASNLQVA  165



>gb|EHH56026.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Macaca fascicularis]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|NP_001274202.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [Macaca 
fascicularis]
 dbj|BAF93481.1| NADH dehydrogenase flavoprotein 1 [Macaca fascicularis]
 gb|EHH22618.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Macaca mulatta]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_011842422.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Mandrillus leucophaeus]
Length=455

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_006171329.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Tupaia chinensis]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_007942874.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Orycteropus afer afer]
Length=455

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIY+RGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYVRGEFYNEASNLQVA  163



>ref|XP_004383708.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 2 [Trichechus manatus latirostris]
Length=455

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>ref|XP_006861118.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Chrysochloris asiatica]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>emb|CAA76757.1| NADH:ubiquinone oxidoreductase 51-kD subunit [Homo sapiens]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKG++ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKLLEGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>sp|Q8HXQ9.1|NDUV1_MACFA RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH-ubiquinone oxidoreductase 51 kDa subunit; 
Flags: Precursor [Macaca fascicularis]
 dbj|BAC20599.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Macaca fascicularis]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_010364628.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Rhinopithecus roxellana]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_008580125.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Galeopterus variegatus]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|NP_009034.2| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 1 precursor [Homo sapiens]
 sp|P49821.4|NDUV1_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH dehydrogenase flavoprotein 1; AltName: Full=NADH-ubiquinone 
oxidoreductase 51 kDa subunit; Flags: Precursor 
[Homo sapiens]
 gb|AAC39722.1| NADH:ubiquinone dehydrogenase 51 kDa subunit [Homo sapiens]
 gb|AAC39750.1| NADH:ubiquinone dehydrogenase 51 kDa subunit [Homo sapiens]
 gb|AAD40373.1| 51kDa subunit of NADH dehydrogenase [Homo sapiens]
 gb|AAH15645.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [Homo sapiens]
 emb|CAG33020.1| NDUFV1 [Homo sapiens]
 gb|EAW74655.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa, isoform 
CRA_d [Homo sapiens]
 gb|EAW74656.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa, isoform 
CRA_d [Homo sapiens]
 gb|ABM84162.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [synthetic 
construct]
 gb|ABM87565.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [synthetic 
construct]
 dbj|BAJ20404.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [synthetic 
construct]
 gb|ADP90734.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90735.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90736.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90737.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90738.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90739.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90740.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90741.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90742.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90743.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90744.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90745.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90746.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90747.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90748.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90749.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90750.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90751.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90752.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90753.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90754.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90755.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90756.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90757.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90758.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90759.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90760.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90761.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90762.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90763.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90764.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90765.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90766.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90767.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90768.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90769.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90770.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90771.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90772.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|ADP90773.1| mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1 [Homo 
sapiens]
 gb|AIC49268.1| NDUFV1, partial [synthetic construct]
Length=464

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKG++ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKLLEGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|NP_001159574.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 2 precursor [Homo sapiens]
 gb|AAH08146.1| NDUFV1 protein [Homo sapiens]
 gb|EAW74652.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa, isoform 
CRA_a [Homo sapiens]
 gb|AIC63086.1| NDUFV1, partial [synthetic construct]
Length=455

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKG++ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKLLEGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



>dbj|BAD96781.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa variant 
[Homo sapiens]
Length=464

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKG++ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKLLEGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_004383707.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform 1 [Trichechus manatus latirostris]
Length=464

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTSGLRG  87

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREIMRHDPHKL+EGCL+ G 
Sbjct  88   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGR  147

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  148  AMGARAAYIYIRGEFYNEASNLQVA  172



>ref|XP_005577102.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Macaca fascicularis]
Length=455

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKSGLRG  537
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K SGLRG
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTSGLRG  78

Query  538  RGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV  717
            RGGAGFP+GLKWSFM K SDGRP YLVVNADE EPGTCKDREI+RHDPHKL+EGCL+ G 
Sbjct  79   RGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGR  138

Query  718  GMRAQAAYIYIRGEYVNERKNLEKA  792
             M A+AAYIYIRGE+ NE  NL+ A
Sbjct  139  AMGARAAYIYIRGEFYNEASNLQVA  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876