BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1699

Length=596
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629303.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     234   2e-72   Nicotiana tomentosiformis
ref|XP_009763526.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     231   4e-71   Nicotiana sylvestris
ref|XP_004244106.2|  PREDICTED: GDSL esterase/lipase At5g55050-li...    219   2e-66   Solanum lycopersicum
ref|XP_006346204.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     211   1e-63   
ref|XP_006346261.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     209   1e-62   Solanum tuberosum [potatoes]
emb|CDP05729.1|  unnamed protein product                                208   5e-62   Coffea canephora [robusta coffee]
ref|XP_009629304.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     204   7e-61   Nicotiana tomentosiformis
ref|XP_009786554.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     202   4e-60   Nicotiana sylvestris
ref|XP_004244348.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     202   1e-59   Solanum lycopersicum
ref|XP_010929638.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     200   5e-59   Elaeis guineensis
ref|XP_008804293.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     199   1e-58   Phoenix dactylifera
gb|EYU27351.1|  hypothetical protein MIMGU_mgv1a008471mg                195   7e-57   Erythranthe guttata [common monkey flower]
ref|XP_006452399.1|  hypothetical protein CICLE_v10008725mg             187   5e-54   Citrus clementina [clementine]
ref|XP_002277934.1|  PREDICTED: GDSL esterase/lipase At5g55050          187   1e-53   Vitis vinifera
ref|XP_011095411.1|  PREDICTED: GDSL esterase/lipase At5g55050          184   2e-53   
ref|XP_010278640.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     186   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009361011.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     184   8e-53   
ref|XP_008364943.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     184   1e-52   
emb|CAN78085.1|  hypothetical protein VITISV_034041                     182   3e-52   Vitis vinifera
ref|XP_002529910.1|  zinc finger protein, putative                      182   4e-52   Ricinus communis
ref|XP_008366441.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     180   3e-51   
ref|XP_002317343.1|  hypothetical protein POPTR_0011s09200g             178   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010244496.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     178   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_012070852.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     177   3e-50   Jatropha curcas
ref|XP_009361012.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     176   2e-49   Pyrus x bretschneideri [bai li]
gb|KHN02853.1|  GDSL esterase/lipase                                    175   2e-49   Glycine soja [wild soybean]
ref|XP_011012091.1|  PREDICTED: GDSL esterase/lipase At5g55050          177   3e-49   Populus euphratica
ref|XP_009392767.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     175   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982523.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     174   4e-49   Setaria italica
gb|KHM99548.1|  GDSL esterase/lipase                                    174   4e-49   Glycine soja [wild soybean]
ref|XP_010096889.1|  GDSL esterase/lipase                               174   5e-49   Morus notabilis
ref|XP_007146498.1|  hypothetical protein PHAVU_006G045800g             174   6e-49   Phaseolus vulgaris [French bean]
ref|XP_004296519.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     173   1e-48   Fragaria vesca subsp. vesca
ref|XP_007214120.1|  hypothetical protein PRUPE_ppa017940mg             173   1e-48   
ref|XP_008363583.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     173   1e-48   
ref|XP_004986408.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     173   2e-48   
ref|XP_010666213.1|  PREDICTED: GDSL esterase/lipase At5g55050          172   2e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG14306.1|  hypothetical protein F383_02930                         172   3e-48   Gossypium arboreum [tree cotton]
ref|XP_008226872.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     172   4e-48   Prunus mume [ume]
ref|XP_006602197.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     172   4e-48   Glycine max [soybeans]
gb|KJB13709.1|  hypothetical protein B456_002G090200                    171   6e-48   Gossypium raimondii
ref|XP_003600128.1|  GDSL esterase/lipase                               172   6e-48   Medicago truncatula
ref|XP_008345049.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     171   7e-48   
ref|XP_003532134.1|  PREDICTED: GDSL esterase/lipase At5g55050          171   8e-48   Glycine max [soybeans]
ref|XP_008385871.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     171   1e-47   Malus domestica [apple tree]
gb|KJB13708.1|  hypothetical protein B456_002G090200                    171   2e-47   Gossypium raimondii
gb|ACJ84395.1|  unknown                                                 166   2e-47   Medicago truncatula
ref|XP_004500091.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     169   4e-47   Cicer arietinum [garbanzo]
ref|XP_010060321.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     170   5e-47   Eucalyptus grandis [rose gum]
gb|KJB81722.1|  hypothetical protein B456_013G158800                    169   7e-47   Gossypium raimondii
ref|XP_004149351.2|  PREDICTED: GDSL esterase/lipase At5g55050          168   9e-47   Cucumis sativus [cucumbers]
ref|XP_008449153.1|  PREDICTED: GDSL esterase/lipase At5g55050          168   1e-46   Cucumis melo [Oriental melon]
gb|ACU23301.1|  unknown                                                 168   1e-46   Glycine max [soybeans]
ref|NP_001147457.1|  anther-specific proline-rich protein APG           168   2e-46   Zea mays [maize]
gb|KEH33842.1|  GDSL-like lipase/acylhydrolase                          167   3e-46   Medicago truncatula
ref|XP_009392780.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     167   4e-46   
ref|XP_003600129.1|  GDSL esterase/lipase                               167   4e-46   Medicago truncatula
ref|XP_003600135.1|  GDSL esterase/lipase                               167   4e-46   
gb|AFK33602.1|  unknown                                                 166   5e-46   Medicago truncatula
gb|KJB62853.1|  hypothetical protein B456_009G440500                    166   6e-46   Gossypium raimondii
ref|XP_008226873.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     166   7e-46   Prunus mume [ume]
gb|EPS67263.1|  hypothetical protein M569_07514                         165   1e-45   Genlisea aurea
gb|EMT01246.1|  GDSL esterase/lipase                                    164   1e-45   
ref|XP_004500088.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     165   5e-45   Cicer arietinum [garbanzo]
gb|KEH28428.1|  GDSL-like lipase/acylhydrolase                          159   9e-45   Medicago truncatula
gb|AAP05801.1|  putative GDSL-like lipase/acylhydrolase                 163   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007020781.1|  Zinc finger protein, putative                      163   1e-44   Theobroma cacao [chocolate]
ref|XP_009361010.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     163   1e-44   Pyrus x bretschneideri [bai li]
gb|AFK39512.1|  unknown                                                 161   5e-44   Lotus japonicus
ref|XP_010539124.1|  PREDICTED: GDSL esterase/lipase At5g55050          161   5e-44   Tarenaya hassleriana [spider flower]
gb|KEH28427.1|  GDSL-like lipase/acylhydrolase                          159   6e-44   Medicago truncatula
ref|XP_010060317.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    159   3e-43   Eucalyptus grandis [rose gum]
gb|EMT25664.1|  GDSL esterase/lipase                                    159   3e-43   
ref|XP_004296521.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     159   3e-43   Fragaria vesca subsp. vesca
ref|XP_008364881.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     159   4e-43   
ref|XP_003617573.1|  GDSL esterase/lipase                               159   4e-43   Medicago truncatula
ref|XP_010042836.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     157   7e-43   Eucalyptus grandis [rose gum]
ref|XP_002529911.1|  zinc finger protein, putative                      158   1e-42   Ricinus communis
dbj|BAK01165.1|  predicted protein                                      158   1e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006829183.2|  PREDICTED: GDSL esterase/lipase At5g55050          157   2e-42   
gb|ERM96599.1|  hypothetical protein AMTR_s00001p00270970               157   2e-42   Amborella trichopoda
gb|AFK33479.1|  unknown                                                 156   4e-42   Lotus japonicus
gb|ACU21127.1|  unknown                                                 154   9e-42   Glycine max [soybeans]
gb|KCW66981.1|  hypothetical protein EUGRSUZ_F00745                     155   1e-41   Eucalyptus grandis [rose gum]
ref|XP_007142298.1|  hypothetical protein PHAVU_008G268800g             154   2e-41   Phaseolus vulgaris [French bean]
ref|XP_003559714.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     154   2e-41   Brachypodium distachyon [annual false brome]
gb|KHN11913.1|  GDSL esterase/lipase                                    154   3e-41   Glycine soja [wild soybean]
ref|XP_004491409.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...    154   4e-41   Cicer arietinum [garbanzo]
ref|XP_004491408.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...    154   4e-41   
emb|CDY19892.1|  BnaC09g31580D                                          152   1e-40   Brassica napus [oilseed rape]
ref|XP_009120029.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     152   1e-40   Brassica rapa
gb|KDP39149.1|  hypothetical protein JCGZ_00906                         151   3e-40   Jatropha curcas
gb|KDO62057.1|  hypothetical protein CISIN_1g0356442mg                  144   4e-40   Citrus sinensis [apfelsine]
ref|XP_012070853.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     150   5e-40   Jatropha curcas
ref|XP_006651568.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     150   8e-40   
ref|XP_010096890.1|  GDSL esterase/lipase                               149   8e-40   
ref|XP_008363091.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     144   8e-40   
ref|XP_010545226.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...    149   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_009132410.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     148   7e-39   Brassica rapa
emb|CDY43015.1|  BnaA03g11620D                                          147   1e-38   Brassica napus [oilseed rape]
emb|CDY61425.1|  BnaC03g71620D                                          147   1e-38   Brassica napus [oilseed rape]
ref|XP_003559713.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     147   2e-38   Brachypodium distachyon [annual false brome]
ref|NP_001050552.1|  Os03g0580800                                       147   2e-38   
gb|EAY90766.1|  hypothetical protein OsI_12368                          146   2e-38   Oryza sativa Indica Group [Indian rice]
gb|EAZ27592.1|  hypothetical protein OsJ_11540                          146   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792009.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     144   8e-38   Phoenix dactylifera
ref|NP_001050555.1|  Os03g0581400                                       145   9e-38   
ref|XP_010540156.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     142   4e-37   Tarenaya hassleriana [spider flower]
ref|XP_010545227.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...    142   8e-37   Tarenaya hassleriana [spider flower]
ref|XP_010666212.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...    140   1e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN56114.1|  hypothetical protein Csa_3G076010                       142   1e-36   Cucumis sativus [cucumbers]
ref|XP_009397969.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     141   2e-36   
emb|CDY19891.1|  BnaC09g31570D                                          140   3e-36   Brassica napus [oilseed rape]
ref|XP_010666211.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...    140   4e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009120027.1|  PREDICTED: GDSL esterase/lipase At5g55050          140   4e-36   Brassica rapa
ref|XP_010918204.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     139   6e-36   
ref|XP_012086456.1|  PREDICTED: GDSL esterase/lipase At5g37690          139   7e-36   Jatropha curcas
ref|XP_004986407.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     139   8e-36   Setaria italica
ref|XP_002464307.1|  hypothetical protein SORBIDRAFT_01g015890          138   3e-35   
emb|CDY06617.1|  BnaC02g13410D                                          136   1e-34   
emb|CDY20792.1|  BnaA02g09320D                                          136   1e-34   Brassica napus [oilseed rape]
ref|XP_009127039.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     136   1e-34   Brassica rapa
gb|KJB22746.1|  hypothetical protein B456_004G064300                    135   2e-34   Gossypium raimondii
ref|XP_011650521.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     135   2e-34   Cucumis sativus [cucumbers]
ref|XP_008449093.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     135   3e-34   
ref|XP_010647695.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     135   4e-34   
ref|XP_010528545.1|  PREDICTED: GDSL esterase/lipase At5g37690          134   5e-34   Tarenaya hassleriana [spider flower]
emb|CBI37762.3|  unnamed protein product                                134   6e-34   Vitis vinifera
ref|XP_004292273.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     134   6e-34   Fragaria vesca subsp. vesca
ref|XP_009400994.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     134   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC73753.1|  hypothetical protein OsI_08409                          134   1e-33   Oryza sativa Indica Group [Indian rice]
emb|CDY43014.1|  BnaA03g11610D                                          134   1e-33   Brassica napus [oilseed rape]
ref|XP_007216510.1|  hypothetical protein PRUPE_ppa025674mg             133   2e-33   Prunus persica
ref|XP_010443103.1|  PREDICTED: GDSL esterase/lipase At5g55050          133   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002968205.1|  hypothetical protein SELMODRAFT_89823              133   2e-33   Selaginella moellendorffii
ref|XP_008645093.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    133   2e-33   Zea mays [maize]
ref|XP_006280637.1|  hypothetical protein CARUB_v10026598mg             133   2e-33   Capsella rubella
ref|XP_002976172.1|  hypothetical protein SELMODRAFT_104120             133   3e-33   
ref|XP_010436724.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     129   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007141917.1|  hypothetical protein PHAVU_008G236800g             132   3e-33   Phaseolus vulgaris [French bean]
emb|CDY61423.1|  BnaC03g71610D                                          132   3e-33   Brassica napus [oilseed rape]
ref|NP_001047688.1|  Os02g0669000                                       132   3e-33   
ref|XP_004953406.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     132   4e-33   Setaria italica
ref|XP_010482926.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     132   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006430582.1|  hypothetical protein CICLE_v10013564mg             132   4e-33   Citrus clementina [clementine]
gb|ACG36192.1|  GSDL-motif lipase                                       132   6e-33   Zea mays [maize]
ref|XP_009132408.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     131   8e-33   Brassica rapa
ref|NP_001148614.1|  LOC100282230 precursor                             131   8e-33   Zea mays [maize]
ref|XP_006364625.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     131   9e-33   Solanum tuberosum [potatoes]
ref|XP_004250176.1|  PREDICTED: GDSL esterase/lipase At5g37690          131   9e-33   Solanum lycopersicum
ref|XP_007032977.1|  SGNH hydrolase-type esterase superfamily pro...    132   1e-32   
gb|KDO50801.1|  hypothetical protein CISIN_1g041889mg                   131   1e-32   Citrus sinensis [apfelsine]
ref|XP_002981505.1|  hypothetical protein SELMODRAFT_114853             131   1e-32   
ref|XP_006482381.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     131   1e-32   Citrus sinensis [apfelsine]
gb|KFK27114.1|  hypothetical protein AALP_AA8G336400                    131   1e-32   Arabis alpina [alpine rockcress]
ref|XP_010905234.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     131   1e-32   Elaeis guineensis
gb|AFW63334.1|  GSDL-motif protein lipase                               131   1e-32   
ref|XP_004982496.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     131   1e-32   Setaria italica
ref|XP_009789284.1|  PREDICTED: GDSL esterase/lipase At5g37690          130   2e-32   Nicotiana sylvestris
ref|XP_010450525.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     130   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009596775.1|  PREDICTED: GDSL esterase/lipase 7-like             130   2e-32   Nicotiana tomentosiformis
ref|XP_009370610.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     130   2e-32   
ref|XP_010440879.1|  PREDICTED: GDSL esterase/lipase At5g37690          130   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004966493.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     130   2e-32   
ref|XP_004145849.1|  PREDICTED: GDSL esterase/lipase At5g37690          130   2e-32   Cucumis sativus [cucumbers]
ref|XP_009132409.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     130   2e-32   Brassica rapa
ref|XP_002451409.1|  hypothetical protein SORBIDRAFT_04g001560          130   2e-32   
ref|XP_008381376.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     130   2e-32   
ref|XP_010113268.1|  GDSL esterase/lipase                               130   2e-32   
ref|XP_002870554.1|  hypothetical protein ARALYDRAFT_493746             130   2e-32   
ref|XP_008457023.1|  PREDICTED: GDSL esterase/lipase At5g37690          130   3e-32   Cucumis melo [Oriental melon]
ref|XP_002984381.1|  hypothetical protein SELMODRAFT_120432             130   3e-32   Selaginella moellendorffii
gb|AES61163.2|  GDSL-like lipase/acylhydrolase                          127   3e-32   Medicago truncatula
ref|XP_009781455.1|  PREDICTED: GDSL esterase/lipase 7-like             130   3e-32   Nicotiana sylvestris
ref|XP_002972805.1|  hypothetical protein SELMODRAFT_232013             130   3e-32   Selaginella moellendorffii
ref|XP_006285681.1|  hypothetical protein CARUB_v10007145mg             130   3e-32   Capsella rubella
ref|XP_006828510.1|  PREDICTED: GDSL esterase/lipase At5g37690          130   3e-32   Amborella trichopoda
ref|XP_006647662.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     129   4e-32   Oryza brachyantha
gb|KHN39466.1|  GDSL esterase/lipase                                    129   4e-32   Glycine soja [wild soybean]
ref|XP_003519329.1|  PREDICTED: GDSL esterase/lipase At5g37690-li...    129   4e-32   Glycine max [soybeans]
ref|XP_004289592.1|  PREDICTED: GDSL esterase/lipase At5g37690          129   5e-32   Fragaria vesca subsp. vesca
ref|XP_008228044.1|  PREDICTED: GDSL esterase/lipase At5g37690          129   5e-32   Prunus mume [ume]
ref|XP_010324308.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...    129   5e-32   
ref|XP_009418683.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     129   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864371.1|  GDSL-motif lipase/hydrolase family protein         129   5e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_006596502.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     129   6e-32   
ref|XP_008781241.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...    129   6e-32   Phoenix dactylifera
ref|XP_002279442.2|  PREDICTED: GDSL esterase/lipase At5g55050-like     129   6e-32   
ref|NP_200316.1|  GDSL esterase/lipase                                  129   6e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAN75126.1|  hypothetical protein VITISV_042427                     129   7e-32   Vitis vinifera
ref|XP_009367135.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     129   7e-32   Pyrus x bretschneideri [bai li]
ref|XP_004289054.2|  PREDICTED: uncharacterized protein LOC101311518    132   7e-32   Fragaria vesca subsp. vesca
ref|XP_006405842.1|  hypothetical protein EUTSA_v10027814mg             129   7e-32   Eutrema salsugineum [saltwater cress]
ref|XP_008798242.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     129   8e-32   
ref|XP_004490816.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     129   8e-32   
ref|XP_004956485.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     129   1e-31   Setaria italica
ref|XP_008645092.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    129   1e-31   Zea mays [maize]
ref|XP_010271296.1|  PREDICTED: GDSL esterase/lipase At5g37690          128   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_002455881.1|  hypothetical protein SORBIDRAFT_03g026750          128   1e-31   Sorghum bicolor [broomcorn]
ref|XP_010108989.1|  GDSL esterase/lipase                               128   2e-31   Morus notabilis
gb|AAM61634.1|  GDSL-motif lipase/hydrolase-like protein                127   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778519.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     127   2e-31   Phoenix dactylifera
dbj|BAJ87244.1|  predicted protein                                      128   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006646796.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     128   2e-31   Oryza brachyantha
ref|NP_198585.2|  GDSL esterase/lipase                                  127   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33277.1|  hypothetical protein AALP_AA6G354100                    127   2e-31   Arabis alpina [alpine rockcress]
ref|XP_002963578.1|  hypothetical protein SELMODRAFT_80680              127   2e-31   
ref|XP_010448960.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     127   2e-31   Camelina sativa [gold-of-pleasure]
gb|KFK33276.1|  hypothetical protein AALP_AA6G354100                    127   3e-31   Arabis alpina [alpine rockcress]
ref|XP_010062263.1|  PREDICTED: GDSL esterase/lipase At5g37690          127   3e-31   Eucalyptus grandis [rose gum]
gb|KJB43244.1|  hypothetical protein B456_007G190000                    127   3e-31   Gossypium raimondii
ref|XP_008679095.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     127   3e-31   Zea mays [maize]
ref|XP_010030697.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     127   4e-31   Eucalyptus grandis [rose gum]
ref|XP_011092996.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     127   4e-31   
ref|XP_004955199.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     127   4e-31   Setaria italica
gb|AFW87567.1|  hypothetical protein ZEAMMB73_404117                    125   4e-31   
gb|EAY85532.1|  hypothetical protein OsI_06905                          127   5e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_009418684.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     126   7e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395376.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     126   7e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH28240.1|  GDSL-like lipase/acylhydrolase                          125   8e-31   Medicago truncatula
ref|XP_004233932.2|  PREDICTED: GDSL esterase/lipase 7-like             126   8e-31   Solanum lycopersicum
ref|XP_009389191.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     125   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010935212.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     125   9e-31   Elaeis guineensis
gb|AES99241.2|  GDSL-like lipase/acylhydrolase                          125   1e-30   Medicago truncatula
ref|XP_004292275.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     125   1e-30   Fragaria vesca subsp. vesca
ref|XP_003616283.1|  GDSL esterase/lipase                               125   1e-30   
ref|XP_008365776.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     121   1e-30   
ref|XP_004965496.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     126   1e-30   
ref|XP_002439050.1|  hypothetical protein SORBIDRAFT_10g030550          125   1e-30   Sorghum bicolor [broomcorn]
ref|XP_009139742.1|  PREDICTED: GDSL esterase/lipase At5g37690          125   1e-30   Brassica rapa
ref|XP_004966494.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     125   2e-30   Setaria italica
ref|XP_009589693.1|  PREDICTED: GDSL esterase/lipase At5g37690          125   2e-30   Nicotiana tomentosiformis
ref|XP_008236136.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     125   2e-30   
ref|XP_006365666.1|  PREDICTED: GDSL esterase/lipase 7-like             125   2e-30   Solanum tuberosum [potatoes]
gb|KCW55612.1|  hypothetical protein EUGRSUZ_I01477                     124   2e-30   Eucalyptus grandis [rose gum]
ref|XP_011001569.1|  PREDICTED: GDSL esterase/lipase At5g37690          124   3e-30   Populus euphratica
ref|XP_007041706.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    124   3e-30   
ref|NP_001132708.1|  hypothetical protein precursor                     124   3e-30   Zea mays [maize]
ref|XP_003572800.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     124   4e-30   Brachypodium distachyon [annual false brome]
ref|XP_006372567.1|  hypothetical protein POPTR_0017s02870g             124   4e-30   Populus trichocarpa [western balsam poplar]
gb|EEC81334.1|  hypothetical protein OsI_24509                          124   4e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_004977709.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     124   5e-30   
ref|XP_004952105.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     124   5e-30   Setaria italica
ref|XP_008382487.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     124   6e-30   
ref|XP_002972662.1|  hypothetical protein SELMODRAFT_98542              123   6e-30   
ref|XP_010694317.1|  PREDICTED: GDSL esterase/lipase 7                  123   6e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002973211.1|  hypothetical protein SELMODRAFT_413745             123   6e-30   Selaginella moellendorffii
dbj|BAK02158.1|  predicted protein                                      124   6e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001183248.1|  hypothetical protein precursor                     124   6e-30   Zea mays [maize]
ref|XP_002994082.1|  hypothetical protein SELMODRAFT_45524              122   7e-30   
ref|XP_002976639.1|  hypothetical protein SELMODRAFT_416519             123   7e-30   Selaginella moellendorffii
ref|XP_008781349.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     123   7e-30   Phoenix dactylifera
ref|XP_003570826.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     123   8e-30   Brachypodium distachyon [annual false brome]
tpg|DAA60904.1|  TPA: hypothetical protein ZEAMMB73_211014              124   8e-30   
ref|XP_002439051.1|  hypothetical protein SORBIDRAFT_10g030560          123   9e-30   Sorghum bicolor [broomcorn]
ref|XP_003589465.1|  GDSL esterase/lipase                               123   9e-30   
ref|XP_002462124.1|  hypothetical protein SORBIDRAFT_02g019550          123   1e-29   
ref|XP_006379706.1|  hypothetical protein POPTR_0008s10430g             123   1e-29   Populus trichocarpa [western balsam poplar]
emb|CDP01632.1|  unnamed protein product                                122   1e-29   Coffea canephora [robusta coffee]
ref|XP_002967217.1|  hypothetical protein SELMODRAFT_87116              122   1e-29   
gb|ABK27121.1|  unknown                                                 123   1e-29   Picea sitchensis
ref|XP_002437291.1|  hypothetical protein SORBIDRAFT_10g024300          123   1e-29   Sorghum bicolor [broomcorn]
ref|XP_004982954.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     122   2e-29   Setaria italica
ref|XP_002528422.1|  zinc finger protein, putative                      122   2e-29   Ricinus communis
ref|XP_009409252.1|  PREDICTED: GDSL esterase/lipase At5g37690          122   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS56603.1|  hypothetical protein TRIUR3_16015                       119   2e-29   Triticum urartu
ref|XP_006383013.1|  hypothetical protein POPTR_0005s10710g             122   2e-29   
ref|XP_003590909.1|  GDSL esterase/lipase                               122   2e-29   Medicago truncatula
ref|XP_002274836.2|  PREDICTED: GDSL esterase/lipase At5g37690          122   2e-29   Vitis vinifera
ref|XP_002452598.1|  hypothetical protein SORBIDRAFT_04g028830          122   3e-29   Sorghum bicolor [broomcorn]
ref|XP_001772825.1|  predicted protein                                  122   3e-29   
gb|EEE66383.1|  hypothetical protein OsJ_22704                          122   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002989121.1|  hypothetical protein SELMODRAFT_129215             122   3e-29   Selaginella moellendorffii
ref|XP_008654621.1|  PREDICTED: hypothetical protein isoform X1         121   3e-29   
emb|CBI33516.3|  unnamed protein product                                121   3e-29   Vitis vinifera
ref|XP_007046563.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    122   3e-29   
ref|XP_006653672.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     121   3e-29   Oryza brachyantha
gb|EEE66382.1|  hypothetical protein OsJ_22703                          121   4e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AFW69562.1|  hypothetical protein ZEAMMB73_069839                    121   4e-29   
ref|XP_006486656.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     121   4e-29   
ref|XP_002525954.1|  zinc finger protein, putative                      121   4e-29   
ref|XP_002439048.1|  hypothetical protein SORBIDRAFT_10g030530          121   4e-29   
ref|XP_010030860.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     118   4e-29   
ref|NP_001141971.1|  hypothetical protein precursor                     121   4e-29   
ref|NP_001058619.1|  Os06g0725100                                       121   4e-29   
ref|XP_003560843.1|  PREDICTED: GDSL esterase/lipase At5g37690          122   5e-29   
ref|XP_002988284.1|  hypothetical protein SELMODRAFT_127685             120   5e-29   
ref|XP_010906926.1|  PREDICTED: GDSL esterase/lipase At5g37690          121   5e-29   
dbj|BAJ96273.1|  predicted protein                                      121   6e-29   
ref|XP_002963881.1|  hypothetical protein SELMODRAFT_80725              120   6e-29   
ref|XP_010236845.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     120   6e-29   
ref|XP_008645094.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     121   6e-29   
gb|EMT27268.1|  GDSL esterase/lipase                                    120   7e-29   
ref|XP_011002018.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     120   7e-29   
ref|XP_010029428.1|  PREDICTED: GDSL esterase/lipase 7-like             120   7e-29   
ref|XP_008678928.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     120   7e-29   
gb|KCW56342.1|  hypothetical protein EUGRSUZ_I02076                     120   8e-29   
dbj|BAJ94778.1|  predicted protein                                      120   8e-29   
ref|XP_002960505.1|  hypothetical protein SELMODRAFT_73430              120   9e-29   
ref|XP_008343129.1|  PREDICTED: GDSL esterase/lipase At5g37690          120   9e-29   
ref|XP_009389190.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     120   9e-29   
ref|XP_011007241.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     120   1e-28   
ref|XP_002974862.1|  hypothetical protein SELMODRAFT_102199             120   1e-28   
emb|CAH67166.1|  H0211B05.3                                             120   1e-28   
ref|XP_002963776.1|  hypothetical protein SELMODRAFT_80714              120   1e-28   
ref|XP_011462225.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     119   1e-28   
gb|EYU40463.1|  hypothetical protein MIMGU_mgv1a018259mg                119   1e-28   
emb|CAD41059.2|  OSJNBa0084K11.17                                       120   1e-28   
ref|XP_002464304.1|  hypothetical protein SORBIDRAFT_01g015860          120   2e-28   
ref|XP_002448325.1|  hypothetical protein SORBIDRAFT_06g025280          120   2e-28   
gb|KDO68241.1|  hypothetical protein CISIN_1g041191mg                   119   2e-28   
ref|XP_009344833.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     119   2e-28   
ref|XP_007030301.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    119   2e-28   
gb|AFK33443.1|  unknown                                                 116   2e-28   
ref|XP_010266838.1|  PREDICTED: GDSL esterase/lipase EXL3-like          119   2e-28   
ref|XP_002988147.1|  hypothetical protein SELMODRAFT_127225             119   3e-28   
gb|KCW56555.1|  hypothetical protein EUGRSUZ_I02287                     119   3e-28   
ref|XP_010670128.1|  PREDICTED: GDSL esterase/lipase At5g37690          119   3e-28   
dbj|BAD19975.1|  putative family II extracellular lipase 3
ref|XP_008382488.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     119   3e-28   
ref|XP_002521156.1|  zinc finger protein, putative                      119   4e-28   
ref|XP_010030798.1|  PREDICTED: GDSL esterase/lipase 7-like             119   4e-28   
ref|XP_006575487.1|  PREDICTED: GDSL esterase/lipase At5g37690-li...    118   4e-28   
ref|XP_002964035.1|  hypothetical protein SELMODRAFT_438768             118   4e-28   
ref|XP_006384153.1|  hypothetical protein POPTR_0004s08520g             118   4e-28   
gb|KCW56340.1|  hypothetical protein EUGRSUZ_I02074                     118   4e-28   
gb|EMT12420.1|  GDSL esterase/lipase                                    119   4e-28   
ref|XP_009412862.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     119   4e-28   
emb|CDP03830.1|  unnamed protein product                                118   4e-28   
ref|XP_004965706.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     118   4e-28   
ref|XP_006371114.1|  hypothetical protein POPTR_0019s04150g             119   4e-28   
ref|XP_008809415.1|  PREDICTED: GDSL esterase/lipase At5g37690          118   4e-28   
ref|XP_006656508.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     119   5e-28   
ref|XP_008380976.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     119   5e-28   
ref|XP_004953405.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     118   5e-28   
ref|XP_002974632.1|  hypothetical protein SELMODRAFT_232393             118   6e-28   
ref|XP_008242079.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     118   6e-28   
ref|XP_006647849.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     117   6e-28   
ref|XP_006437267.1|  hypothetical protein CICLE_v10033835mg             118   6e-28   
ref|XP_003629207.1|  GDSL esterase/lipase                               118   6e-28   
gb|EMT13101.1|  GDSL esterase/lipase                                    118   6e-28   
ref|XP_009757598.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     118   6e-28   
ref|XP_008813060.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     118   6e-28   
ref|XP_007032908.1|  GDSL-motif lipase 7, putative                      118   7e-28   
ref|XP_006829178.1|  PREDICTED: GDSL esterase/lipase At1g71691          118   7e-28   
gb|KJB15885.1|  hypothetical protein B456_002G202200                    118   7e-28   
ref|XP_007146097.1|  hypothetical protein PHAVU_006G012300g             117   7e-28   
ref|XP_010419187.1|  PREDICTED: GDSL esterase/lipase At3g14820-like     117   8e-28   
ref|XP_010046122.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     118   8e-28   
gb|KDO46628.1|  hypothetical protein CISIN_1g041652mg                   117   8e-28   
ref|XP_002963344.1|  hypothetical protein SELMODRAFT_80189              117   8e-28   
ref|XP_008223373.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     117   9e-28   
ref|XP_001774782.1|  predicted protein                                  117   9e-28   
ref|NP_001057321.1|  Os06g0257600                                       118   9e-28   
ref|XP_009337117.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     117   9e-28   
ref|XP_010524116.1|  PREDICTED: GDSL esterase/lipase At2g42990          117   1e-27   
ref|XP_008781147.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     117   1e-27   
ref|XP_006484791.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     117   1e-27   
gb|EYU38004.1|  hypothetical protein MIMGU_mgv1a022138mg                117   1e-27   
gb|KHN14798.1|  GDSL esterase/lipase                                    114   1e-27   
ref|XP_002271400.1|  PREDICTED: GDSL esterase/lipase At5g22810          117   1e-27   
emb|CDP14526.1|  unnamed protein product                                117   1e-27   
gb|KDP43725.1|  hypothetical protein JCGZ_22352                         117   1e-27   
gb|KHN35335.1|  GDSL esterase/lipase                                    117   1e-27   
gb|KHN00434.1|  GDSL esterase/lipase                                    117   1e-27   
ref|XP_011088666.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     117   1e-27   
ref|XP_002531921.1|  zinc finger protein, putative                      117   1e-27   
gb|KHN48972.1|  GDSL esterase/lipase                                    117   1e-27   
ref|XP_004966495.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     117   1e-27   
ref|XP_008242093.1|  PREDICTED: GDSL esterase/lipase EXL3-like          117   1e-27   
ref|XP_007143993.1|  hypothetical protein PHAVU_007G120000g             117   1e-27   
gb|EEC75633.1|  hypothetical protein OsI_12372                          117   1e-27   
ref|XP_009363463.1|  PREDICTED: GDSL esterase/lipase EXL3-like          117   1e-27   
gb|ABK26965.1|  unknown                                                 117   1e-27   
ref|XP_003519850.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     117   1e-27   
ref|XP_003574729.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     117   1e-27   
gb|EMT06926.1|  GDSL esterase/lipase                                    116   1e-27   
ref|XP_010918935.1|  PREDICTED: GDSL esterase/lipase LTL1               117   2e-27   
ref|XP_009378286.1|  PREDICTED: GDSL esterase/lipase 7                  117   2e-27   
ref|XP_002306212.2|  hypothetical protein POPTR_0004s18720g             117   2e-27   
ref|XP_002965163.1|  hypothetical protein SELMODRAFT_230518             117   2e-27   
ref|XP_010257902.1|  PREDICTED: GDSL esterase/lipase 7-like             117   2e-27   
ref|XP_003521785.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     117   2e-27   
gb|EYU39533.1|  hypothetical protein MIMGU_mgv1a008571mg                117   2e-27   
ref|XP_008339188.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     117   2e-27   
gb|KFK26081.1|  hypothetical protein AALP_AA8G200400                    117   2e-27   
ref|XP_006657357.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     115   2e-27   
ref|XP_003554733.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     117   2e-27   
ref|XP_006827265.2|  PREDICTED: GDSL esterase/lipase At1g74460          114   2e-27   
ref|XP_009356602.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     116   2e-27   
dbj|BAD16143.1|  GDSL-motif lipase/hydrolase-like                       116   2e-27   
ref|XP_010935209.1|  PREDICTED: GDSL esterase/lipase At4g16230-li...    116   2e-27   
ref|XP_006648921.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     116   2e-27   
ref|XP_009379346.1|  PREDICTED: GDSL esterase/lipase EXL3-like          116   2e-27   
ref|XP_003560321.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     116   2e-27   
ref|XP_002467122.1|  hypothetical protein SORBIDRAFT_01g020000          116   2e-27   
ref|XP_002962248.1|  hypothetical protein SELMODRAFT_77657              116   2e-27   
gb|ACU23502.1|  unknown                                                 116   3e-27   
ref|XP_002966503.1|  hypothetical protein SELMODRAFT_85364              116   3e-27   
ref|XP_010030797.1|  PREDICTED: GDSL esterase/lipase 7-like             116   3e-27   
ref|XP_006655981.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     116   3e-27   
ref|XP_002982345.1|  hypothetical protein SELMODRAFT_116276             116   3e-27   
gb|EEE57756.1|  hypothetical protein OsJ_08277                          116   3e-27   
ref|XP_011046319.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     116   3e-27   
gb|EAY84234.1|  hypothetical protein OsI_05616                          114   3e-27   
ref|XP_011019874.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     116   3e-27   
gb|ACG46653.1|  anther-specific proline-rich protein APG precursor      116   3e-27   
ref|NP_001136990.1|  uncharacterized protein LOC100217152               116   3e-27   
ref|XP_006425322.1|  hypothetical protein CICLE_v10027459mg             115   3e-27   
gb|EMT29053.1|  GDSL esterase/lipase                                    116   3e-27   
ref|XP_007035821.1|  GDSL esterase/lipase isoform 2                     116   3e-27   
ref|XP_011046318.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     116   3e-27   
ref|XP_008218371.1|  PREDICTED: GDSL esterase/lipase LTL1-like          116   4e-27   
ref|XP_012088493.1|  PREDICTED: GDSL esterase/lipase EXL3-like          115   4e-27   
ref|XP_004495557.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     116   4e-27   
ref|XP_007156215.1|  hypothetical protein PHAVU_003G267900g             116   4e-27   
ref|XP_007204177.1|  hypothetical protein PRUPE_ppa016932mg             115   4e-27   
gb|ACR37591.1|  unknown                                                 115   4e-27   
ref|XP_011629023.1|  PREDICTED: GDSL esterase/lipase At5g08460 is...    114   4e-27   
dbj|BAD28304.1|  putative anter-specific proline-rich protein APG       115   4e-27   
gb|EAY87012.1|  hypothetical protein OsI_08408                          115   4e-27   
gb|EPS72894.1|  hypothetical protein M569_01863                         112   4e-27   
gb|KHN13664.1|  GDSL esterase/lipase                                    115   4e-27   
ref|XP_003542450.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     115   5e-27   
gb|KGN44054.1|  hypothetical protein Csa_7G145970                       114   5e-27   
ref|XP_001781861.1|  predicted protein                                  115   5e-27   
gb|ACU15087.1|  unknown                                                 112   5e-27   
ref|XP_008646234.1|  PREDICTED: GDSL esterase/lipase At5g55050-like     115   5e-27   
ref|XP_009395858.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     115   5e-27   
gb|ACU23670.1|  unknown                                                 115   5e-27   
ref|XP_010649507.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     115   5e-27   
ref|NP_001062538.1|  Os08g0565900                                       115   5e-27   
ref|XP_006414376.1|  hypothetical protein EUTSA_v10027022mg             115   5e-27   
gb|KDP23987.1|  hypothetical protein JCGZ_25375                         115   6e-27   
ref|XP_003552505.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     115   6e-27   
ref|XP_010229707.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     115   6e-27   
ref|XP_006401499.1|  hypothetical protein EUTSA_v10015846mg             115   6e-27   
ref|XP_003533553.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     115   7e-27   
ref|XP_006829182.1|  PREDICTED: GDSL esterase/lipase At5g08460 is...    115   7e-27   
ref|XP_010508487.1|  PREDICTED: GDSL esterase/lipase At2g42990          115   7e-27   
ref|XP_002981545.1|  hypothetical protein SELMODRAFT_114798             114   7e-27   
ref|XP_008230312.1|  PREDICTED: GDSL esterase/lipase 7                  115   7e-27   
ref|XP_003554732.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     115   7e-27   
ref|XP_006411572.1|  hypothetical protein EUTSA_v10016869mg             115   7e-27   
ref|XP_003573010.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     115   7e-27   
ref|NP_178483.1|  GDSL esterase/lipase                                  115   7e-27   
gb|EYU29672.1|  hypothetical protein MIMGU_mgv1a0116502mg               112   8e-27   
ref|XP_009385218.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     115   8e-27   
ref|XP_003555016.2|  PREDICTED: GDSL esterase/lipase 7-like             115   8e-27   
gb|ACJ84324.1|  unknown                                                 112   8e-27   
ref|XP_011038448.1|  PREDICTED: GDSL esterase/lipase At5g33370          115   8e-27   
ref|XP_008380187.1|  PREDICTED: GDSL esterase/lipase At2g42990          115   8e-27   
gb|ABK25389.1|  unknown                                                 115   8e-27   
ref|NP_001237641.2|  uncharacterized LOC100500155 precursor             115   9e-27   
emb|CBI17099.3|  unnamed protein product                                118   9e-27   
ref|XP_001757546.1|  predicted protein                                  115   9e-27   
ref|XP_010549002.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     115   9e-27   
gb|EYU38779.1|  hypothetical protein MIMGU_mgv1a026265mg                114   9e-27   
ref|XP_007214883.1|  hypothetical protein PRUPE_ppa022538mg             114   1e-26   
gb|EMT02129.1|  GDSL esterase/lipase                                    114   1e-26   
ref|XP_010935208.1|  PREDICTED: GDSL esterase/lipase At4g16230-li...    114   1e-26   
ref|XP_008369672.1|  PREDICTED: GDSL esterase/lipase At4g16230          114   1e-26   
ref|XP_008354621.1|  PREDICTED: GDSL esterase/lipase EXL3-like          114   1e-26   
ref|XP_010680078.1|  PREDICTED: uncharacterized protein LOC104895310    117   1e-26   
ref|XP_004966492.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     114   1e-26   
ref|XP_012088492.1|  PREDICTED: GDSL esterase/lipase EXL3-like          114   1e-26   
ref|XP_010487287.1|  PREDICTED: GDSL esterase/lipase At3g14820 is...    114   1e-26   
gb|ERM94499.1|  hypothetical protein AMTR_s00010p00262680               113   1e-26   
ref|XP_006293493.1|  hypothetical protein CARUB_v10023509mg             114   1e-26   
gb|KEH42418.1|  GDSL-like lipase/acylhydrolase                          114   1e-26   
ref|XP_002527431.1|  zinc finger protein, putative                      114   1e-26   
ref|XP_004150907.2|  PREDICTED: GDSL esterase/lipase At4g26790-like     115   1e-26   
ref|XP_004489545.1|  PREDICTED: GDSL esterase/lipase LTL1-like          114   1e-26   
gb|AEY85024.1|  zinc finger protein                                     114   1e-26   
ref|XP_008393902.1|  PREDICTED: GDSL esterase/lipase EXL3-like          114   1e-26   
gb|KJB44764.1|  hypothetical protein B456_007G271400                    114   1e-26   
gb|EEE65379.1|  hypothetical protein OsJ_20687                          113   1e-26   
ref|XP_009631850.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     114   1e-26   
gb|KFK29189.1|  hypothetical protein AALP_AA7G101100                    114   1e-26   
ref|XP_009591832.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     114   1e-26   
ref|XP_002278423.2|  PREDICTED: GDSL esterase/lipase 7                  114   1e-26   
ref|XP_004983037.1|  PREDICTED: GDSL esterase/lipase EXL3-like          114   1e-26   
gb|AES82718.2|  GDSL-like lipase/acylhydrolase                          114   1e-26   
ref|XP_006422488.1|  hypothetical protein CICLE_v10030062mg             114   1e-26   
ref|XP_006660400.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     114   1e-26   
ref|XP_010517851.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     114   2e-26   
ref|XP_010492845.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     114   2e-26   
gb|KJB57157.1|  hypothetical protein B456_009G151000                    114   2e-26   
ref|XP_008643799.1|  PREDICTED: anther-specific proline-rich prot...    114   2e-26   
ref|XP_011629113.1|  PREDICTED: GDSL esterase/lipase At5g33370          114   2e-26   
ref|XP_010046130.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     114   2e-26   
gb|KHN43145.1|  GDSL esterase/lipase                                    114   2e-26   
ref|XP_010261310.1|  PREDICTED: GDSL esterase/lipase 7-like             114   2e-26   
gb|KJB72846.1|  hypothetical protein B456_011G200700                    114   2e-26   
ref|NP_001151440.1|  anther-specific proline-rich protein APG pre...    114   2e-26   
gb|KJB57077.1|  hypothetical protein B456_009G147000                    113   2e-26   
ref|NP_001057215.2|  Os06g0229400                                       114   2e-26   
ref|XP_010069682.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     114   2e-26   
ref|XP_004237503.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     114   2e-26   
ref|XP_004304187.1|  PREDICTED: GDSL esterase/lipase 7                  114   2e-26   



>ref|XP_009629303.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Nicotiana tomentosiformis]
Length=359

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            AQ VPA Y+FGDSL+DVGNNNH  +II+A+FP+NGVDYPG K TGRF NG NSADFLAEK
Sbjct  25   AQSVPAAYMFGDSLIDVGNNNHFGTIIKANFPYNGVDYPGGKPTGRFCNGKNSADFLAEK  84

Query  322  VGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            +G+PTPPPYL+DKNNVF  GVSFASGGAGIFN TN+ ++SKALH+S QV+ FS VQQ+LV
Sbjct  85   LGVPTPPPYLADKNNVFANGVSFASGGAGIFNGTNDNLLSKALHMSQQVQFFSIVQQRLV  144

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            NQ+G+ AA +QLSKS F I+IG+ND+INYF
Sbjct  145  NQLGSDAAHKQLSKSVFAIVIGSNDMINYF  174



>ref|XP_009763526.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Nicotiana sylvestris]
Length=362

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            AQ VPA Y+FGDSLVDVGNNNH  ++I+A+FP+NGVDYPG K+TGRF NG N+ADFLAEK
Sbjct  28   AQSVPAAYMFGDSLVDVGNNNHFGTVIKANFPYNGVDYPGGKSTGRFCNGKNTADFLAEK  87

Query  322  VGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            +G+PTPPPYL+DKNNVF KGVSFASGGAGIFN TN+  +SKALH+S QV+ FS VQQ+LV
Sbjct  88   LGVPTPPPYLADKNNVFAKGVSFASGGAGIFNGTNDDFLSKALHMSQQVQFFSIVQQRLV  147

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             Q+G+ AA++QL KS F I+IG+ND+INYF
Sbjct  148  TQLGSDAAQKQLLKSVFGIVIGSNDIINYF  177



>ref|XP_004244106.2| PREDICTED: GDSL esterase/lipase At5g55050-like isoform X1 [Solanum 
lycopersicum]
Length=357

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            EAQ VPA Y+FGDSL+DVGNNNHI +II+A+FP+NG D+PG K TGRFSNG N+ADF+AE
Sbjct  21   EAQLVPAAYMFGDSLIDVGNNNHIATIIKANFPYNGRDFPGGKPTGRFSNGKNTADFIAE  80

Query  319  KVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKL  498
            K+G+PTPPPYLSDKNN F KGVSFASGGAGIF +TN  +IS AL +S QV+LF  VQQ+L
Sbjct  81   KLGIPTPPPYLSDKNNQFPKGVSFASGGAGIFRTTNGELISFALDMSQQVQLFLLVQQRL  140

Query  499  VNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            V Q+G  A  ++LSKS F+++IG+ND+INYF
Sbjct  141  VKQLGGDAGMKKLSKSIFVVVIGSNDIINYF  171



>ref|XP_006346204.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Solanum tuberosum]
Length=328

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  166  VFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPPP  345
            +FGDSL+DVGNNNHI +II+A+FP+NG D+PG + TGRF NG N+ADF+AEK+G+PTPPP
Sbjct  1    MFGDSLIDVGNNNHIATIIKANFPYNGRDFPGGQPTGRFCNGKNTADFIAEKLGIPTPPP  60

Query  346  YLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAA  525
            YLSDKNN F KGVSFASGGAGIF +TN  +IS ALH+S QV+ FS VQQ+LV Q+GA A 
Sbjct  61   YLSDKNNQFPKGVSFASGGAGIFRTTNGALISFALHMSQQVQFFSVVQQRLVKQLGADAG  120

Query  526  KQQLSKSPFLILIGNNDLINYF  591
             +QLSKS F+++IG+ND+INYF
Sbjct  121  MKQLSKSIFVVVIGSNDIINYF  142



>ref|XP_006346261.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Solanum tuberosum]
Length=338

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            AQKVPAMYVFGDSLVDVGNNN++++  RA+F  NG+D+PG K TGRF+NG N+ADF+AE 
Sbjct  4    AQKVPAMYVFGDSLVDVGNNNYLETFFRANFLFNGIDFPGGKPTGRFNNGKNAADFIAEN  63

Query  322  VGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            VGLPTPPPYLSDKN+VFL+GVSFASGGAGI NSTN+   +  ++LS QV  F  VQQ+L+
Sbjct  64   VGLPTPPPYLSDKNDVFLQGVSFASGGAGILNSTNDHPFNGTIYLSKQVGYFYEVQQRLI  123

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             ++G +AAK+ L+ S F I+IG+NDL NYF
Sbjct  124  KKMGESAAKEHLTNSLFAIVIGSNDLFNYF  153



>emb|CDP05729.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            E Q VPA+YVFGDSLVDVGNNN+I DS+++A++P+NG+DYPG K TGRF NG N+ADF+A
Sbjct  35   EGQTVPAVYVFGDSLVDVGNNNYIKDSLLKANYPYNGIDYPGGKPTGRFCNGKNAADFIA  94

Query  316  EKVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQK  495
            EKVGLPT PPYLSD ++VFL+GVSFASGG+G+FN+T  G + K L L+ QV  F+ +  +
Sbjct  95   EKVGLPTSPPYLSDTSDVFLEGVSFASGGSGLFNTTGQGFLRKTLSLAQQVDYFTALHDR  154

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            LV Q+G AAA+Q+LSKS FL++IG+ND   YF
Sbjct  155  LVKQLGPAAAQQRLSKSLFLVVIGSNDAFAYF  186



>ref|XP_009629304.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Nicotiana tomentosiformis]
Length=338

 Score =   204 bits (520),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
             +QKV AMYVFGDS VDVGNN++  +I RA+FP NG+DYPG K TGRFSNG N+ADFLAE
Sbjct  3    RSQKVTAMYVFGDSQVDVGNNDYFQTIFRANFPFNGIDYPGGKPTGRFSNGKNAADFLAE  62

Query  319  KVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKL  498
             VGLPTPPPYLS+K+ +F++GVSFASGGAGI NSTN    +  +HLS QV  FS +QQ+L
Sbjct  63   NVGLPTPPPYLSNKDGLFMEGVSFASGGAGILNSTNGTPFNGTIHLSKQVEYFSELQQRL  122

Query  499  VNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + +IG  AA+  LS S F I+IG+NDL+NYF
Sbjct  123  IQKIGYNAAQMHLSSSLFPIVIGSNDLLNYF  153



>ref|XP_009786554.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Nicotiana sylvestris]
Length=338

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
             +QKV AMYVFGDS VDVGNN++  +I RA+FP NG+DYPG K TGRFSNG N+ADFLAE
Sbjct  3    RSQKVTAMYVFGDSQVDVGNNDYFQTIFRANFPFNGIDYPGGKPTGRFSNGKNAADFLAE  62

Query  319  KVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKL  498
            KVGLPTPPPYLS+K+ +F++GVSFASGGAGI NSTN    +  + LS Q+  FS +QQ+L
Sbjct  63   KVGLPTPPPYLSNKDGLFMEGVSFASGGAGILNSTNGTPFNGTIQLSKQIEYFSELQQRL  122

Query  499  VNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + +IG  AA+  LS S F I+IG+NDL+NYF
Sbjct  123  IQKIGYDAAQIHLSSSLFPIVIGSNDLLNYF  153



>ref|XP_004244348.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Solanum lycopersicum]
Length=365

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
             AQKVPAMYVFGDSLVDVGNNN++++  RA+F  NG+D+PG K TGRFSNG N+ADF+AE
Sbjct  28   RAQKVPAMYVFGDSLVDVGNNNYLETFFRANFLFNGIDFPGGKPTGRFSNGKNAADFIAE  87

Query  319  KVGLPTPPPYLSD--KNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
             +GLPTP PYLSD  KNNVFL+GVSFASGGAGI NSTN+   +  ++LS QV  F  VQQ
Sbjct  88   NIGLPTPSPYLSDSNKNNVFLQGVSFASGGAGILNSTNDHPYNGTIYLSKQVGYFYEVQQ  147

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            +L+  IG  AAK+ L  S F I+IG+ND+ NYFN
Sbjct  148  RLIKNIGENAAKKHLKNSLFAIVIGSNDIFNYFN  181



>ref|XP_010929638.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Elaeis guineensis]
Length=368

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 123/151 (81%), Gaps = 8/151 (5%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            VPAMYVFGDSL DVGNNNH++++++ADFPHNG+DYPG KATGRFSNG NSADFLAEK+G+
Sbjct  36   VPAMYVFGDSLADVGNNNHLETLLKADFPHNGIDYPGHKATGRFSNGKNSADFLAEKLGV  95

Query  331  PTPPPYL-----SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQK  495
            P+ PPYL     S+K +VF+ GVSFASGGAGI +STN+G   + L L+ Q+  +STV   
Sbjct  96   PSSPPYLSIPSNSNKTDVFMNGVSFASGGAGILDSTNSG---QCLTLNKQIDYYSTVYGT  152

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            LV Q+G+A A++ LSKS F ++IG+ND++NY
Sbjct  153  LVQQLGSAQAQEHLSKSIFAVIIGSNDMLNY  183



>ref|XP_008804293.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Phoenix dactylifera]
Length=364

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 122/151 (81%), Gaps = 8/151 (5%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            VPAMYVFGDSL DVGNNNH++++++A+FPHNG+DYPGRKATGRFSNG NSADFLAEK+G+
Sbjct  32   VPAMYVFGDSLADVGNNNHLETLLKANFPHNGIDYPGRKATGRFSNGKNSADFLAEKLGV  91

Query  331  PTPPPYL-----SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQK  495
            PT PPYL     S++ + FL GVSFASGGAGI +STN+G   + L  + Q+  +STV   
Sbjct  92   PTSPPYLSIPSSSNRTDAFLHGVSFASGGAGILDSTNSG---QCLTFNKQIDYYSTVYGA  148

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            LV Q+G+A A++ LSKS F+ +IG+NDL+NY
Sbjct  149  LVQQLGSAPAQEHLSKSIFVFIIGSNDLLNY  179



>gb|EYU27351.1| hypothetical protein MIMGU_mgv1a008471mg [Erythranthe guttata]
Length=372

 Score =   195 bits (495),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPAMYVFGDSLVDVGNNN++  S+I+ADFP+NG+D+PG K TGRFSNG N+AD +AEK+G
Sbjct  40   VPAMYVFGDSLVDVGNNNYLPLSVIKADFPYNGIDFPGHKPTGRFSNGKNAADIIAEKLG  99

Query  328  LPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQ  507
            + TPPPYLS  NNVFLKGVSFASGGAGIFN+T   +I   + ++ QV  FS+V+Q LV  
Sbjct  100  VTTPPPYLSKPNNVFLKGVSFASGGAGIFNTTGESLIKHTIPMAHQVGHFSSVRQILVKA  159

Query  508  IGAA-AAKQQLSKSPFLILIGNNDLINYFN  594
            +G++ A ++  SKS F I+IG+ND+INYF 
Sbjct  160  MGSSNAVQEHFSKSFFPIVIGSNDIINYFT  189



>ref|XP_006452399.1| hypothetical protein CICLE_v10008725mg [Citrus clementina]
 ref|XP_006475044.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Citrus sinensis]
 gb|ESR65639.1| hypothetical protein CICLE_v10008725mg [Citrus clementina]
Length=363

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 124/155 (80%), Gaps = 6/155 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA++VFGDSLVDVGNNN++  SI +ADFPHNG+D+P +K TGRFSNG N+ADF+A
Sbjct  26   EAQMVPAVFVFGDSLVDVGNNNYLPISIAKADFPHNGIDFPTKKPTGRFSNGKNAADFIA  85

Query  316  EKVGLPTPPPYLSDKNN----VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            EKVGLP+ PPYL+ K+N     FL GVSFASGGAGIFNS++   +++++ L+ QV  + T
Sbjct  86   EKVGLPSSPPYLAVKSNKNKASFLTGVSFASGGAGIFNSSDQS-LAQSITLTKQVDYYGT  144

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            V + LV Q+G +AA++ LSKS F I++G+ND+ +Y
Sbjct  145  VHKDLVQQMGPSAAQEHLSKSLFAIVVGSNDIFDY  179



>ref|XP_002277934.1| PREDICTED: GDSL esterase/lipase At5g55050 [Vitis vinifera]
 emb|CBI26656.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 124/158 (78%), Gaps = 8/158 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ  PA+++FGDSLVDVGNNNH+  S+ +ADFPHNGVD+PG+K TGRF NG N+ADFLA
Sbjct  24   EAQLAPALFMFGDSLVDVGNNNHLKLSLAKADFPHNGVDFPGKKPTGRFCNGKNAADFLA  83

Query  316  EKVGLPTPPPYLS--DKNNV----FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EK+GLP+ PPYLS   K+N+    F+ GVSFASGGAGIF+ T + +  ++L L  QV  +
Sbjct  84   EKLGLPSAPPYLSLISKSNLSNASFVAGVSFASGGAGIFDGT-DALYKQSLPLKKQVAYY  142

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +TV ++LV Q+G+A A++ LSKS F ++IG+ND++ Y+
Sbjct  143  ATVYERLVQQLGSAGAQEHLSKSVFAVVIGSNDILGYY  180



>ref|XP_011095411.1| PREDICTED: GDSL esterase/lipase At5g55050 [Sesamum indicum]
Length=327

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +1

Query  160  MYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPT  336
            MYVFGDSLVDVGNNN+++ SII+ADFP+NG+DYPG +ATGRFSNG N+ADFLAEKVGL +
Sbjct  1    MYVFGDSLVDVGNNNYLELSIIKADFPYNGIDYPGGQATGRFSNGKNAADFLAEKVGLAS  60

Query  337  PPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGA  516
             PPYL   N VF+KGVSFASGGAGIFN+T+  +I   + L  Q+  FSTV+Q+L  ++G 
Sbjct  61   APPYLGQPNGVFVKGVSFASGGAGIFNTTDESLI-HTIPLPHQLGHFSTVRQRLAKELG-  118

Query  517  AAAKQQLSKSPFLILIGNNDLINYFN  594
            +  +  LSKS F ++IG+ND+INYFN
Sbjct  119  SHLEDHLSKSLFPVVIGSNDIINYFN  144



>ref|XP_010278640.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Nelumbo nucifera]
Length=361

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 124/158 (78%), Gaps = 7/158 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +AQ VPA++VFGDSLVDVGNNNH+  S+ +ADFPHNGVD+PG+K TGRFSNG N+ADFLA
Sbjct  22   DAQMVPAVFVFGDSLVDVGNNNHLKLSLAKADFPHNGVDFPGKKPTGRFSNGKNAADFLA  81

Query  316  EKVGLPTPPPYLS-----DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFS  480
            EK+GLPT PPYLS     +K+N FL GV+FASGGAGI + ++N I  +++ L+ Q+  +S
Sbjct  82   EKLGLPTSPPYLSLTSATNKSNAFLGGVNFASGGAGILDGSDN-IFKQSIPLNKQIEYYS  140

Query  481  TVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            TV   +V Q+GA  A++  SKS + I+IG+ND++ YF+
Sbjct  141  TVYGDMVQQLGAVGAQKYFSKSIYGIVIGSNDILGYFH  178



>ref|XP_009361011.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Pyrus x bretschneideri]
Length=368

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 117/158 (74%), Gaps = 8/158 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA+YVFGDSLVDVGNN+++  S+ +ADFPHNGVDYPG+ ATGR+ NG NSADFLA
Sbjct  31   EAQMVPAIYVFGDSLVDVGNNDYLKISVFKADFPHNGVDYPGKVATGRWGNGKNSADFLA  90

Query  316  EKVGLPTPPPYLS------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EKVGLPT PPYLS       +   F+ GVSFASGGAGIFN ++     +A+ LS QV  +
Sbjct  91   EKVGLPTSPPYLSLVSKSNKRKASFVDGVSFASGGAGIFNGSDEQ-YRQAIPLSYQVNYY  149

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            S V Q +  Q+G+  AK  LSKS FLI+IG+ND+  YF
Sbjct  150  SEVHQNIGLQLGSKGAKDHLSKSLFLIVIGSNDIFGYF  187



>ref|XP_008364943.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Malus domestica]
Length=368

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 119/158 (75%), Gaps = 8/158 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA+YVFGDSLVDVGNN+++  S+ +ADFPHNGVDYPG+ ATGR+ NG NSADFLA
Sbjct  31   EAQMVPAIYVFGDSLVDVGNNDYLTISVFKADFPHNGVDYPGKVATGRWGNGKNSADFLA  90

Query  316  EKVGLPTPPPYLS--DKNN----VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EKVGLPT PPYLS   K+N     F+ GVSFASGGAGIFN ++     +A+ LS QV  +
Sbjct  91   EKVGLPTSPPYLSLVSKSNKXKASFVNGVSFASGGAGIFNGSDEQ-YRQAIPLSYQVNYY  149

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            S V Q +  Q+G+  AK  LSKS FLI+IG+ND+  YF
Sbjct  150  SEVHQNIGLQLGSKGAKDHLSKSLFLIVIGSNDIFGYF  187



>emb|CAN78085.1| hypothetical protein VITISV_034041 [Vitis vinifera]
Length=364

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 119/158 (75%), Gaps = 8/158 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ  PA+++FGDSLVDVGNNNH+  S+ +ADFPHNGVD+PG+K TGRF NG N+ADFLA
Sbjct  24   EAQLAPALFMFGDSLVDVGNNNHLKLSLAKADFPHNGVDFPGKKPTGRFCNGKNAADFLA  83

Query  316  EKVGLPTPPPY------LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EK+GLP+ PPY          N  F+ GVSFASGGAGIF+ T + +  ++L L  QV  +
Sbjct  84   EKLGLPSAPPYLSLISKSKSSNESFVAGVSFASGGAGIFDGT-DALYKQSLPLKKQVDYY  142

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +TV ++LV Q+G+A A++ LSKS F ++IG+ND++ Y+
Sbjct  143  ATVYERLVQQLGSAGAQEHLSKSVFAVVIGSNDILGYY  180



>ref|XP_002529910.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF32464.1| zinc finger protein, putative [Ricinus communis]
Length=358

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 121/155 (78%), Gaps = 5/155 (3%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA++VFGDSLVDVGNNNH+  SI +A+FPHNGVD+P +KATGRFSNG N+ADFLAE
Sbjct  24   AQMVPAVFVFGDSLVDVGNNNHLPVSIAKANFPHNGVDFPNKKATGRFSNGKNAADFLAE  83

Query  319  KVGLPTPPPYL--SDKN-NVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
            KVGLPT PPYL  S KN + F+ GVSFASGGAGIFN T+   + +++ L+ QV  + +V 
Sbjct  84   KVGLPTSPPYLSVSSKNTSAFMTGVSFASGGAGIFNGTDQS-LGQSIPLTKQVGYYESVY  142

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +LV  +GA+AA+  LSKS F I+IG+ND+  Y N
Sbjct  143  GQLVQNLGASAAQNLLSKSLFAIVIGSNDIFGYSN  177



>ref|XP_008366441.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Malus domestica]
Length=368

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 119/157 (76%), Gaps = 8/157 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA+YVFGDSLVDVGNNN++  S+ +A+FPHNGVDYPG+ ATGRF NG NSADFLA
Sbjct  31   EAQMVPAIYVFGDSLVDVGNNNYLKISLAKANFPHNGVDYPGKVATGRFGNGKNSADFLA  90

Query  316  EKVGLPTPPPYLS--DKNN----VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EKVGLP  PPYLS   K+N     F+ GVSFASGGAGIFN ++N    +++ LS QV  +
Sbjct  91   EKVGLPPSPPYLSLVSKSNKQKASFVNGVSFASGGAGIFNGSDNQ-FRQSIPLSYQVNYY  149

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            S V Q +  Q+G+  AK  LSKS FLI+IG+ND+ +Y
Sbjct  150  SEVYQNIRLQLGSEGAKDHLSKSLFLIVIGSNDIFDY  186



>ref|XP_002317343.1| hypothetical protein POPTR_0011s09200g [Populus trichocarpa]
 gb|EEE97955.1| hypothetical protein POPTR_0011s09200g [Populus trichocarpa]
Length=361

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 121/153 (79%), Gaps = 5/153 (3%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA++VFGDSLVDVGNNN++  S+ +ADFPHNG+D+P +KATGRFSNG N+ADFLA+
Sbjct  25   AQMVPAIFVFGDSLVDVGNNNYLPVSVAKADFPHNGIDFPTKKATGRFSNGKNAADFLAQ  84

Query  319  KVGLPTPPPYLS---DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
            KVGLPT PPYLS      + F+ GVSFASGGAGIFN T+   + +A+ L+ QV  + +V 
Sbjct  85   KVGLPTSPPYLSVSPQNTSSFMTGVSFASGGAGIFNGTDR-TLGQAIPLTKQVGNYESVY  143

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
             KL+ ++G + A+++LSKS F+I+IG+ND+ +Y
Sbjct  144  GKLIQRLGLSGAQKRLSKSLFVIVIGSNDIFDY  176



>ref|XP_010244496.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Nelumbo nucifera]
Length=358

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            E Q VPA+++FGDSLVDVGNNNH+  S+ +ADFPHNGVD+PG+K TGRFSNG N+ADFLA
Sbjct  19   ETQLVPAIFMFGDSLVDVGNNNHLKLSLAKADFPHNGVDFPGKKPTGRFSNGRNAADFLA  78

Query  316  EKVGLPTPPPYLS-----DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFS  480
            EK+GL T PPYLS     +K+N FL G SFASGGAGI + T+  +  +++ L+ Q+  +S
Sbjct  79   EKLGLQTSPPYLSLVSATNKSNAFLGGASFASGGAGILDGTDT-LFKQSISLNKQIEYYS  137

Query  481  TVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            TV   LV Q+G   A+   SKS + I+IG+ND++ YF
Sbjct  138  TVYGDLVQQLGTVEAQTYFSKSLYGIVIGSNDILGYF  174



>ref|XP_012070852.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Jatropha curcas]
 gb|KDP39148.1| hypothetical protein JCGZ_00905 [Jatropha curcas]
Length=363

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 5/155 (3%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA++VFGDSLVDVGNNNH+  SI +A+FPHNG+D+P +KATGRF+NG N+ADFLAE
Sbjct  29   AQMVPAVFVFGDSLVDVGNNNHLPVSIAKANFPHNGIDFPNKKATGRFTNGKNAADFLAE  88

Query  319  KVGLPTPPPYLSDK---NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
            KVGLPT PPYLS K    + F+ GVSFASGGAGI N T+   + +++ L+ QV  + +V 
Sbjct  89   KVGLPTSPPYLSLKFKTASAFMTGVSFASGGAGIINGTDEK-LGQSITLTRQVGDYESVY  147

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             KLV  +GA+A +  LSKS F I+IG+ND+ +Y N
Sbjct  148  GKLVENMGASATQNLLSKSLFAIVIGSNDIFDYSN  182



>ref|XP_009361012.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Pyrus x bretschneideri]
Length=368

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 8/157 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA+YVFGDSLVDVGNN+++  S+++A+FPHNGVDYP + ATGRF NG NSADFLA
Sbjct  31   EAQMVPAIYVFGDSLVDVGNNDYLKISVVKANFPHNGVDYPDKVATGRFGNGKNSADFLA  90

Query  316  EKVGLPTPPPYLS------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EKVGLPT PPYLS       +   F+ GVSFASGGAGIFN ++     +++ LS QV  +
Sbjct  91   EKVGLPTSPPYLSLVSKSIKQKASFVNGVSFASGGAGIFNGSDEQ-YRQSIPLSYQVNYY  149

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            S V Q +  Q+G+  A   LSKS FLI+IG+ND+ +Y
Sbjct  150  SEVHQNIGLQLGSKGANDHLSKSLFLIVIGSNDIFDY  186



>gb|KHN02853.1| GDSL esterase/lipase [Glycine soja]
Length=359

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 120/161 (75%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQK PA+YVFGDSLVD+GNNN++  SI +A  PH G+D+P +K TGRFSNG N+AD +A
Sbjct  19   EAQKAPAVYVFGDSLVDIGNNNYLSLSIEKAILPHYGIDFPTKKPTGRFSNGKNAADLIA  78

Query  316  EKVGLPTPPPYLS-------DKNNV-FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GLPT PPYLS       + NNV FL+GV+FASGGAGIFN ++NG   +++ L  QV 
Sbjct  79   EKLGLPTSPPYLSLVSKVHNNSNNVSFLRGVNFASGGAGIFNVSDNG-FRQSIPLPKQVD  137

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +S V ++L  QIGA++  + LSKS F+++IG ND+  YF+
Sbjct  138  YYSLVHEQLAQQIGASSLGKHLSKSIFIVVIGGNDIFGYFD  178



>ref|XP_011012091.1| PREDICTED: GDSL esterase/lipase At5g55050 [Populus euphratica]
Length=447

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 119/153 (78%), Gaps = 5/153 (3%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA++VFGDSLVDVGNNN++  S+ +ADFPHNG+D+P  KATGRFSNG N+ADFLA+
Sbjct  111  AQMVPAIFVFGDSLVDVGNNNYLPVSVAKADFPHNGIDFPTEKATGRFSNGKNAADFLAQ  170

Query  319  KVGLPTPPPYLS---DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
            KVGLPT PPYLS      + F+ GVSFASGGAGIFN T+   + +A+ LS QV  + +V 
Sbjct  171  KVGLPTSPPYLSVSRKNTSSFMTGVSFASGGAGIFNGTDR-TLGQAIPLSKQVGNYESVY  229

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
              L+ ++G + A+++LSKS F+I+IG+ND+ +Y
Sbjct  230  GNLIQRLGLSGAQKRLSKSLFVIVIGSNDIFDY  262



>ref|XP_009392767.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 9/152 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            V A+YVFGDSL DVGNNNH++ S+++ADFPHNGVD+PG KATGRFSNG NSADFLAE +G
Sbjct  30   VSAVYVFGDSLADVGNNNHLELSLLKADFPHNGVDFPGHKATGRFSNGKNSADFLAESLG  89

Query  328  LPTPPPYL-----SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
            LPT PPYL     S+  +VFL GV+FASGG G+ +STN     + +  + Q+  +S+V  
Sbjct  90   LPTSPPYLDITSSSNNTDVFLGGVNFASGGGGVLDSTNK---DQCISFNKQIDYYSSVYT  146

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
             LV Q+G+A A+  LS S F  +IG+ND++NY
Sbjct  147  ALVQQLGSAQAQAHLSTSIFAFVIGSNDILNY  178



>ref|XP_004982523.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=362

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 107/148 (72%), Gaps = 5/148 (3%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            VPA+YVFGDSL DVGNNNH+ +++RADFPHNG+DYPGRKATGRFSNG NS DFLA+ +GL
Sbjct  35   VPAIYVFGDSLADVGNNNHLPTLLRADFPHNGIDYPGRKATGRFSNGKNSVDFLADSLGL  94

Query  331  PTPPPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVN  504
             +PPPY  LS  N  +  GV+FASGGAG+ N+TN G   + +    Q+  FS+V   L  
Sbjct  95   ASPPPYLALSRSNANYANGVNFASGGAGVSNATNKG---QCISFDKQIDYFSSVNASLAQ  151

Query  505  QIGAAAAKQQLSKSPFLILIGNNDLINY  588
             +G A     L+KS F I IG+ND+I+Y
Sbjct  152  SLGQAQTTAHLAKSLFAITIGSNDIIHY  179



>gb|KHM99548.1| GDSL esterase/lipase [Glycine soja]
Length=365

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 118/161 (73%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQK PA+YVFGDSLVDVGNNN++  SI +A  PH G+D+P +K TGRFSNG N+AD +A
Sbjct  25   EAQKAPAVYVFGDSLVDVGNNNYLSLSIEKAILPHYGIDFPTKKPTGRFSNGKNAADLIA  84

Query  316  EKVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GLPT PPYLS        +KN  FL GV+FASGGAGIFN+++ G   +++ L  QV 
Sbjct  85   EKLGLPTSPPYLSLVSKVHNNNKNVSFLGGVNFASGGAGIFNASDKG-FRQSIPLPKQVD  143

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +S V ++L+ QIGA+   + LSKS F+++IG ND+  YF+
Sbjct  144  YYSQVHEQLIQQIGASTLGKHLSKSIFIVVIGGNDIFGYFD  184



>ref|XP_010096889.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB66343.1| GDSL esterase/lipase [Morus notabilis]
Length=370

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 115/155 (74%), Gaps = 5/155 (3%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ+VPA+YVFGDSLVDVGNNN++  S+ +A++P NGVD+PGRKATGRF NG N+ADFLA
Sbjct  34   EAQQVPAIYVFGDSLVDVGNNNYLKLSLAKANYPPNGVDFPGRKATGRFCNGKNAADFLA  93

Query  316  EKVGLPTPPPYL---SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
            EKVGL T PPYL   S+ N     G+SFASGGAGIFN T+     +++ L+ QV  +S V
Sbjct  94   EKVGLATSPPYLSRTSNSNKDTSTGISFASGGAGIFNGTDE-FYRQSIPLTKQVEHYSKV  152

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             ++LV ++G    +  LSKS F I+IG+NDL  YF
Sbjct  153  HEQLVQELGIGGTEVHLSKSLFAIVIGSNDLFGYF  187



>ref|XP_007146498.1| hypothetical protein PHAVU_006G045800g [Phaseolus vulgaris]
 gb|ESW18492.1| hypothetical protein PHAVU_006G045800g [Phaseolus vulgaris]
Length=366

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 118/161 (73%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQK PA+YVFGDSLVDVGNNN++  SI +A  PH G+D+P +K  GRF+NG N+AD +A
Sbjct  26   EAQKAPAVYVFGDSLVDVGNNNYLSFSIEKAILPHYGIDFPTKKPAGRFTNGKNAADLIA  85

Query  316  EKVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GLPT PPYLS        +KN  FL GV+FASGGAGIFN+++ G + +++ L  QV 
Sbjct  86   EKLGLPTSPPYLSLLSKVHNPNKNISFLGGVNFASGGAGIFNASDKGFM-QSIPLQKQVD  144

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +S V +KL  QIGA+  ++ LSKS F+++IG ND+  YF+
Sbjct  145  YYSQVHEKLTQQIGASTLEKHLSKSIFIVVIGGNDVFGYFD  185



>ref|XP_004296519.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 122/184 (66%), Gaps = 8/184 (4%)
 Frame = +1

Query  64   ACSLRKMNVFIVflsfsfflsgsfsEAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPH  240
            ACS+     F +F                VPA+Y+FGDSL+DVGNNN++  S+ +A+FPH
Sbjct  5    ACSVSPTTFFTIFSIILSVFIAFSDAQSTVPAIYIFGDSLLDVGNNNYLTVSVAKANFPH  64

Query  241  NGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPPPYLS------DKNNVFLKGVSFASGG  402
            NG+D+P +KATGRFSNG NSADFLAEKVGLPT PPYLS       +   F+ GVSFASGG
Sbjct  65   NGIDFPTKKATGRFSNGKNSADFLAEKVGLPTSPPYLSLVSKSNKQKGSFVAGVSFASGG  124

Query  403  AGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLI  582
            AGIFN T++    ++L L+ QV  ++ V  +L  Q+G  AA+  L+KS  ++LIG+ND+ 
Sbjct  125  AGIFNGTDDE-YRQSLPLTKQVGYYAQVCAELQQQLGTQAAQAHLAKSLHVVLIGSNDVF  183

Query  583  NYFN  594
             Y +
Sbjct  184  GYLD  187



>ref|XP_007214120.1| hypothetical protein PRUPE_ppa017940mg [Prunus persica]
 gb|EMJ15319.1| hypothetical protein PRUPE_ppa017940mg [Prunus persica]
Length=362

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 121/159 (76%), Gaps = 8/159 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +AQ VPA+YVFGDSL DVGNNN++  S+++A+FPHNGVD+P +KATGRF NG NSADFLA
Sbjct  25   KAQMVPAIYVFGDSLADVGNNNYLKISLLKANFPHNGVDFPNKKATGRFGNGKNSADFLA  84

Query  316  EKVGLPTPPPYL-----SDKNNV-FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EKVGLPT PPYL     S+K N+ F+ GVSFASGGAGIFN ++     +++ LS QV  +
Sbjct  85   EKVGLPTSPPYLSLVSKSNKQNLSFVAGVSFASGGAGIFNGSDEK-FRQSIPLSYQVNYY  143

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            S V + +  ++G+  A+  LSKS F+I+IG+ND+  YF+
Sbjct  144  SQVYEDIGLELGSNGAQDHLSKSLFVIVIGSNDIFAYFD  182



>ref|XP_008363583.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Malus domestica]
Length=368

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 117/157 (75%), Gaps = 8/157 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA+YVFGDSL DVGNN+++  S+++A+FPHNGVDYP + ATGRF NG NSADF+A
Sbjct  31   EAQMVPAIYVFGDSLXDVGNNDYLKISVVKANFPHNGVDYPDKVATGRFGNGKNSADFIA  90

Query  316  EKVGLPTPPPYLS--DKNN----VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            +KVGLPT PPYLS   K+N     F+ GVSFASGGAGIFN ++     +++ LS QV  +
Sbjct  91   ZKVGLPTSPPYLSLVSKSNKQKASFVNGVSFASGGAGIFNGSDEQ-YRQSIPLSYQVNYY  149

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            S V Q +  Q+GA  A   LSKS FLI+IG+ND+ +Y
Sbjct  150  SEVHQNIGLQLGAKGANDHLSKSLFLIVIGSNDIFDY  186



>ref|XP_004986408.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=368

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 107/148 (72%), Gaps = 5/148 (3%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            VPA+YV GDS+ DVGNNNH+ + +RADFPHNG+DYPGRKATGRFSNGNNS DF+A+ +GL
Sbjct  40   VPAIYVLGDSIADVGNNNHLPTFLRADFPHNGIDYPGRKATGRFSNGNNSVDFIADNLGL  99

Query  331  PTPPPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVN  504
             +PPPY  LS  N  +  GV+FASGGAG+  +TN G+    +    Q+  FS+V   L  
Sbjct  100  ASPPPYLALSRSNANYANGVNFASGGAGVSKATNKGLC---ISFDKQIDYFSSVYASLAQ  156

Query  505  QIGAAAAKQQLSKSPFLILIGNNDLINY  588
             +G A A   LSKS F+I IG+ND+I+Y
Sbjct  157  SLGQAQAAAHLSKSLFVITIGSNDIIHY  184



>ref|XP_010666213.1| PREDICTED: GDSL esterase/lipase At5g55050 [Beta vulgaris subsp. 
vulgaris]
Length=362

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 124/176 (70%), Gaps = 5/176 (3%)
 Frame = +1

Query  76   RKMNVFIVflsfsfflsgsfsEAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVD  252
             K   F++      F++   S AQ  PA++VFGDSLVDVGNNNH+  S+++ADFPHNG+D
Sbjct  3    EKFTFFLLMFCMLIFINLKSSRAQLAPALFVFGDSLVDVGNNNHLPFSLLKADFPHNGID  62

Query  253  YPGRKATGRFSNGNNSADFLAEKVGLPTPPPYLS---DKNNVFLKGVSFASGGAGIFNST  423
            +P  K TGRFSNG N+ADFLAEK+GL + PPYLS    K++ F  GVSFASGGAGIF+  
Sbjct  63   FPNHKPTGRFSNGKNAADFLAEKLGLLSSPPYLSLTRIKSSNFSAGVSFASGGAGIFDG-  121

Query  424  NNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            ++ I  K++  + Q+  + TVQ K+V Q+GA  A++ +SKS   I+IG+ND + YF
Sbjct  122  DDKIYHKSITFNKQISYYGTVQAKMVEQLGATKAEKMISKSVIAIVIGSNDFLGYF  177



>gb|KHG14306.1| hypothetical protein F383_02930 [Gossypium arboreum]
Length=367

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 116/155 (75%), Gaps = 6/155 (4%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA++VFGDSLVDVGNNN++  SI +ADFPHNG+D+P RK TGRFSNG N+AD LAE
Sbjct  31   AQMVPAVFVFGDSLVDVGNNNYLPVSIAKADFPHNGIDFPTRKPTGRFSNGKNAADLLAE  90

Query  319  KVGLPTPPPYLS----DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
            K+GLP+ PPYLS       + ++ GVSFASGGAGIFN T+     +++ L  QV  +  V
Sbjct  91   KLGLPSSPPYLSLLKKTDESSYINGVSFASGGAGIFNGTDQ-TYGQSIPLLKQVDNYIVV  149

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             + LV Q+G+  A++ LSKS F I+IG+ND+++YF
Sbjct  150  YKSLVQQMGSPGAEKHLSKSLFTIVIGSNDILDYF  184



>ref|XP_008226872.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Prunus mume]
Length=365

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 120/159 (75%), Gaps = 8/159 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +AQ VPA+YVFGDSL DVGNNN++  S+++A+FPHNGVD+P +KATGRF NG NSADFLA
Sbjct  28   KAQMVPAIYVFGDSLADVGNNNYLKISLLKANFPHNGVDFPNKKATGRFGNGKNSADFLA  87

Query  316  EKVGLPTPPPYLS--DKNN----VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EKVGLPT PPYLS   K+N     F+ GVSFASGGAGIFN ++     +++ LS QV  +
Sbjct  88   EKVGLPTSPPYLSLVSKSNKQDLSFVAGVSFASGGAGIFNGSDEK-FRQSIPLSYQVNYY  146

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            S V + +  ++G+  A+  LSKS F+I+IG+ND+  YF+
Sbjct  147  SQVYEDIGLELGSNGAQDHLSKSLFVIVIGSNDIFAYFD  185



>ref|XP_006602197.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Glycine max]
Length=359

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 117/161 (73%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQK PA+YVFGDSLVD+GNNN++  SI +A  PH G+D+P +K TGRFSNG N+AD +A
Sbjct  19   EAQKAPAVYVFGDSLVDIGNNNYLSLSIEKAILPHYGIDFPTKKPTGRFSNGKNAADLIA  78

Query  316  EKVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GLPT PPYLS          N  FL+GV+FASGGAGIFN ++NG   +++ L  QV 
Sbjct  79   EKLGLPTSPPYLSLVSNVHNNSNNVSFLRGVNFASGGAGIFNVSDNG-FRQSIPLPKQVD  137

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +S V ++L  QIGA++  + LSKS F+++IG ND+  YF+
Sbjct  138  YYSLVHEQLAQQIGASSLGKHLSKSIFIVVIGGNDIFGYFD  178



>gb|KJB13709.1| hypothetical protein B456_002G090200 [Gossypium raimondii]
Length=344

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 116/155 (75%), Gaps = 6/155 (4%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA++VFGDSLVDVGNNN++  SI +ADFPHNG+D+P +K TGRFSNG N+AD LAE
Sbjct  31   AQMVPAVFVFGDSLVDVGNNNYLPVSIAKADFPHNGIDFPTKKPTGRFSNGKNAADLLAE  90

Query  319  KVGLPTPPPYLS----DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
            K+GLP+ PPYLS       + ++ GVSFASGGAGIFN T+     +++ L  QV  +  V
Sbjct  91   KLGLPSSPPYLSLLKKTDESAYINGVSFASGGAGIFNGTDQ-TYGQSIPLLKQVDNYIVV  149

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             + LV Q+G + A++ LSK+ F I+IG+ND+++YF
Sbjct  150  YKSLVQQMGPSGAEKHLSKALFTIVIGSNDMLDYF  184



>ref|XP_003600128.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES70379.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=368

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 115/161 (71%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQK PA+YVFGDSLVDVGNNNH+  S+++A  P+ G+D+P +K TGRFSNG N+AD +A
Sbjct  27   EAQKTPAIYVFGDSLVDVGNNNHLTLSLVKAILPYYGIDFPTKKPTGRFSNGKNAADLIA  86

Query  316  EKVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GL T PPYLS         KN  FL GV+FASGGAGIFN T +  I +++ L+ QV 
Sbjct  87   EKIGLATSPPYLSLVSKINFNKKNVSFLHGVNFASGGAGIFNGT-DPTIRQSISLTKQVD  145

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +S V +KL  Q  A+  ++ LSKS F I+IG+ND+  Y+N
Sbjct  146  YYSQVHEKLTQQTEASTLQKHLSKSIFAIVIGSNDIFGYYN  186



>ref|XP_008345049.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Malus domestica]
Length=368

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 116/157 (74%), Gaps = 8/157 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA+YVFGDSL DVGNN+++  S+++A+FPHNGVDYP + ATGRF NG NSADF+A
Sbjct  31   EAQMVPAIYVFGDSLXDVGNNDYLKISVVKANFPHNGVDYPDKVATGRFGNGKNSADFIA  90

Query  316  EKVGLPTPPPYLS--DKNN----VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            +KVGLPT PPYLS   K+N     F+ GVSFASGGAGIFN ++     +++ LS QV  +
Sbjct  91   ZKVGLPTSPPYLSLVSKSNKQKASFVNGVSFASGGAGIFNGSDEQ-YRQSIPLSYQVNYY  149

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            S V Q +  Q+G   A   LSKS FLI+IG+ND+ +Y
Sbjct  150  SEVHQNIGLQLGXKGANDHLSKSLFLIVIGSNDIFDY  186



>ref|XP_003532134.1| PREDICTED: GDSL esterase/lipase At5g55050 [Glycine max]
Length=366

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 116/162 (72%), Gaps = 11/162 (7%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQK PA+YVFGDSLVDVGNNN++  SI +A  PH G+D+P +K TGRFSNG N+AD +A
Sbjct  25   EAQKAPAVYVFGDSLVDVGNNNYLSLSIEKAILPHYGIDFPTKKPTGRFSNGKNAADLIA  84

Query  316  EKVGLPTPPPYLS---------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
            E +GLPT PPYLS          KN  FL GV+FASGGAGIFN+++ G   +++ L  QV
Sbjct  85   ENLGLPTSPPYLSLVSKVHNNNKKNVSFLGGVNFASGGAGIFNASDKG-FRQSIPLPKQV  143

Query  469  RLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
              +S V ++L+ QIGA+   + LSKS F+++IG ND+  YF+
Sbjct  144  DYYSQVHEQLIQQIGASTLGKHLSKSIFIVVIGGNDIFGYFD  185



>ref|XP_008385871.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Malus domestica]
Length=368

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 127/187 (68%), Gaps = 9/187 (5%)
 Frame = +1

Query  52   MMGFACSLRKMNVFIVflsfsfflsgsfsEAQKVPAMYVFGDSLVDVGNNNHID-SIIRA  228
            M  +   +  M  F+VF  F      + SEAQ VPA+YVFGDSL DVGNNN++  S+++A
Sbjct  1    MAKYHTDVLPMASFVVFSLFITSFIVTLSEAQMVPAIYVFGDSLADVGNNNYLKISLVKA  60

Query  229  DFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPPPYLS--DKNN-----VFLKGVS  387
            +FPHNGVDYP + ATGRF NG NSADFLAEK+GL   PPYL+   K+N      F+ GVS
Sbjct  61   NFPHNGVDYPDKVATGRFGNGKNSADFLAEKIGLLPSPPYLALVSKSNRRKILSFVDGVS  120

Query  388  FASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIG  567
            FASGGAGIFN ++     +++ LS QV  +S V Q +  Q+G+  AK  LSKS FL++IG
Sbjct  121  FASGGAGIFNGSDEQ-FRQSIPLSYQVNYYSEVHQNIGLQLGSEGAKDHLSKSLFLLVIG  179

Query  568  NNDLINY  588
            +ND+ +Y
Sbjct  180  SNDIFDY  186



>gb|KJB13708.1| hypothetical protein B456_002G090200 [Gossypium raimondii]
Length=387

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 116/155 (75%), Gaps = 6/155 (4%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA++VFGDSLVDVGNNN++  SI +ADFPHNG+D+P +K TGRFSNG N+AD LAE
Sbjct  51   AQMVPAVFVFGDSLVDVGNNNYLPVSIAKADFPHNGIDFPTKKPTGRFSNGKNAADLLAE  110

Query  319  KVGLPTPPPYLS----DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
            K+GLP+ PPYLS       + ++ GVSFASGGAGIFN T+     +++ L  QV  +  V
Sbjct  111  KLGLPSSPPYLSLLKKTDESAYINGVSFASGGAGIFNGTDQ-TYGQSIPLLKQVDNYIVV  169

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             + LV Q+G + A++ LSK+ F I+IG+ND+++YF
Sbjct  170  YKSLVQQMGPSGAEKHLSKALFTIVIGSNDMLDYF  204



>gb|ACJ84395.1| unknown [Medicago truncatula]
Length=221

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 113/161 (70%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +AQK PA+YVFGDSLVDVGNNN++  S+++A  PH G+D+P +K TGRFSNG N+AD +A
Sbjct  26   KAQKTPAIYVFGDSLVDVGNNNYLTLSLVKATLPHYGIDFPTKKPTGRFSNGKNAADLIA  85

Query  316  EKVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GL T PPYLS         KN  FL GV+FASGGAGIFN T+     +++ L+ QV 
Sbjct  86   EKLGLATSPPYLSLVSKINFNKKNVSFLDGVNFASGGAGIFNGTDEN-FRQSIPLTKQVD  144

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +S + +KL  Q  A+  +  LSKS F ++IG+ND+  YFN
Sbjct  145  YYSQMHEKLTQQTEASILQNHLSKSIFAVVIGSNDIFGYFN  185



>ref|XP_004500091.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Cicer arietinum]
Length=366

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 118/162 (73%), Gaps = 11/162 (7%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +AQK PA+YVFGDSLVDVGNNN++  S+++A  PH G+D+P ++ TGRFSNG N+AD +A
Sbjct  25   DAQKTPAIYVFGDSLVDVGNNNYLTLSLVKATLPHYGIDFPTKRPTGRFSNGKNAADLIA  84

Query  316  EKVGLPTPPPYLS---------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
            EKVGLPT PPYLS         +KN  FL GV+FASGGAGIFN T++    +++ L+ QV
Sbjct  85   EKVGLPTSPPYLSLICKVKNNNNKNVSFLSGVNFASGGAGIFNGTDDN-FRQSIPLTKQV  143

Query  469  RLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
              +S V  +L  QIGA+  ++ LSKS F+++IG+ND+  Y N
Sbjct  144  DYYSQVHDQLTQQIGASTLQKHLSKSIFIVVIGSNDIFGYSN  185



>ref|XP_010060321.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Eucalyptus grandis]
 gb|KCW66982.1| hypothetical protein EUGRSUZ_F00746 [Eucalyptus grandis]
Length=399

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 115/159 (72%), Gaps = 10/159 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            E Q VPA +VFGDSLVDVGNNNH+  S+ +ADFPHNG+D+P +KATGRFSNG N+ADFLA
Sbjct  56   EGQMVPAAFVFGDSLVDVGNNNHLPVSLAKADFPHNGMDFPNKKATGRFSNGKNTADFLA  115

Query  316  EKVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GLP  PPYL+        + ++ FL GVSFASGGAGI + T      +++ L+ QV 
Sbjct  116  EKLGLPPSPPYLALVSNSSKSNSSSQFLTGVSFASGGAGILDGTAEK-YKQSIPLTKQVE  174

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
             +  V + LV  +G++ AKQ ++KS F+I+IG+ND+  Y
Sbjct  175  YYLAVHESLVQHMGSSGAKQHVTKSLFIIVIGSNDIFGY  213



>gb|KJB81722.1| hypothetical protein B456_013G158800 [Gossypium raimondii]
Length=366

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 119/155 (77%), Gaps = 5/155 (3%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA++VFGDS VDVGNNNH+  SI +A+FPHNGVD+P +KATGR+SNG N+ADFLA
Sbjct  32   EAQMVPALFVFGDSQVDVGNNNHLFFSIAKANFPHNGVDFPTKKATGRYSNGKNAADFLA  91

Query  316  EKVGLPTPPPYLSDKNNV---FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
            EK+GL + P YLS  +N    ++ GVSFASGG+GI N T++ ++ +++ LSDQV  F +V
Sbjct  92   EKLGLSSSPAYLSLSSNTHASYMNGVSFASGGSGILN-TSSQVLGQSIPLSDQVNNFLSV  150

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             + ++ ++G    ++  SKS F I+IG+ND++NYF
Sbjct  151  HKVMLQKMGTDGLEKHFSKSLFAIVIGSNDILNYF  185



>ref|XP_004149351.2| PREDICTED: GDSL esterase/lipase At5g55050 [Cucumis sativus]
 gb|KGN56112.1| hypothetical protein Csa_3G075990 [Cucumis sativus]
Length=362

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 112/155 (72%), Gaps = 10/155 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YVFGDSLVDVGNNNH+  S+ +A+FPHNG+D+P +K TGRFSNG N+ADF+AE+VG
Sbjct  27   VPAIYVFGDSLVDVGNNNHLKLSLAKANFPHNGLDFPTKKPTGRFSNGKNAADFVAERVG  86

Query  328  LPTPPPYLSDKNNV--------FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            L T PPYLS  +          F  GVSFASGGAGIFN TNN +  +++ +  Q+ L+S 
Sbjct  87   LATSPPYLSLISKFRKTVNTAPFKTGVSFASGGAGIFNETNN-LFKQSVAMEQQIELYSR  145

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            V   LV ++G++ A   LSKS F I+IG+ND+  Y
Sbjct  146  VYTNLVGELGSSGAAAHLSKSLFTIVIGSNDIFGY  180



>ref|XP_008449153.1| PREDICTED: GDSL esterase/lipase At5g55050 [Cucumis melo]
Length=365

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 112/155 (72%), Gaps = 10/155 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YVFGDSLVDVGNNNH+  S+ +A+FPHNG+D+P +K TGRFSNG N+ADF+AE+VG
Sbjct  30   VPAIYVFGDSLVDVGNNNHLKLSLAKANFPHNGLDFPTKKPTGRFSNGKNAADFVAERVG  89

Query  328  LPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            L T PPYLS             F  GVSFASGGAGIFN TNN +  +++ +  Q+ L+S 
Sbjct  90   LATSPPYLSLISKFRKTVNTTPFKTGVSFASGGAGIFNETNN-LFKQSVAMDQQIELYSR  148

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            V + LV ++G++ A   LSKS F ++IG+ND+  Y
Sbjct  149  VYKHLVGELGSSGAAAHLSKSLFTVVIGSNDIFGY  183



>gb|ACU23301.1| unknown [Glycine max]
Length=366

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 115/162 (71%), Gaps = 11/162 (7%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQK PA+YVFGDSLVDVGNNN++  SI +A  PH G+D+P +K TGRFSNG N+AD +A
Sbjct  25   EAQKAPAVYVFGDSLVDVGNNNYLSLSIEKAILPHYGIDFPTKKPTGRFSNGKNAADLIA  84

Query  316  EKVGLPTPPPYLS---------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
              +GLPT PPYLS          KN  FL GV+FASGGAGIFN+++ G   +++ L  QV
Sbjct  85   GNLGLPTSPPYLSLVSKVHNNNKKNVSFLGGVNFASGGAGIFNASDKG-FRQSIPLPKQV  143

Query  469  RLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
              +S V ++L+ QIGA+   + LSKS F+++IG ND+  YF+
Sbjct  144  DYYSQVHEQLIQQIGASTLGKHLSKSIFIVVIGGNDIFGYFD  185



>ref|NP_001147457.1| anther-specific proline-rich protein APG [Zea mays]
 gb|ACG27609.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACN34236.1| unknown [Zea mays]
 tpg|DAA50122.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=377

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 6/149 (4%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            VPA+YV GDSL DVGNNNH+ ++++ADFPHNG+DYPG+KATGRFSNG NS DFLAE +GL
Sbjct  38   VPAIYVLGDSLADVGNNNHLVTLLKADFPHNGIDYPGQKATGRFSNGKNSVDFLAENLGL  97

Query  331  PTPPPYL---SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
             T PPYL   S  N  +  GV+FASGGAG+ N TN     + +    Q+  F+TV   LV
Sbjct  98   ATSPPYLALSSSSNPNYANGVNFASGGAGVSNLTNK---DQCISFDKQIDYFATVYASLV  154

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLINY  588
              +G A A   L+KS F I IG+ND+I+Y
Sbjct  155  QSLGQAQATAHLAKSLFAITIGSNDIIHY  183



>gb|KEH33842.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=388

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 115/160 (72%), Gaps = 9/160 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQKVPA+YVFGDSLVDVGNNN++ D+  +A FP+ G+D+P +K  GRF NG N+AD +A
Sbjct  22   EAQKVPAVYVFGDSLVDVGNNNYLNDTFAKAIFPYYGIDFPTKKPAGRFCNGKNAADLIA  81

Query  316  EKVGLPTPPPYLS-------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            EKVGL T PPYLS       +KN  FL GV+FASGGAGIF   +   + +++HL++QV  
Sbjct  82   EKVGLATSPPYLSLASSKVKNKNVSFLSGVNFASGGAGIFKGIDPNYM-RSIHLTEQVDY  140

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            +S + ++   QI  +  ++ LS+S F ++IGNND+ +YFN
Sbjct  141  YSQMYEESTKQIEVSTLQKHLSESIFFVVIGNNDIFDYFN  180



>ref|XP_009392780.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 111/153 (73%), Gaps = 9/153 (6%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            +V A+YVFGDSL DVGNNNH+  S+++ADFPHNGVD+PG KATGRFSNG NSADFLAEK+
Sbjct  28   EVSAVYVFGDSLADVGNNNHLGLSLLKADFPHNGVDFPGHKATGRFSNGKNSADFLAEKL  87

Query  325  GLPTPPPYL---SDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
            G PT P YL   S  NN   FL GV+FASGG G+ +STN     + +  + Q+  +S+V 
Sbjct  88   GRPTSPAYLSIPSSSNNTDEFLGGVNFASGGGGVLDSTNK---DQCISFNKQIDYYSSVY  144

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
              LV Q+G+A  +  LS S F ++IG+ND++NY
Sbjct  145  AALVQQLGSAQTQAHLSNSVFALVIGSNDILNY  177



>ref|XP_003600129.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES70380.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=366

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 113/161 (70%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +AQK PA+YVFGDSLVDVGNNN++  S+++A  PH G+D+P +K TGRFSNG N+AD +A
Sbjct  26   KAQKTPAIYVFGDSLVDVGNNNYLTLSLVKATLPHYGIDFPTKKPTGRFSNGKNAADLIA  85

Query  316  EKVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GL T PPYLS         KN  FL GV+FASGGAGIFN T+     +++ L+ QV 
Sbjct  86   EKLGLATSPPYLSLVSKINFNKKNVSFLDGVNFASGGAGIFNGTDEN-FRQSIPLTKQVD  144

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +S + +KL  Q  A+  +  LSKS F ++IG+ND+  YFN
Sbjct  145  YYSQMHEKLTQQTEASILQNHLSKSIFAVVIGSNDIFGYFN  185



>ref|XP_003600135.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES70386.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=408

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 115/160 (72%), Gaps = 9/160 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQKVPA+YVFGDSLVDVGNNN++ D+  +A FP+ G+D+P +K  GRF NG N+AD +A
Sbjct  21   EAQKVPAVYVFGDSLVDVGNNNYLNDTFAKAIFPYYGIDFPTKKPAGRFCNGKNAADLIA  80

Query  316  EKVGLPTPPPYLS-------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            EKVGL T PPYLS       +KN  FL GV+FASGGAGIF   +   + +++HL++QV  
Sbjct  81   EKVGLATSPPYLSLASSKVKNKNVSFLSGVNFASGGAGIFKGIDPNYM-RSIHLTEQVDY  139

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            +S + ++   QI  +  ++ LS+S F ++IGNND+ +YFN
Sbjct  140  YSQMYEESTKQIEVSTLQKHLSESIFFVVIGNNDIFDYFN  179



>gb|AFK33602.1| unknown [Medicago truncatula]
Length=366

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 113/161 (70%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +AQK PA+YVFGDSLVDVGNNN++  S+++A  PH G+D+P +K TGRFSNG N+AD +A
Sbjct  26   KAQKTPAIYVFGDSLVDVGNNNYLTLSLVKATLPHYGIDFPTKKPTGRFSNGKNAADLIA  85

Query  316  EKVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GL T PPYLS         KN  FL GV+FASGGAGIFN T+     +++ L+ QV 
Sbjct  86   EKLGLATSPPYLSLVSKINFNKKNVSFLDGVNFASGGAGIFNGTDEN-FRQSIPLTKQVD  144

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +S + +KL  Q  A+  +  LSKS F ++IG+ND+  YFN
Sbjct  145  YYSQMHEKLTQQTEASILQNHLSKSIFAVVIGSNDIFGYFN  185



>gb|KJB62853.1| hypothetical protein B456_009G440500 [Gossypium raimondii]
Length=361

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 117/155 (75%), Gaps = 6/155 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +AQ VPA+YVFGDSLVDVGNNN +  S  +A+FPHNGVD+P RK TGRF NG N+AD LA
Sbjct  26   KAQMVPAVYVFGDSLVDVGNNNFLPVSFAKANFPHNGVDFPTRKPTGRFCNGKNAADLLA  85

Query  316  EKVGLPTPPPYLS-DKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
            EK+GLP+ PPYLS   NN+   L G SFASGGAGIFNST++ +  +A+ LS+QV  F ++
Sbjct  86   EKLGLPSSPPYLSLSVNNITSHLTGASFASGGAGIFNSTDH-VFGQAIPLSNQVDDFMSL  144

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             + L+ Q G++AA+   SKS F  +IG+NDL +YF
Sbjct  145  NKILMKQ-GSSAAQNHTSKSLFAFVIGSNDLFDYF  178



>ref|XP_008226873.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Prunus mume]
Length=367

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 113/157 (72%), Gaps = 7/157 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EA+ VPAMY+FGDSLVDVGNNN++  S  +A+FPHNG+D+P +  TGRF NG N+AD LA
Sbjct  30   EARVVPAMYIFGDSLVDVGNNNYLQFSFAKANFPHNGIDFPTKTPTGRFCNGKNAADLLA  89

Query  316  EKVGLPTPPPYL---SDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFS  480
            EK+GLPT PPYL   S  NN+  FL GV+FASG A IF  TN     +++   +QV  + 
Sbjct  90   EKMGLPTIPPYLSIASKSNNITLFLNGVNFASGAAKIFKDTNQQ-YPQSISFGEQVDYYL  148

Query  481  TVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             VQ++LV ++GA+ A+  LSKS F I+IG+ND+  YF
Sbjct  149  AVQKELVQKLGASKAQTHLSKSLFPIIIGSNDVYTYF  185



>gb|EPS67263.1| hypothetical protein M569_07514, partial [Genlisea aurea]
Length=325

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 113/148 (76%), Gaps = 3/148 (2%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            V A+Y+FGDSLVDVGNNN++  SI+R D+P NG+D+PG+K TGRFSNG N+ADF+AEK+ 
Sbjct  1    VQALYIFGDSLVDVGNNNYLPMSILRGDYPFNGIDFPGKKPTGRFSNGKNAADFVAEKLN  60

Query  328  LPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQ  507
            +P PPPYLS +N+ F +GVSFASGGAGI N+T N ++ + + L  Q   F+ V+Q+    
Sbjct  61   VPPPPPYLSRRNDAFQRGVSFASGGAGIMNTT-NAVVGQNIPLVKQFWYFNGVRQRKATA  119

Query  508  IGA-AAAKQQLSKSPFLILIGNNDLINY  588
            +G+ +AA+   + S FL ++G+NDL+N+
Sbjct  120  LGSESAARDHFANSIFLFVVGSNDLLNF  147



>gb|EMT01246.1| GDSL esterase/lipase [Aegilops tauschii]
Length=300

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 6/149 (4%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            VPA+YVFGDSL DVGNNNH+ ++++ADF HNG+DY G KATGRFSNG NSADFLA+K+GL
Sbjct  27   VPAVYVFGDSLADVGNNNHLLTLLKADFSHNGMDYAGGKATGRFSNGKNSADFLADKLGL  86

Query  331  PTPPPYL---SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
             T PPYL   S  N  ++ GVSFASGGAG+ N+TN    ++ +    Q+  +S V   L 
Sbjct  87   ATSPPYLALSSSSNANYVNGVSFASGGAGVSNATNK---NQCITFDKQIEYYSGVYSSLA  143

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLINY  588
              +G A A   L++S F I IG+ND+I+Y
Sbjct  144  RSLGQAQAATHLARSIFAITIGSNDIIHY  172



>ref|XP_004500088.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Cicer arietinum]
Length=397

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 115/162 (71%), Gaps = 11/162 (7%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQKVPA+YVFGDSLVDVGNNN+I+ +  +A  P+ G+D+P +K  GRFSNG N+AD +A
Sbjct  28   EAQKVPAIYVFGDSLVDVGNNNYINGTFAKAILPYYGIDFPTKKPAGRFSNGKNAADLIA  87

Query  316  EKVGLPTPPPYLS---------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
            EK+GLPT PPYLS          KN  FL GV+FASGGAGIFN  ++  + +++ L +QV
Sbjct  88   EKIGLPTSPPYLSILSKVKNNNKKNVSFLGGVNFASGGAGIFNGKHDS-LWRSIPLKEQV  146

Query  469  RLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
              +S V ++L  QIGA+  +  LSKS F ++IG ND+ +Y N
Sbjct  147  EYYSQVYEQLKQQIGASKLQNHLSKSIFFVVIGGNDIFDYLN  188



>gb|KEH28428.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=216

 Score =   159 bits (402),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA+YVFGDSLVDVGNNN++  SI +A+  H G+D+   K TGRFSNG N+ADF+ E
Sbjct  23   AQMVPAVYVFGDSLVDVGNNNYLTLSIAKANHRHYGIDFLNHKPTGRFSNGKNAADFIGE  82

Query  319  KVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            K+GL T PPYLS        + N  F+ GVSFAS GAGIF+ T+     ++L L+ QV  
Sbjct  83   KLGLATSPPYLSLISKGNKNENNASFINGVSFASAGAGIFDGTDER-YRQSLPLTKQVNY  141

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            ++ V ++L+ ++GA+A ++ LSKS F ++IGNNDL  YF
Sbjct  142  YTNVYEELIREVGASALQKHLSKSIFAVVIGNNDLFGYF  180



>gb|AAP05801.1| putative GDSL-like lipase/acylhydrolase [Oryza sativa Japonica 
Group]
 gb|EAZ27591.1| hypothetical protein OsJ_11539 [Oryza sativa Japonica Group]
Length=360

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 102/146 (70%), Gaps = 6/146 (4%)
 Frame = +1

Query  160  MYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +YV GDSL DVGNNNH+ ++++ADFPHNG+DYPG KATGRFSNG N  DFLAE +GL T 
Sbjct  33   VYVLGDSLADVGNNNHLLTLLKADFPHNGIDYPGGKATGRFSNGKNFPDFLAENLGLATS  92

Query  340  PPYL---SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQI  510
            PPYL   S  +  ++ GV+FASGGAG+FNSTN     + +    Q+  +S VQ  LV  +
Sbjct  93   PPYLAISSSSSANYVNGVNFASGGAGVFNSTNK---DQCISFDKQIEYYSKVQASLVQSL  149

Query  511  GAAAAKQQLSKSPFLILIGNNDLINY  588
            G A A   L+KS F I IG+ND+I Y
Sbjct  150  GEAQAASHLAKSLFAITIGSNDIIGY  175



>ref|XP_007020781.1| Zinc finger protein, putative [Theobroma cacao]
 gb|EOY12306.1| Zinc finger protein, putative [Theobroma cacao]
Length=365

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 114/155 (74%), Gaps = 6/155 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +AQ VPA++VFGDS VDVGNNN++  S+ +A+FPHNG+D+P +K TGRF NG N+AD +A
Sbjct  30   KAQMVPAVFVFGDSQVDVGNNNYLPVSVAKANFPHNGIDFPTKKPTGRFCNGKNAADLIA  89

Query  316  EKVGLPTPPPYLS---DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
            EK+GLPT PPYLS    K+  +  GVSFASGGAGIFNST+  +  +A+ L  QV  +  V
Sbjct  90   EKLGLPTSPPYLSLSNKKDASYTNGVSFASGGAGIFNSTDQ-VFGQAIPLPKQVDNYLAV  148

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             + L+ Q+GA A K   ++S F I+IG+NDL +YF
Sbjct  149  HKILMQQLGAGAEKHS-AESLFAIVIGSNDLFDYF  182



>ref|XP_009361010.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Pyrus x bretschneideri]
Length=380

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 112/159 (70%), Gaps = 9/159 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EA+ VPAMYVFGDSLVDVGNNN++  S+ +A+FPHNG+D+P ++ TGRF NG N+AD LA
Sbjct  43   EARVVPAMYVFGDSLVDVGNNNYLQFSLAKANFPHNGLDFPTKQPTGRFCNGKNAADLLA  102

Query  316  EKVGLPTPPPYLS------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EK+GLPT PPYLS         N+FL GV+FASG A IF         +++ L +QV  +
Sbjct  103  EKMGLPTIPPYLSMASKLNKSYNLFLNGVNFASGAAKIFKEDQQ--YPQSISLGEQVDYY  160

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +V++ L  QIG   A++ LSKS F I+IG+ND+  YF+
Sbjct  161  LSVKEGLGQQIGTFKAQKHLSKSLFTIIIGSNDIYTYFD  199



>gb|AFK39512.1| unknown [Lotus japonicus]
Length=366

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 116/160 (73%), Gaps = 10/160 (6%)
 Frame = +1

Query  139  EAQK-VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFL  312
            EAQK  PA+YVFGDSL DVGNNN++  S+ +A  P+ G+D+P +K TGRFSNG N+AD +
Sbjct  25   EAQKKAPAVYVFGDSLFDVGNNNYLSLSLAKAILPYYGIDFPTKKPTGRFSNGKNAADLI  84

Query  313  AEKVGLPTPPPYLS-------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            AEKVGLP  P YLS        KN  +L+GV+FASGGAGIF+ T++    +++ L+ QV 
Sbjct  85   AEKVGLPISPAYLSLVLKANHHKNVSYLEGVNFASGGAGIFDGTDD-TSKQSIPLTKQVD  143

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             +S V ++L  QIGA+  +++LSKS FL++IG+ND+  YF
Sbjct  144  FYSKVHEQLTQQIGASTLQKRLSKSIFLVVIGSNDIFGYF  183



>ref|XP_010539124.1| PREDICTED: GDSL esterase/lipase At5g55050 [Tarenaya hassleriana]
Length=373

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 117/155 (75%), Gaps = 6/155 (4%)
 Frame = +1

Query  145  QKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            + V  +YVFGDSLVDVGNNN++  S+ +A++PHNG+D+P +K TGRF NG N+AD +AEK
Sbjct  22   EPVKGLYVFGDSLVDVGNNNYLPVSLAKANYPHNGIDFPTKKPTGRFCNGKNAADVIAEK  81

Query  322  VGLPTPPPYLSDK----NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
            +G+P+PPPYLS K     +  L GV+FASGGAGIFN ++   + +++ LS QV  + +V 
Sbjct  82   LGIPSPPPYLSLKKRGNESGELAGVNFASGGAGIFNGSDQ-TLGQSIPLSQQVNNYISVH  140

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            ++LV Q+  +AA+  LSKS F+I+IG+NDL +YF+
Sbjct  141  EELVKQLSPSAAQNHLSKSIFVIVIGSNDLFDYFS  175



>gb|KEH28427.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=305

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA+YVFGDSLVDVGNNN++  SI +A+  H G+D+   K TGRFSNG N+ADF+ E
Sbjct  23   AQMVPAVYVFGDSLVDVGNNNYLTLSIAKANHRHYGIDFLNHKPTGRFSNGKNAADFIGE  82

Query  319  KVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            K+GL T PPYLS        + N  F+ GVSFAS GAGIF+ T+     ++L L+ QV  
Sbjct  83   KLGLATSPPYLSLISKGNKNENNASFINGVSFASAGAGIFDGTDER-YRQSLPLTKQVNY  141

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            ++ V ++L+ ++GA+A ++ LSKS F ++IGNNDL  YF
Sbjct  142  YTNVYEELIREVGASALQKHLSKSIFAVVIGNNDLFGYF  180



>ref|XP_010060317.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g55050-like 
[Eucalyptus grandis]
Length=371

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 114/157 (73%), Gaps = 8/157 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            E Q VPA++VFGDS++DVGNNN +  S+ RA  P+ GVD+P +K  GRFSNG NSADF+A
Sbjct  28   EGQMVPALFVFGDSIMDVGNNNDLPLSVARAILPYYGVDFPTKKPNGRFSNGKNSADFIA  87

Query  316  EKVGLPTPPPYL------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EK+GLPT PPYL      S+ ++ FL GVSFASGGAGIF+ T+   + +++ L DQV L+
Sbjct  88   EKLGLPTSPPYLISNSSQSNSSSPFLTGVSFASGGAGIFDGTDEK-LQQSIPLKDQVELY  146

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
              V   LV  +G++ A++ ++KS FLI IG+ND+ +Y
Sbjct  147  RGVHDDLVQHMGSSGAQKHVAKSLFLIGIGSNDIFDY  183



>gb|EMT25664.1| GDSL esterase/lipase [Aegilops tauschii]
Length=355

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 99/145 (68%), Gaps = 6/145 (4%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPP  342
            YVFGDSL DVGNNNH+ ++++ADF HNG+DYPG  ATGRFSNG NSADFLAEK+GL T P
Sbjct  30   YVFGDSLADVGNNNHLLTVLKADFSHNGMDYPGGVATGRFSNGKNSADFLAEKLGLATSP  89

Query  343  PYL---SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PYL   S  N  ++ GVSFASGGAG+ N TN  +    +    Q+  +S V   L   +G
Sbjct  90   PYLALSSSSNANYVNGVSFASGGAGVSNDTNTELC---ITFDKQIEYYSGVYASLARSLG  146

Query  514  AAAAKQQLSKSPFLILIGNNDLINY  588
               A   L+KS F I IG+ND+I+Y
Sbjct  147  QTQATTHLTKSIFAITIGSNDIIHY  171



>ref|XP_004296521.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Fragaria vesca 
subsp. vesca]
Length=363

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 126/187 (67%), Gaps = 10/187 (5%)
 Frame = +1

Query  55   MGFACSLRKMNVFIVflsfsfflsgsfsEAQKVPAMYVFGDSLVDVGNNNHID-SIIRAD  231
            M F+  L+ ++VF++FL      + +  EA+ +PAMYVFGDSLVDVGNNN++  S  +A+
Sbjct  1    MAFSSFLQSVSVFLIFLLCGISRTVT--EARVIPAMYVFGDSLVDVGNNNYLKYSFAKAN  58

Query  232  FPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPPPYL--SDKNN----VFLKGVSFA  393
            FPHNGVD+P +K TGRF NG N+AD +AEK+GLPT PPYL  S K+N     FL GV+FA
Sbjct  59   FPHNGVDFPTKKPTGRFGNGKNAADLIAEKMGLPTIPPYLSMSSKSNKSRTQFLNGVNFA  118

Query  394  SGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNN  573
            SG + I N  +      ++ L  Q+  +  V + LV  +GA+ A+  LSKS FLI+ G+N
Sbjct  119  SGASKILNDIDPQ-YPFSIPLEKQIDYYLAVHKDLVQALGASRAQIHLSKSLFLIITGSN  177

Query  574  DLINYFN  594
            D+ NYF+
Sbjct  178  DMYNYFD  184



>ref|XP_008364881.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Malus domestica]
Length=366

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 109/159 (69%), Gaps = 9/159 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EA+ VPAMYVFGDSLVDVGNNN++  S  +A+FPHNG+D+P ++ TGRF NG N+AD LA
Sbjct  29   EARVVPAMYVFGDSLVDVGNNNYLQFSFAKANFPHNGLDFPTKQPTGRFCNGKNAADLLA  88

Query  316  EKVGLPTPPPYLS------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EK+GLPT PPYLS         N+FL GV+FASG A IF         +++ L +QV  +
Sbjct  89   EKMGLPTIPPYLSMASKLNKSYNLFLNGVNFASGAAKIFKEDQQ--YPQSISLGEQVDYY  146

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +V++ L  QIG    ++ LSK  F I+IG+ND+  YF+
Sbjct  147  LSVKEXLGQQIGTFKTQKHLSKXLFTIIIGSNDIYTYFD  185



>ref|XP_003617573.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AET00532.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=362

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA+YVFGDSLVDVGNNN++  SI +A+  H G+D+   K TGRFSNG N+ADF+ E
Sbjct  23   AQMVPAVYVFGDSLVDVGNNNYLTLSIAKANHRHYGIDFLNHKPTGRFSNGKNAADFIGE  82

Query  319  KVGLPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            K+GL T PPYLS        + N  F+ GVSFAS GAGIF+ T+     ++L L+ QV  
Sbjct  83   KLGLATSPPYLSLISKGNKNENNASFINGVSFASAGAGIFDGTDER-YRQSLPLTKQVNY  141

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            ++ V ++L+ ++GA+A ++ LSKS F ++IGNNDL  YF
Sbjct  142  YTNVYEELIREVGASALQKHLSKSIFAVVIGNNDLFGYF  180



>ref|XP_010042836.1| PREDICTED: GDSL esterase/lipase At5g55050-like, partial [Eucalyptus 
grandis]
Length=309

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 113/157 (72%), Gaps = 8/157 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            E Q VPA++VFGDS++DVGNNN +  S+ RA  P+ GVD+P +K  GRFSNG NSADF+A
Sbjct  44   EGQMVPALFVFGDSIMDVGNNNDLPLSVARAILPYYGVDFPTKKPNGRFSNGKNSADFIA  103

Query  316  EKVGLPTPPPYL------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            E +GLPT PPYL      S+ ++ FL GVSFASGGAGIF+ T+   + +++ L DQV L+
Sbjct  104  ENLGLPTSPPYLISNSSQSNSSSPFLTGVSFASGGAGIFDGTDEK-LQQSIPLKDQVELY  162

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
              V   LV  +G++ A++ ++KS FLI IG+ND+ +Y
Sbjct  163  RGVHDDLVQHMGSSGAQKHVAKSLFLIGIGSNDIFDY  199



>ref|XP_002529911.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF32465.1| zinc finger protein, putative [Ricinus communis]
Length=363

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 111/155 (72%), Gaps = 10/155 (6%)
 Frame = +1

Query  145  QKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            Q VPAM+VFGDS VDVGNNN++  S  +AD+P+NG+D+P +K TGRFSNG N+ADFLAEK
Sbjct  28   QMVPAMFVFGDSGVDVGNNNYLPFSFAKADYPYNGIDFPTKKPTGRFSNGKNAADFLAEK  87

Query  322  VGLPTPPPYLS----DKNNVFLKGVSFASGGAGIFNSTNN--GIISKALHLSDQVRLFST  483
            +G+PT PPYLS       N FL GV+FASG +GI N T    GI+   + L+ QV  ++ 
Sbjct  88   LGVPTSPPYLSLLFKKNTNSFLTGVNFASGASGILNGTGKSLGIV---IPLTKQVDYYAI  144

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            V + LV ++G+ AA + LSKS F+ + G+NDL+ Y
Sbjct  145  VYKDLVQKLGSYAANKLLSKSLFVTVTGSNDLLRY  179



>dbj|BAK01165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 103/152 (68%), Gaps = 10/152 (7%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLP  333
            PA+YV GDS  D G NNH+ +++RAD PHNGVDYPG K TGRFSNG N  DF+AE + LP
Sbjct  34   PALYVLGDSQADAGTNNHLPTVLRADLPHNGVDYPGCKPTGRFSNGKNFVDFVAEHLKLP  93

Query  334  -TPPPYLS-----DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV-RLFSTVQQ  492
             +PPPYLS       N+++L GV+FASGGAG+ N TN G   + +    Q+ R FS V +
Sbjct  94   SSPPPYLSICNTPSSNSIYLSGVNFASGGAGVSNQTNKG---ECISFDYQIDRQFSKVHE  150

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
             LV Q+G + A   LS+S F + IG ND++NY
Sbjct  151  SLVQQLGQSQASAHLSRSIFTVAIGGNDILNY  182



>ref|XP_006829183.2| PREDICTED: GDSL esterase/lipase At5g55050 [Amborella trichopoda]
Length=351

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 6/154 (4%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            KVPA+++FGDS  DVGNNN++ S  +A+FPHNG+D+PG+KATGRFSNG NSADF+A  VG
Sbjct  16   KVPAVFIFGDSTADVGNNNYLRSKAKANFPHNGIDFPGKKATGRFSNGYNSADFIAMHVG  75

Query  328  L-PTPPPYLSDKNNVF----LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
            L  +PPP LS     F    LKGV+FASGG+GIF++T    + + L L  Q+R FS V +
Sbjct  76   LKSSPPPILSLSKGNFDKQILKGVNFASGGSGIFDTTGKK-LHQVLPLKTQLRHFSAVYK  134

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             L  ++G   A++ L+KS F++ +G+NDL + FN
Sbjct  135  SLTQRLGKVRAEEMLAKSLFVVSVGSNDLFDNFN  168



>gb|ERM96599.1| hypothetical protein AMTR_s00001p00270970 [Amborella trichopoda]
Length=366

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 6/154 (4%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            KVPA+++FGDS  DVGNNN++ S  +A+FPHNG+D+PG+KATGRFSNG NSADF+A  VG
Sbjct  31   KVPAVFIFGDSTADVGNNNYLRSKAKANFPHNGIDFPGKKATGRFSNGYNSADFIAMHVG  90

Query  328  L-PTPPPYLSDKNNVF----LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
            L  +PPP LS     F    LKGV+FASGG+GIF++T    + + L L  Q+R FS V +
Sbjct  91   LKSSPPPILSLSKGNFDKQILKGVNFASGGSGIFDTTGKK-LHQVLPLKTQLRHFSAVYK  149

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             L  ++G   A++ L+KS F++ +G+NDL + FN
Sbjct  150  SLTQRLGKVRAEEMLAKSLFVVSVGSNDLFDNFN  183



>gb|AFK33479.1| unknown [Lotus japonicus]
Length=361

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 114/159 (72%), Gaps = 10/159 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA+YVFGDSLVDVGNNN++  SI +A+  H GVD+P +K TGRFSNG N+ADF+A
Sbjct  21   EAQMVPAVYVFGDSLVDVGNNNYLTLSIAKANHRHYGVDFPNQKPTGRFSNGKNAADFIA  80

Query  316  EKVGLPTPPPYLS-----DKN---NVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            EK+GLPT PPYLS     +KN   + F+ GVSFAS GA IF+ T+     +++ L+ QV 
Sbjct  81   EKLGLPTSPPYLSLVSKANKNSNTSSFMDGVSFASAGAEIFDGTDEH-YRQSIPLTKQVD  139

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
             ++ V +++  ++G  A ++ LS+S F ++IG+ND+  Y
Sbjct  140  YYTLVHEQMTREVGTPALQKHLSRSIFAVVIGSNDIFGY  178



>gb|ACU21127.1| unknown [Glycine max]
Length=303

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 114/161 (71%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +A+ V A+YVFGDSLVDVGNNN++  SI +A+  H GVD+P  K TGRFSNG N+ADF+A
Sbjct  22   KAEMVSAVYVFGDSLVDVGNNNYLTLSIAKANHRHYGVDFPTHKPTGRFSNGKNAADFVA  81

Query  316  EKVGLPTPPPYLS------DKNNV-FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            EK+G PT PPYLS      +KNN  F+ GVSFAS GAGIF+ T+     +++ L  Q+  
Sbjct  82   EKLGFPTSPPYLSLITSKANKNNASFMDGVSFASAGAGIFDGTDER-YRQSIPLRKQMDY  140

Query  475  FSTVQQKLVNQI-GAAAAKQQLSKSPFLILIGNNDLINYFN  594
            +S V +++  ++ GAA  ++ LSKS F+++IG+ND+  YF 
Sbjct  141  YSIVHEEMTREVRGAAGLQKHLSKSIFVVVIGSNDIFGYFE  181



>gb|KCW66981.1| hypothetical protein EUGRSUZ_F00745 [Eucalyptus grandis]
Length=390

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 112/153 (73%), Gaps = 8/153 (5%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA++VFGDS++DVGNNN +  S+ RA  P+ GVD+P +K  GRFSNG NSADF+AEK+G
Sbjct  2    VPALFVFGDSIMDVGNNNDLPLSVARAILPYYGVDFPTKKPNGRFSNGKNSADFIAEKLG  61

Query  328  LPTPPPYL------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
            LPT PPYL      S+ ++ FL GVSFASGGAGIF+ T+   + +++ L DQV L+  V 
Sbjct  62   LPTSPPYLISNSSQSNSSSPFLTGVSFASGGAGIFDGTDEK-LQQSIPLKDQVELYRGVH  120

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
              LV  +G++ A++ ++KS FLI IG+ND+ +Y
Sbjct  121  DDLVQHMGSSGAQKHVAKSLFLIGIGSNDIFDY  153



>ref|XP_007142298.1| hypothetical protein PHAVU_008G268800g [Phaseolus vulgaris]
 gb|ESW14292.1| hypothetical protein PHAVU_008G268800g [Phaseolus vulgaris]
Length=362

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 114/159 (72%), Gaps = 8/159 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +A+ VPA+YVFGDSLVDVGNNN++  SI +A+  H G+D+P  K TGRFSNG N+ADF+A
Sbjct  24   KAEMVPAVYVFGDSLVDVGNNNYLTLSIAKANHRHYGIDFPTHKPTGRFSNGKNAADFVA  83

Query  316  EKVGLPTPPPYLS-----DKNN-VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            EK+GL T PPYLS     +KN+  F+ GVSFAS GAGIF+ ++     +++ L+ QV  +
Sbjct  84   EKLGLATSPPYLSLTSKANKNSATFMDGVSFASAGAGIFDGSDER-YRQSIPLTKQVDYY  142

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            S V +++  + GA   ++ LSKS F+++IG+NDL  YF 
Sbjct  143  SIVHEEMTREKGADGLQKHLSKSVFVVVIGSNDLFAYFE  181



>ref|XP_003559714.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Brachypodium 
distachyon]
Length=364

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 99/145 (68%), Gaps = 6/145 (4%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPP  342
            YVFGDSL DVGNNNH+ ++++ADF HNG+DYPG KATGRFSNG NSADFLAE +GL T P
Sbjct  37   YVFGDSLADVGNNNHLLTLLKADFSHNGMDYPGGKATGRFSNGKNSADFLAENLGLATSP  96

Query  343  PYL---SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PYL   S  N  +  GV+FASGG+G+ NSTN     + +    Q+  +S V   L   +G
Sbjct  97   PYLAISSSSNANYANGVNFASGGSGVSNSTNK---DQCITFDKQIEYYSGVYASLARSLG  153

Query  514  AAAAKQQLSKSPFLILIGNNDLINY  588
               A   L+KS F I IG+ND+I+Y
Sbjct  154  QDQAMSHLAKSIFAITIGSNDIIHY  178



>gb|KHN11913.1| GDSL esterase/lipase [Glycine soja]
Length=362

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 10/161 (6%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +A+ V A+YVFGDSLVDVGNNN++  SI +A+  H GVD+P  K TGRFSNG N+ADF+A
Sbjct  22   KAEMVSAVYVFGDSLVDVGNNNYLTLSIAKANHRHYGVDFPTHKPTGRFSNGKNAADFVA  81

Query  316  EKVGLPTPPPYLS------DKNNV-FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            EK+G PT PPYLS      +KNN  F+ GVSFAS GAGIF+ T+     +++ L  Q+  
Sbjct  82   EKLGFPTSPPYLSLITSKANKNNASFMDGVSFASAGAGIFDGTDER-YRQSIPLRKQMDY  140

Query  475  FSTVQQKLVNQIGAAAAKQQ-LSKSPFLILIGNNDLINYFN  594
            +S V +++  ++G AA  Q+ LSKS F+++IG+ND+  YF 
Sbjct  141  YSIVHEEMTREVGGAAGLQKHLSKSIFVVVIGSNDIFGYFE  181



>ref|XP_004491409.1| PREDICTED: GDSL esterase/lipase At5g55050-like isoform X2 [Cicer 
arietinum]
Length=362

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 111/160 (69%), Gaps = 11/160 (7%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA+YVFGDSLVDVGNNN++  SI++A+  H G+D+   K TGRFSNG N+ADF+ E
Sbjct  22   AQTVPAVYVFGDSLVDVGNNNYLTLSIVKANHRHYGIDFLNHKPTGRFSNGKNAADFIGE  81

Query  319  KVGLPTPPPYLS--------DKNNV-FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            K+GL T  PYLS        + NNV F+ GVSFAS GAGIF+ T+     +++ L+ QV 
Sbjct  82   KLGLATSAPYLSLISKANKNENNNVSFMNGVSFASAGAGIFDGTDER-YRQSIPLTKQVD  140

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             +S V ++L  ++G  A +  LSKS F+++IG+NDL  YF
Sbjct  141  YYSNVYEELTREVGVTALQNHLSKSIFVVVIGSNDLFGYF  180



>ref|XP_004491408.1| PREDICTED: GDSL esterase/lipase At5g55050-like isoform X1 [Cicer 
arietinum]
Length=370

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 111/160 (69%), Gaps = 11/160 (7%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA+YVFGDSLVDVGNNN++  SI++A+  H G+D+   K TGRFSNG N+ADF+ E
Sbjct  22   AQTVPAVYVFGDSLVDVGNNNYLTLSIVKANHRHYGIDFLNHKPTGRFSNGKNAADFIGE  81

Query  319  KVGLPTPPPYLS--------DKNNV-FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            K+GL T  PYLS        + NNV F+ GVSFAS GAGIF+ T+     +++ L+ QV 
Sbjct  82   KLGLATSAPYLSLISKANKNENNNVSFMNGVSFASAGAGIFDGTDER-YRQSIPLTKQVD  140

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             +S V ++L  ++G  A +  LSKS F+++IG+NDL  YF
Sbjct  141  YYSNVYEELTREVGVTALQNHLSKSIFVVVIGSNDLFGYF  180



>emb|CDY19892.1| BnaC09g31580D [Brassica napus]
Length=377

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 112/156 (72%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P +YVFGDSLVD GNNN++  SI +A++P NGVD+P +KATGRFSNG N+AD +AEK G
Sbjct  37   IPGLYVFGDSLVDAGNNNYLPISIAKANYPRNGVDFPKKKATGRFSNGKNAADVIAEKFG  96

Query  328  LPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPY S        ++ +  L G++FASGGAGIFNS++   + +++ LS QV  + +
Sbjct  97   LPLPPPYRSLKGALKVKNRESAALTGLNFASGGAGIFNSSDKK-LGQSIPLSHQVDDWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +  ++  ++  A A+  LSKS F+++IG+NDL +Y+
Sbjct  156  IHNEVTGKLRPAEAQVHLSKSLFIVVIGSNDLFDYY  191



>ref|XP_009120029.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Brassica rapa]
 emb|CDY17298.1| BnaA10g09320D [Brassica napus]
Length=377

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 111/156 (71%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P +YVFGDSLVD GNNN++  SI +A++P NGVD+P +KATGRFSNG N+ADF+AEK G
Sbjct  37   IPGLYVFGDSLVDAGNNNYLPISIAKANYPRNGVDFPKKKATGRFSNGKNAADFIAEKFG  96

Query  328  LPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPY S         + +  L  ++FASGGAGIFNS++   + +++ LS QV  + +
Sbjct  97   LPLPPPYRSLKGALKVKKRESAALTSLNFASGGAGIFNSSDKK-LGQSIPLSHQVDDWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +  ++  ++  A A+  LSKS F+++IG+NDL +Y+
Sbjct  156  IHNEVTGKLRPAEAQVHLSKSLFIVVIGSNDLFDYY  191



>gb|KDP39149.1| hypothetical protein JCGZ_00906 [Jatropha curcas]
Length=350

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 106/156 (68%), Gaps = 6/156 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EA+ VPA++VFGDS VDVGNNN++  SI +ADFP NG+D+P  K TGRFSNG N+ADF+A
Sbjct  13   EAKMVPAVFVFGDSGVDVGNNNYLPFSIAKADFPFNGIDFPTGKPTGRFSNGKNAADFVA  72

Query  316  EKVGLPTPPPYLS----DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            EK+GLPTP PYLS     K N  L GV+FASG +GI N+T    +   + L+ QV  +  
Sbjct  73   EKLGLPTPQPYLSLLINKKKNASLTGVNFASGASGILNATGKS-LGTVIPLTKQVDYYIN  131

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            V   LV ++G+    + L+KS F  + G+NDL  Y+
Sbjct  132  VYGDLVQKMGSNGTNKLLAKSLFFTVTGSNDLFRYY  167



>gb|KDO62057.1| hypothetical protein CISIN_1g0356442mg, partial [Citrus sinensis]
Length=129

 Score =   144 bits (364),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 5/104 (5%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA++VFGDSLVDVGNNN++  SI +ADFPHNG+D+P +K TGRFSNG N+ADF+A
Sbjct  26   EAQMVPAVFVFGDSLVDVGNNNYLPISIAKADFPHNGIDFPTKKPTGRFSNGKNAADFIA  85

Query  316  EKVGLPTPPPYLSDKNN----VFLKGVSFASGGAGIFNSTNNGI  435
            EKVGLP+ PPYL+ K+N     FL GVSFASGGAGIFNS++  +
Sbjct  86   EKVGLPSSPPYLAVKSNKNKASFLTGVSFASGGAGIFNSSDQSL  129



>ref|XP_012070853.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Jatropha curcas]
Length=367

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 106/156 (68%), Gaps = 6/156 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EA+ VPA++VFGDS VDVGNNN++  SI +ADFP NG+D+P  K TGRFSNG N+ADF+A
Sbjct  30   EAKMVPAVFVFGDSGVDVGNNNYLPFSIAKADFPFNGIDFPTGKPTGRFSNGKNAADFVA  89

Query  316  EKVGLPTPPPYLS----DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            EK+GLPTP PYLS     K N  L GV+FASG +GI N+T    +   + L+ QV  +  
Sbjct  90   EKLGLPTPQPYLSLLINKKKNASLTGVNFASGASGILNATGKS-LGTVIPLTKQVDYYIN  148

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            V   LV ++G+    + L+KS F  + G+NDL  Y+
Sbjct  149  VYGDLVQKMGSNGTNKLLAKSLFFTVTGSNDLFRYY  184



>ref|XP_006651568.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Oryza brachyantha]
Length=370

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 9/150 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YV GDS  DVGNNN++ +S++RA+FPHNGVDYPG KATGRFSNG N  D +A  +G
Sbjct  37   VPALYVLGDSQADVGNNNYLPESLLRANFPHNGVDYPGGKATGRFSNGYNFVDLVASSLG  96

Query  328  LPTPPPYLSDKNN----VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV-RLFSTVQQ  492
            L +PPPYLS +N+    ++LKG++FASGGAG+ + TN G   + +   +Q+ R +S V  
Sbjct  97   LDSPPPYLSIRNSSNSTIYLKGINFASGGAGVSDLTNKG---QCISFDEQIERDYSKVHA  153

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLI  582
             LV ++G   A   L +S F++ IG ND+I
Sbjct  154  ALVKRLGKRNASTHLGESLFVVAIGGNDII  183



>ref|XP_010096890.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB66344.1| GDSL esterase/lipase [Morus notabilis]
Length=331

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 100/151 (66%), Gaps = 10/151 (7%)
 Frame = +1

Query  160  MYVFGDSLVDVGNNNH-IDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPT  336
            MYVFGDSLVD GNNN+ + S+++A+FPHNG+D+P +K TGRF NG N+ D L+E VGLP 
Sbjct  1    MYVFGDSLVDAGNNNYLVFSLVKANFPHNGIDFPTKKPTGRFCNGKNAVDLLSEIVGLPP  60

Query  337  PPPYLS------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKL  498
             PPYLS         N FL G +FASGG+GI N TN      +L L+ QV  F  V + L
Sbjct  61   SPPYLSVAFKLKKSRNQFLTGANFASGGSGIMNQTNKMF---SLSLTKQVGYFLAVHKAL  117

Query  499  VNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
              Q+G   A +  SKS FLI+ G+ND+ +YF
Sbjct  118  NKQLGPTGANKHFSKSLFLIVTGSNDIFSYF  148



>ref|XP_008363091.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Malus domestica]
Length=141

 Score =   144 bits (363),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 7/103 (7%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EAQ VPA+YVFGDSLVDVGNN+++  S+ +ADFPHNGVDYPG+ ATGR+ NG NSADFLA
Sbjct  31   EAQMVPAIYVFGDSLVDVGNNDYLTISVFKADFPHNGVDYPGKVATGRWGNGKNSADFLA  90

Query  316  EKVGLPTPPPYLS--DKNN----VFLKGVSFASGGAGIFNSTN  426
            EKVGLPT PPYLS   K+N     F+ GVSFASGGAGIFN ++
Sbjct  91   EKVGLPTSPPYLSLVSKSNKXKASFVNGVSFASGGAGIFNGSD  133



>ref|XP_010545226.1| PREDICTED: GDSL esterase/lipase At5g55050-like isoform X1 [Tarenaya 
hassleriana]
Length=370

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 112/155 (72%), Gaps = 8/155 (5%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            V A++VFGDSLVDVGNNN+I  SI +A+FP NG+D+PGR  TGRFSNG N+ADFLAEK G
Sbjct  32   VTAVFVFGDSLVDVGNNNYIPFSIAKANFPPNGIDFPGRVPTGRFSNGLNAADFLAEKAG  91

Query  328  LPTPPPYLSDKN----NVFLKGVSFASGGAGIFNST-NNGIISKALHLSDQVRLF-STVQ  489
            LP+ PP+LS +N    + F  GV+FASGGAGIFN T +N I+ +++ LS QV  +   V+
Sbjct  92   LPSSPPFLSPENQRNMSSFFAGVNFASGGAGIFNGTYHNDILGQSISLSRQVDYYVHHVR  151

Query  490  QKLVNQIGAAA-AKQQLSKSPFLILIGNNDLINYF  591
              L+  +      +  LS+S F ++IG+NDL++YF
Sbjct  152  GDLIRLVQPYHDVRTYLSRSVFAVVIGSNDLLHYF  186



>ref|XP_009132410.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Brassica rapa]
Length=377

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 111/156 (71%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP +YVFGDSLVD GNNN++  SI +A++PHNGVD+P +KATGRF NG N+AD +AEK G
Sbjct  37   VPGLYVFGDSLVDAGNNNYLAISISKANYPHNGVDFPNKKATGRFCNGKNAADAIAEKFG  96

Query  328  LPTP--------PPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP P        P     K +  + GV+FASGGAGIFNS+++  + +A+ LS QV  + +
Sbjct  97   LPLPPPYLSLKGPFKEEKKKSAVMTGVNFASGGAGIFNSSDHK-LGQAIPLSHQVNHWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + Q+L +Q+G A A+  LSKS F ++IG+NDL +YF
Sbjct  156  IHQELTSQLGPAEAQNHLSKSLFAVVIGSNDLFDYF  191



>emb|CDY43015.1| BnaA03g11620D [Brassica napus]
Length=377

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 111/156 (71%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP +YVFGDSLVD GNNN++  SI +A++PHNGVD+P +KATGRF NG N+AD +AEK G
Sbjct  37   VPGLYVFGDSLVDAGNNNYLAISISKANYPHNGVDFPNKKATGRFCNGKNAADAIAEKFG  96

Query  328  LPTP--------PPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP P        P     K +  + GV+FASGGAGIFNS+++  + +A+ LS QV  + +
Sbjct  97   LPLPPPYLSLKGPFKEEKKKSAAMTGVNFASGGAGIFNSSDHK-LGQAIPLSHQVNHWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + Q+L +Q+G A A+  LSKS F ++IG+NDL +YF
Sbjct  156  IHQELTSQLGPAEAQNHLSKSLFAVVIGSNDLFDYF  191



>emb|CDY61425.1| BnaC03g71620D [Brassica napus]
Length=377

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 111/156 (71%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP +YVFGDSLVD GNNN++  SI +A++PHNGVD+P +KATGRF NG N+AD +AEK G
Sbjct  37   VPGLYVFGDSLVDAGNNNYLAISISKANYPHNGVDFPNKKATGRFCNGKNAADAIAEKFG  96

Query  328  LPTP--------PPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP P        P     K +  + GV+FASGGAGIFNS+++  + +A+ LS QV  + +
Sbjct  97   LPLPPPYLSLKGPFKEEKKKSAAMTGVNFASGGAGIFNSSDHK-LGQAIPLSHQVNHWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + Q+L +Q+G A A+  LSKS F ++IG+NDL +YF
Sbjct  156  IHQELTSQLGPAEAQNHLSKSLFAVVIGSNDLFDYF  191



>ref|XP_003559713.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Brachypodium 
distachyon]
Length=379

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 11/154 (7%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDY-PGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YV GDS  D GNNNH+ +++RADFPHNGVDY  G KATGRFSNG N  DFLAE + 
Sbjct  36   VPALYVLGDSQADNGNNNHLVTLLRADFPHNGVDYGRGNKATGRFSNGKNFVDFLAEHLN  95

Query  328  LP-TPPPYLSDKNN-----VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV-RLFSTV  486
            L  TPPPY+S +NN     ++  GV+FASGGAG+ + TN G   + +    Q+ + +S V
Sbjct  96   LASTPPPYMSIRNNPSNRFIYPSGVNFASGGAGVSSETNKG---QCISFDQQIDQHYSGV  152

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
             + LVNQ+G      +L+KS F + IG ND++NY
Sbjct  153  YKALVNQLGQNMTLARLAKSIFTVAIGGNDILNY  186



>ref|NP_001050552.1| Os03g0580800 [Oryza sativa Japonica Group]
 gb|ABF97293.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12466.1| Os03g0580800 [Oryza sativa Japonica Group]
 dbj|BAG92242.1| unnamed protein product [Oryza sativa Japonica Group]
Length=379

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 106/152 (70%), Gaps = 10/152 (7%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YV GDS  DVGNNN++  S+++A+FPHNG+DYPG K TGRFSNG N  D +A  +G
Sbjct  45   VPAIYVLGDSQADVGNNNYLLHSLLKANFPHNGIDYPGGKPTGRFSNGYNFVDLIAISLG  104

Query  328  LPTPPPYLSDK-----NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR-LFSTVQ  489
            +P+PPPYLS       ++V+LKGV+FASGGAG+ N TN   +++ +   +Q+   +  V 
Sbjct  105  VPSPPPYLSISSKPMNSSVYLKGVNFASGGAGVSNLTN---LAQCISFDEQIEGDYHRVH  161

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLIN  585
            + L  Q+G   AK  L+KS F++ IG ND+IN
Sbjct  162  EALGKQLGIPGAKAHLAKSLFVVAIGGNDIIN  193



>gb|EAY90766.1| hypothetical protein OsI_12368 [Oryza sativa Indica Group]
Length=366

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 107/152 (70%), Gaps = 10/152 (7%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YV GDS  DVGNNN++  S+++A+FPHNG+DYPG K TGRFSNG N  D +A  +G
Sbjct  32   VPAIYVLGDSQADVGNNNYLLHSLLKANFPHNGIDYPGGKPTGRFSNGYNFVDLIAISLG  91

Query  328  LPTPPPYLSDK-----NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR-LFSTVQ  489
            +P+PPPYLS +     ++V+LKGV+FASGGAG+ N TN   +++ +   +Q+   +  V 
Sbjct  92   VPSPPPYLSIRSKPMNSSVYLKGVNFASGGAGVSNLTN---LAQCISFDEQIDGDYHRVH  148

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLIN  585
            + L  Q+G   AK  L+KS F++ IG ND+IN
Sbjct  149  EALGKQLGIPGAKAHLAKSLFVVAIGGNDIIN  180



>gb|EAZ27592.1| hypothetical protein OsJ_11540 [Oryza sativa Japonica Group]
Length=366

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 106/152 (70%), Gaps = 10/152 (7%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YV GDS  DVGNNN++  S+++A+FPHNG+DYPG K TGRFSNG N  D +A  +G
Sbjct  32   VPAIYVLGDSQADVGNNNYLLHSLLKANFPHNGIDYPGGKPTGRFSNGYNFVDLIAISLG  91

Query  328  LPTPPPYLSDK-----NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR-LFSTVQ  489
            +P+PPPYLS       ++V+LKGV+FASGGAG+ N TN   +++ +   +Q+   +  V 
Sbjct  92   VPSPPPYLSISSKPMNSSVYLKGVNFASGGAGVSNLTN---LAQCISFDEQIEGDYHRVH  148

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLIN  585
            + L  Q+G   AK  L+KS F++ IG ND+IN
Sbjct  149  EALGKQLGIPGAKAHLAKSLFVVAIGGNDIIN  180



>ref|XP_008792009.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Phoenix dactylifera]
Length=351

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 101/152 (66%), Gaps = 6/152 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            E+  VPA+YVFGDSLVD GNNN+  +  +A+FPHNGVD+PG   TGR+SNG N+ DFLA 
Sbjct  21   ESASVPALYVFGDSLVDNGNNNYWTTTAKANFPHNGVDFPGGTPTGRWSNGYNTIDFLAS  80

Query  319  KVGLPTPP-PYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQK  495
             +G  + P PYLS   N   +G +FASGG+GI ++T    I     LS Q+  F +V Q 
Sbjct  81   MLGFDSAPQPYLSPVKNT-TQGANFASGGSGILDTTGPTTIP----LSTQINFFQSVAQN  135

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            L+ Q+G+  A   LSKS FLI  G+ND++ Y+
Sbjct  136  LMQQMGSQQATLHLSKSLFLISPGSNDMVAYY  167



>ref|NP_001050555.1| Os03g0581400 [Oryza sativa Japonica Group]
 gb|AAS07169.1| putative GDSL-like lipase/acylhydrolase [Oryza sativa Japonica 
Group]
 gb|ABF97299.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12469.1| Os03g0581400 [Oryza sativa Japonica Group]
 gb|EAZ27596.1| hypothetical protein OsJ_11543 [Oryza sativa Japonica Group]
Length=367

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 105/150 (70%), Gaps = 8/150 (5%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSII---RADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
             PA+YV GDS  DVGNNN++ + +   +A++PHNGVDYPG K TGRFSNG N  D+LA+ 
Sbjct  38   APAVYVLGDSQADVGNNNYLPATLPMYKANYPHNGVDYPGGKPTGRFSNGYNFVDYLADS  97

Query  322  VGLPTPPPYLSDKN-NVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV-RLFSTVQQK  495
            +G+ +PPPYLS  N +V+L+GV+F+SGG+G+ N TN G   + +   +Q+ + +STV   
Sbjct  98   LGVASPPPYLSISNTSVYLRGVNFSSGGSGVSNLTNMG---QCISFDEQIDQHYSTVHAT  154

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLIN  585
            LV Q+G   A   L++S F + IG ND+IN
Sbjct  155  LVEQLGPRQASTHLAESLFSVAIGGNDIIN  184



>ref|XP_010540156.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Tarenaya hassleriana]
Length=343

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +1

Query  193  GNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPPPYLS-----  354
            GNNN++  SI +A++PHNGVD+P  K TGRFSNG N+AD +AEK G+P+PPPYLS     
Sbjct  30   GNNNYLPVSIAKANYPHNGVDFPTGKPTGRFSNGKNAADVIAEKFGIPSPPPYLSLKNTG  89

Query  355  DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQ  534
            DK+     GV+FASGGAGIFN ++   + +++ +S+QV  + +V Q+ VNQ+GA+AA+  
Sbjct  90   DKSAGESTGVNFASGGAGIFNGSDQ-TLGQSIPMSEQVNNYISVHQESVNQLGASAAQIH  148

Query  535  LSKSPFLILIGNNDLINYF  591
             SKS F+I++G+NDL +YF
Sbjct  149  FSKSIFVIVVGSNDLFDYF  167



>ref|XP_010545227.1| PREDICTED: GDSL esterase/lipase At5g55050-like isoform X2 [Tarenaya 
hassleriana]
Length=369

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 111/155 (72%), Gaps = 9/155 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            V A++VFGDSLVDVGNNN+I  SI +A+FP NG+D+PGR  TGRFSNG N+ADFL EK G
Sbjct  32   VTAVFVFGDSLVDVGNNNYIPFSIAKANFPPNGIDFPGRVPTGRFSNGLNAADFL-EKAG  90

Query  328  LPTPPPYLSDKN----NVFLKGVSFASGGAGIFNST-NNGIISKALHLSDQVRLF-STVQ  489
            LP+ PP+LS +N    + F  GV+FASGGAGIFN T +N I+ +++ LS QV  +   V+
Sbjct  91   LPSSPPFLSPENQRNMSSFFAGVNFASGGAGIFNGTYHNDILGQSISLSRQVDYYVHHVR  150

Query  490  QKLVNQIGAAA-AKQQLSKSPFLILIGNNDLINYF  591
              L+  +      +  LS+S F ++IG+NDL++YF
Sbjct  151  GDLIRLVQPYHDVRTYLSRSVFAVVIGSNDLLHYF  185



>ref|XP_010666212.1| PREDICTED: GDSL esterase/lipase At5g55050-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=313

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 16/166 (10%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA++VFGDSLVDVGNNN++  +I ++D P++GVD+P  K  GRFSNG  +ADFLAE
Sbjct  23   AQSVPALFVFGDSLVDVGNNNYLTFTIAKSDLPNHGVDFPTHKPNGRFSNGKIAADFLAE  82

Query  319  KVGLPTPPPYL---SDKNNVFLKGVSFASGGAGIFNSTN--------NGIISKALHLS--  459
            K+GL +P PYL     K N F +GVSFAS  AGI NSTN        +G+  +  H +  
Sbjct  83   KLGLQSPLPYLYLVHTKTNEFSRGVSFASAAAGILNSTNRCLDLPLIDGLDDEISHFTIP  142

Query  460  --DQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
              +QV  +   +  LV  +G + A + LS+S F I+IG+ D+  YF
Sbjct  143  MDEQVEYYIKTRGILVENLGESRAAKLLSESVFTIVIGSTDIGTYF  188



>gb|KGN56114.1| hypothetical protein Csa_3G076010 [Cucumis sativus]
Length=368

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 105/160 (66%), Gaps = 15/160 (9%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            A  VPAMYVFGDSLVDVGNNN+++ S  +A+F  NG+D+P  K TGRF NG N ADFLAE
Sbjct  29   AALVPAMYVFGDSLVDVGNNNYLNFSSPKANFYPNGIDFPTGKPTGRFCNGKNPADFLAE  88

Query  319  KVGLPTPPPYLS---------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            KVGL + P YLS         D+N    +G++FASGGA I   +N  IIS ++ L  QV 
Sbjct  89   KVGLASAPSYLSIIENRSYIHDRN----RGINFASGGATIIPQSNQ-IISTSISLCKQVV  143

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             ++++ + LV  +G   AK   SKS +LI IG+ND+  YF
Sbjct  144  YYNSIYESLVKDLGVTKAKAYTSKSLYLIEIGSNDIFGYF  183



>ref|XP_009397969.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Musa acuminata 
subsp. malaccensis]
Length=364

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 104/160 (65%), Gaps = 13/160 (8%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EA KVPA+YVFGDS  DVGNNN++  S  +A+FPHNGVD+P  + TGRFSNG N  DFLA
Sbjct  26   EAAKVPAIYVFGDSTADVGNNNYLPGSNAKANFPHNGVDFPFSRPTGRFSNGYNGIDFLA  85

Query  316  EKVGL-PTPPPYLSDKNNV------FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
              +G   +PPP+LS  N         LKGV+FASGG+GI +ST + I      ++ Q++ 
Sbjct  86   NHMGFRRSPPPFLSLTNKTNHQILRGLKGVNFASGGSGILDSTGSTIT-----MTKQIQY  140

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            FST++  +V QI +    + LSKS FLI  G ND+  YF 
Sbjct  141  FSTIRSNIVAQIASEPTYRLLSKSIFLISSGGNDIFAYFT  180



>emb|CDY19891.1| BnaC09g31570D [Brassica napus]
Length=377

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 114/156 (73%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP +YVFGDSLVD GNNN++  S+ +A++PHNGVD+PG++ TGRFSNG N+AD +AEK G
Sbjct  37   VPGVYVFGDSLVDAGNNNYLAFSVSKANYPHNGVDFPGKRPTGRFSNGKNAADAIAEKFG  96

Query  328  LPTPPPYLSD--------KNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYLS         + +  + GV+FASGGAGIFNS++   + +A+ LS QV  + +
Sbjct  97   LPLPPPYLSLRGLFKEKRRKSAAVTGVNFASGGAGIFNSSDQK-LGQAIPLSHQVNHWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++L NQ+G A  +  LSKS F ++IG+NDL +YF
Sbjct  156  IHRQLTNQLGPAETQIHLSKSLFTVVIGSNDLFDYF  191



>ref|XP_010666211.1| PREDICTED: GDSL esterase/lipase At5g55050-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=373

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 16/166 (10%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            AQ VPA++VFGDSLVDVGNNN++  +I ++D P++GVD+P  K  GRFSNG  +ADFLAE
Sbjct  23   AQSVPALFVFGDSLVDVGNNNYLTFTIAKSDLPNHGVDFPTHKPNGRFSNGKIAADFLAE  82

Query  319  KVGLPTPPPYL---SDKNNVFLKGVSFASGGAGIFNSTN--------NGIISKALHLS--  459
            K+GL +P PYL     K N F +GVSFAS  AGI NSTN        +G+  +  H +  
Sbjct  83   KLGLQSPLPYLYLVHTKTNEFSRGVSFASAAAGILNSTNRCLDLPLIDGLDDEISHFTIP  142

Query  460  --DQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
              +QV  +   +  LV  +G + A + LS+S F I+IG+ D+  YF
Sbjct  143  MDEQVEYYIKTRGILVENLGESRAAKLLSESVFTIVIGSTDIGTYF  188



>ref|XP_009120027.1| PREDICTED: GDSL esterase/lipase At5g55050 [Brassica rapa]
 emb|CDY17297.1| BnaA10g09310D [Brassica napus]
Length=377

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 114/156 (73%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP +YVFGDSLVD GNNN++  S+ +A++PHNGVD+PG++ TGRFSNG N+AD +AEK G
Sbjct  37   VPGVYVFGDSLVDAGNNNYLAFSVSKANYPHNGVDFPGKRPTGRFSNGKNAADAIAEKFG  96

Query  328  LPTPPPYLSD--------KNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYLS         + +  + GV+FASGGAGIFNS++   + +A+ LS QV  + +
Sbjct  97   LPLPPPYLSLRGLFKEKRRKSAAVTGVNFASGGAGIFNSSDQK-LGQAIPLSHQVNHWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++L NQ+G A  +  LSKS F ++IG+NDL +YF
Sbjct  156  IHRELTNQLGPAETQIHLSKSLFTVVIGSNDLFDYF  191



>ref|XP_010918204.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Elaeis guineensis]
Length=351

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 101/153 (66%), Gaps = 6/153 (4%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            E   VPA+YVFGDSLVD GNN++  + I+A+FPHNGVD+PG   TGR+SNG N+ DFLA 
Sbjct  21   ENASVPALYVFGDSLVDSGNNDYWYTTIKANFPHNGVDFPGGTPTGRWSNGYNTIDFLAA  80

Query  319  KVGLPT-PPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQK  495
             +G  + PPP+LS   +   +G +FASGG+GI ++T    I     L  Q++ F +V Q 
Sbjct  81   MLGFKSAPPPFLSPVKDT-SQGANFASGGSGILDTTGPTTIP----LRTQIKFFRSVAQN  135

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            L  Q+G+  A   LSKS FLI  G+ND+  Y++
Sbjct  136  LRQQMGSQQASLHLSKSLFLISPGSNDMAAYYS  168



>ref|XP_012086456.1| PREDICTED: GDSL esterase/lipase At5g37690 [Jatropha curcas]
Length=368

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 99/146 (68%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPP  342
            Y+FGDSL +VGNNNH+ S+ R+D+P  G+D+ G++ATGRF+NG    D ++EK+G+P+PP
Sbjct  33   YIFGDSLTEVGNNNHLQSLARSDYPWYGIDFTGKQATGRFTNGRTIGDIISEKLGIPSPP  92

Query  343  PYLSDKNN---VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PYLS  +N     LKGV++ASGGAGI N T    I + L   DQ+  F   ++ +  +IG
Sbjct  93   PYLSLSSNNADALLKGVNYASGGAGILNETGLYFIQR-LSFDDQIDYFEKTKEVIRAKIG  151

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA +  +++ + I IG+ND +N F
Sbjct  152  ENAANKHCNEALYFIGIGSNDYVNNF  177



>ref|XP_004986407.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=374

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 97/152 (64%), Gaps = 11/152 (7%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YV GDS  DVGNNNH+  S +RA+FP NG+DYP ++ATGRFSNG N  DFLA K+G
Sbjct  32   VPALYVLGDSQADVGNNNHLALSPLRANFPRNGIDYPEQQATGRFSNGRNFVDFLAGKLG  91

Query  328  LPTPPPYLSDKN------NVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV-RLFSTV  486
            L +PPPY S  N      + FL GV+FASGGAG+   TN G   +      Q+ R +  V
Sbjct  92   LTSPPPYHSISNTTPGRYSTFLTGVNFASGGAGVLGLTNKG---QCFSFDHQIERDYLNV  148

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLI  582
               LV Q+G   A   L+KS F + IG ND+I
Sbjct  149  YSGLVQQLGKPQAMAHLAKSIFTVAIGGNDII  180



>ref|XP_002464307.1| hypothetical protein SORBIDRAFT_01g015890 [Sorghum bicolor]
 gb|EER91305.1| hypothetical protein SORBIDRAFT_01g015890 [Sorghum bicolor]
Length=372

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 94/146 (64%), Gaps = 15/146 (10%)
 Frame = +1

Query  160  MYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +YV GDSL DVGNNNH+ ++++ADFPHNG+DYPG+KATGRF          AE +GL T 
Sbjct  48   IYVLGDSLADVGNNNHLVTLLKADFPHNGIDYPGKKATGRFP---------AENLGLATS  98

Query  340  PPYL---SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQI  510
            PPYL   S  N  +  GV+FASGGAG+ N+TN     + +    Q+   ++V   LV  +
Sbjct  99   PPYLALSSSSNPNYANGVNFASGGAGVSNATNK---DQCISFDQQIDYLASVHASLVQSL  155

Query  511  GAAAAKQQLSKSPFLILIGNNDLINY  588
            G A A   L+KS F I IG+ND+I+Y
Sbjct  156  GQAQATAHLAKSLFAITIGSNDIIHY  181



>emb|CDY06617.1| BnaC02g13410D [Brassica napus]
Length=374

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 113/156 (72%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P +Y+FGDSLVD GNNN++  SI +A++P NGVD+P +KATGRFSNG N+AD +AEK G
Sbjct  34   IPGVYIFGDSLVDAGNNNYLAISISKANYPRNGVDFPDKKATGRFSNGKNAADAIAEKFG  93

Query  328  LPTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYLS        ++ +  L GV+FASGGAGIFN ++   + +++ LS QV  +  
Sbjct  94   LPLPPPYLSLKVSFKEKERKSAALTGVNFASGGAGIFNGSDQK-LRQSIPLSHQVNDWQD  152

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++L +Q+G + A+  LSKS F ++IG+NDL +YF
Sbjct  153  IHKELTSQLGPSEAQNHLSKSLFFVVIGSNDLFDYF  188



>emb|CDY20792.1| BnaA02g09320D [Brassica napus]
Length=374

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 108/156 (69%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P +Y+FGDSLVD GNNN++  SI +A++P NGVD+P +KATGRFSNG N+AD +AEK  
Sbjct  34   IPGVYIFGDSLVDAGNNNYLAISISKANYPRNGVDFPDKKATGRFSNGKNAADAIAEKFA  93

Query  328  LPTP--------PPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP P        P    ++ +  L GV+FASGGAGIFN ++   + +++ LS QV  +  
Sbjct  94   LPLPPPYLSLKVPFKEKERKSAALTGVNFASGGAGIFNGSDQK-LRQSIPLSHQVNDWQE  152

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++L +Q+G + A+  LSKS F ++IG+NDL +YF
Sbjct  153  IHKELTSQLGPSEAQNHLSKSLFFVVIGSNDLFDYF  188



>ref|XP_009127039.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Brassica rapa]
Length=374

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 108/156 (69%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P +Y+FGDSLVD GNNN++  SI +A++P NGVD+P +KATGRFSNG N+AD +AEK  
Sbjct  34   IPGVYIFGDSLVDAGNNNYLAISISKANYPRNGVDFPDKKATGRFSNGKNAADAIAEKFA  93

Query  328  LPTP--------PPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP P        P    ++ +  L GV+FASGGAGIFN ++   + +++ LS QV  +  
Sbjct  94   LPLPPPYLSLKVPFKEKERKSAALTGVNFASGGAGIFNGSDQK-LRQSIPLSHQVNDWQE  152

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++L +Q+G + A+  LSKS F ++IG+NDL +YF
Sbjct  153  IHKELTSQLGPSEAQNHLSKSLFFVVIGSNDLFDYF  188



>gb|KJB22746.1| hypothetical protein B456_004G064300 [Gossypium raimondii]
Length=362

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 99/148 (67%), Gaps = 4/148 (3%)
 Frame = +1

Query  157  AMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLP  333
            A ++FGDSL +VGNNNH+  S+ R+D+P  G+D+ GRKATGRF+NG    D L+EK+G  
Sbjct  27   ATFIFGDSLAEVGNNNHLQYSLARSDYPWYGIDFTGRKATGRFTNGRTIGDILSEKLGTS  86

Query  334  TPPPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQ  507
            +PPPY  LS  ++  L+GV++ASGGAGI   T    I + L   DQ+  F   ++++  +
Sbjct  87   SPPPYLSLSQNDDAILQGVNYASGGAGILKETGQYFIQR-LTFDDQINYFKKTKERIGAK  145

Query  508  IGAAAAKQQLSKSPFLILIGNNDLINYF  591
            IGA AA +  +++ + I IG+ND +N F
Sbjct  146  IGAQAANKLCNEATYFIGIGSNDYVNNF  173



>ref|XP_011650521.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Cucumis sativus]
Length=334

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 101/154 (66%), Gaps = 15/154 (10%)
 Frame = +1

Query  160  MYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPT  336
            MYVFGDSLVDVGNNN+++ S  +A+F  NG+D+P  K TGRF NG N ADFLAEKVGL +
Sbjct  1    MYVFGDSLVDVGNNNYLNFSSPKANFYPNGIDFPTGKPTGRFCNGKNPADFLAEKVGLAS  60

Query  337  PPPYLS---------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
             P YLS         D+N    +G++FASGGA I   +N  IIS ++ L  QV  ++++ 
Sbjct  61   APSYLSIIENRSYIHDRN----RGINFASGGATIIPQSNQ-IISTSISLCKQVVYYNSIY  115

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + LV  +G   AK   SKS +LI IG+ND+  YF
Sbjct  116  ESLVKDLGVTKAKAYTSKSLYLIEIGSNDIFGYF  149



>ref|XP_008449093.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Cucumis melo]
Length=365

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 102/157 (65%), Gaps = 8/157 (5%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            A  VPAM+VFGDSLVDVGNNN+++ S  +A+F  NG+D+P  K TGRF NG N ADFLAE
Sbjct  27   AALVPAMFVFGDSLVDVGNNNYLNFSSPKANFYPNGIDFPTGKPTGRFCNGKNPADFLAE  86

Query  319  KVGLPTPPPYLSDKNNV------FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFS  480
            KVGL + P YLS   N         +G++FASGGA I   +N  IIS ++ L  QV  ++
Sbjct  87   KVGLASAPSYLSIIENSSRHTHNINRGINFASGGATIIPQSNQ-IISTSISLCKQVVYYN  145

Query  481  TVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            ++ + LV  +G   AK   SKS + I IG+ND+  YF
Sbjct  146  SIYKSLVKDLGVNKAKAYTSKSLYFIEIGSNDIFAYF  182



>ref|XP_010647695.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Vitis vinifera]
Length=366

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 99/155 (64%), Gaps = 10/155 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +PAM++ GDS  DVG N+ +  S IRADFP NG+D+P  + TGRFSNG N+ DFLA   G
Sbjct  25   IPAMFILGDSTADVGTNSLLPFSFIRADFPFNGIDFPSSQPTGRFSNGFNTVDFLANLTG  84

Query  328  LP-TPPPYL------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
               +PPP+L      S  N  FLKGVSFASGG+G+ ++T   +    + L  Q++ F+TV
Sbjct  85   FQISPPPFLSLVDSQSSMNKQFLKGVSFASGGSGLLDTTGQSL--GVIPLGKQIQQFATV  142

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            Q  L   IG+   ++ LSKS FLI  G ND++ +F
Sbjct  143  QSNLTAAIGSDETEKLLSKSLFLISTGGNDILGHF  177



>ref|XP_010528545.1| PREDICTED: GDSL esterase/lipase At5g37690 [Tarenaya hassleriana]
Length=360

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 98/147 (67%), Gaps = 5/147 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNNH+  S+ R+D+   GVD+PG KATGRF+NG    D ++EK+G+P+P
Sbjct  31   YIFGDSLTEVGNNNHLQYSLARSDYQWYGVDFPGGKATGRFTNGRTIGDIISEKLGIPSP  90

Query  340  PPYLSDKNN---VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQI  510
            PPYLS   N    FL G+++ASGGAGI N T    I + +   DQ+  F   ++ + ++I
Sbjct  91   PPYLSLSQNDDASFLSGINYASGGAGILNETGLYFIQR-MTFDDQINYFKKTKEIIRSKI  149

Query  511  GAAAAKQQLSKSPFLILIGNNDLINYF  591
            G  AA + ++ + F I IG+ND +N F
Sbjct  150  GDTAANKHVNDAMFFIGIGSNDYVNNF  176



>emb|CBI37762.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 99/155 (64%), Gaps = 10/155 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +PAM++ GDS  DVG N+ +  S IRADFP NG+D+P  + TGRFSNG N+ DFLA   G
Sbjct  11   IPAMFILGDSTADVGTNSLLPFSFIRADFPFNGIDFPSSQPTGRFSNGFNTVDFLANLTG  70

Query  328  LP-TPPPYL------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
               +PPP+L      S  N  FLKGVSFASGG+G+ ++T   +    + L  Q++ F+TV
Sbjct  71   FQISPPPFLSLVDSQSSMNKQFLKGVSFASGGSGLLDTTGQSL--GVIPLGKQIQQFATV  128

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            Q  L   IG+   ++ LSKS FLI  G ND++ +F
Sbjct  129  QSNLTAAIGSDETEKLLSKSLFLISTGGNDILGHF  163



>ref|XP_004292273.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Fragaria vesca 
subsp. vesca]
Length=357

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 100/152 (66%), Gaps = 5/152 (3%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+++ GDS  DVG NN +  S+ RADFP+NG+D+P    TGRFSNG N+ADFLA+  G
Sbjct  26   VPAIFILGDSTADVGTNNFLPGSMARADFPYNGIDFPNSTPTGRFSNGLNTADFLAKLFG  85

Query  328  LP-TPPPYLSDKNNVFLK---GVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQK  495
               +P P+LS  +   LK   G SFASGG+G+F++T   +    + L++Q++ FS+V+  
Sbjct  86   FEKSPKPFLSLNSTSLLKWFGGFSFASGGSGLFDTTGQRMTKSCIPLAEQIQQFSSVRSN  145

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            L   +G  A +  +SKS F I IG+ND+  Y+
Sbjct  146  LTALMGPVATETYISKSLFFISIGSNDIFEYY  177



>ref|XP_009400994.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Musa acuminata 
subsp. malaccensis]
Length=375

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 103/159 (65%), Gaps = 13/159 (8%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            +A KVPA+YVFGDS  DVGNNN++  S  +A+FPHNG+D+P  + TGRFSNG N  DFLA
Sbjct  37   QAGKVPAIYVFGDSTADVGNNNYLQRSNAKANFPHNGIDFPFSRPTGRFSNGYNGIDFLA  96

Query  316  EKVGL-PTPPPYLSDKN----NVF--LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
              +G   +PP +LS  N     +F  LKGV+FASGG+GI +ST + I      ++ Q++ 
Sbjct  97   IHMGFRRSPPSFLSLTNKTNHQIFKGLKGVNFASGGSGILDSTGSTIT-----MTKQIQY  151

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            FST++  ++ QI        LSKS FLI  G ND+  YF
Sbjct  152  FSTLRSNIMTQIATEPTYHLLSKSIFLISSGGNDIFAYF  190



>gb|EEC73753.1| hypothetical protein OsI_08409 [Oryza sativa Indica Group]
Length=362

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 104/160 (65%), Gaps = 13/160 (8%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID--SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            A KVPA+YVFGDS  DVGNNN++   ++ RA+FPHNG+D+P  + TGRFSNG N  DFLA
Sbjct  23   AAKVPAIYVFGDSTADVGNNNYLTGAAVPRANFPHNGIDFPTSRPTGRFSNGYNGVDFLA  82

Query  316  EKVGL-PTPPPYLS----DKNNVF--LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
              +G   +PPP+L+      N +F  L+G +FAS G+GI +ST   II     +S QV+ 
Sbjct  83   LNMGFRRSPPPFLAVANKTSNPLFRGLQGTNFASAGSGILDSTGQSIIP----MSKQVQQ  138

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            F+ VQ+ +  +I   AA   LS+S FLI  G ND+  +F+
Sbjct  139  FAAVQRNISARISQQAADTVLSRSLFLISTGGNDIFAFFS  178



>emb|CDY43014.1| BnaA03g11610D [Brassica napus]
Length=376

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 112/156 (72%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YV GDSLVD GNNN++  SI +A++PHNGVD+PG  ATGRF NG N+AD +AEK G
Sbjct  37   VPAVYVLGDSLVDAGNNNYLAISISKANYPHNGVDFPGSIATGRFCNGKNAADTIAEKFG  96

Query  328  LPTPPPYL--------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYL         ++    L GV+FASGGAGIFNS++   + +++ LS QV  + +
Sbjct  97   LPLPPPYLSLKGIFKEEERKAAALSGVNFASGGAGIFNSSDQQ-LRQSIPLSYQVNNWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++L++Q+  + A+  LSKS F ++IG+ND+ +YF
Sbjct  156  IHKELMSQLDPSEAQIHLSKSLFFVVIGSNDIFDYF  191



>ref|XP_007216510.1| hypothetical protein PRUPE_ppa025674mg [Prunus persica]
 gb|EMJ17709.1| hypothetical protein PRUPE_ppa025674mg [Prunus persica]
Length=356

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 99/147 (67%), Gaps = 4/147 (3%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            P  +VFGDSL +VGNNN++  S+ R+++P  GVDY G +ATGRF+NG    D ++EK+G+
Sbjct  27   PVTFVFGDSLTEVGNNNYLQYSLARSNYPWYGVDYAGGQATGRFTNGRTIGDIISEKLGI  86

Query  331  PTPPPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVN  504
            P+PPPYLS   N    LKGV++ASGGAGI N T    I + L   DQ++ F+  ++ +  
Sbjct  87   PSPPPYLSVSQNDDALLKGVNYASGGAGILNDTGLYFIQR-LSFDDQIQNFNKTKEAIKA  145

Query  505  QIGAAAAKQQLSKSPFLILIGNNDLIN  585
            +IG  AA +  S++ + I IG+ND +N
Sbjct  146  KIGGEAAAKLCSEAIYFIGIGSNDYVN  172



>ref|XP_010443103.1| PREDICTED: GDSL esterase/lipase At5g55050 [Camelina sativa]
Length=378

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 109/156 (70%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP +YVFGDSLVD GNNN++  SI ++++PHNG+D+P +K TGRF NG N+AD +AEK G
Sbjct  37   VPGLYVFGDSLVDAGNNNYLPISISKSNYPHNGIDFPNKKPTGRFCNGKNAADAIAEKFG  96

Query  328  LPTPPPYL--------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYL          + +  + GV+FASGGAGIFN ++   + +A+ LS QV  + +
Sbjct  97   LPLPPPYLSLRGLLKRETRKSAAVTGVNFASGGAGIFNGSDQK-LGQAIPLSKQVNNWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + + L  Q+G + A+  LSKS F ++IG+NDL +YF
Sbjct  156  IHKDLTTQLGPSEAQAHLSKSLFTVVIGSNDLFDYF  191



>ref|XP_002968205.1| hypothetical protein SELMODRAFT_89823 [Selaginella moellendorffii]
 gb|EFJ30459.1| hypothetical protein SELMODRAFT_89823 [Selaginella moellendorffii]
Length=369

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 96/151 (64%), Gaps = 3/151 (2%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            EA +VPA +VFGDSLVD GNN  + S+ +A+  HNG+D+ G  ATGRF NG    D +A+
Sbjct  30   EAPQVPAFFVFGDSLVDSGNNKFLQSLSQANHSHNGIDFQGSVATGRFCNGLTVTDVVAQ  89

Query  319  KVGLPTPPPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
            ++GLP  PPYL    N    LKGV++ASGGAG+ + T    + + L L  Q+  +   + 
Sbjct  90   ELGLPLAPPYLDPSTNGTAILKGVNYASGGAGVLDETGLYFLQR-LPLGKQIEYYGNTRS  148

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLIN  585
            +++  +G  AA Q LSKS F  +IG+ND +N
Sbjct  149  QIIGLLGQKAASQMLSKSIFCFVIGSNDYLN  179



>ref|XP_008645093.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X2 [Zea 
mays]
 gb|AFW69561.1| hypothetical protein ZEAMMB73_871181 [Zea mays]
Length=380

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 113/188 (60%), Gaps = 13/188 (7%)
 Frame = +1

Query  55   MGFACSLRKMNVFIVflsfsfflsgsfsEAQKVPAMYVFGDSLVDVGNNNHIDS--IIRA  228
            MG+   L  M   +V       LS +  E ++VPAMYVFGDS +DVGNNNH+    + RA
Sbjct  1    MGWYDGLLLMKALVVLTGSMLVLSAAAVERRRVPAMYVFGDSTLDVGNNNHLQGKQVPRA  60

Query  229  DFPHNGVDYPGR-KATGRFSNGNNSADFLAEKVGLP-TPPPYLSDKNNVFL------KGV  384
            + P+ G+D PG  K TGRFSNG N ADF+A+ +G   +P  YL  K   +L      +GV
Sbjct  61   NKPYYGIDLPGSGKPTGRFSNGYNVADFVAKHLGFEKSPLAYLVLKARNYLIPSAITRGV  120

Query  385  SFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILI  564
            S+AS GAGI +STN G     L LS QVRLF+  +  +  ++GA A  + LS+S FL+ +
Sbjct  121  SYASAGAGILDSTNAG---GNLPLSQQVRLFAATRAAMEAKVGARAVAELLSRSFFLVGV  177

Query  565  GNNDLINY  588
            G+ND   +
Sbjct  178  GSNDFFAF  185



>ref|XP_006280637.1| hypothetical protein CARUB_v10026598mg [Capsella rubella]
 gb|EOA13535.1| hypothetical protein CARUB_v10026598mg [Capsella rubella]
Length=378

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 108/156 (69%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP +YVFGDSLVD GNNN++  SI +A++PHNGVD+P  K TGRF NG N+AD +AEK G
Sbjct  38   VPGVYVFGDSLVDAGNNNYLPISISKANYPHNGVDFPNSKPTGRFCNGKNAADAIAEKFG  97

Query  328  LPTPPPYL--------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYL          + +  + GV+FASGGAGIFNS++   + +A+ LS QV  + +
Sbjct  98   LPLPPPYLSLRGLLKREKRKSAAVTGVNFASGGAGIFNSSDQK-LGQAIPLSKQVNNWFS  156

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +   L  Q+G + A+  LSKS F ++IG+NDL +YF
Sbjct  157  IHNDLTMQLGPSEAQAHLSKSLFTVVIGSNDLFDYF  192



>ref|XP_002976172.1| hypothetical protein SELMODRAFT_104120 [Selaginella moellendorffii]
 gb|EFJ23077.1| hypothetical protein SELMODRAFT_104120 [Selaginella moellendorffii]
Length=369

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 96/151 (64%), Gaps = 3/151 (2%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            EA +VPA +VFGDSLVD GNN  + S+ +A+  HNG+D+ G  ATGRF NG    D +A+
Sbjct  30   EAPQVPAFFVFGDSLVDSGNNKFLQSLSQANHSHNGIDFQGSVATGRFCNGLTVTDVVAQ  89

Query  319  KVGLPTPPPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
            ++GLP  PPYL    N    LKGV++ASGGAG+ + T    + + L L  Q+  +   + 
Sbjct  90   ELGLPLAPPYLDPSTNGTAILKGVNYASGGAGVLDETGLYFLQR-LPLGKQIEYYGNTRS  148

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLIN  585
            +++  +G  AA Q LSKS F  +IG+ND +N
Sbjct  149  QIIGLLGQKAAYQMLSKSIFCFVIGSNDYLN  179



>ref|XP_010436724.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Camelina sativa]
Length=215

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN++  S+ RADFP+ G+D+ G K TGRF+NG    D ++ K+G+P+P
Sbjct  30   YIFGDSLTEVGNNNYLQYSLARADFPYYGIDFSGGKTTGRFTNGRTIGDIISTKLGIPSP  89

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++ +L G+++ASGGAGI N T    I + L   DQ+  F   ++ +  +IG
Sbjct  90   PPYLSLSQNDDAYLSGINYASGGAGILNETGIYFIQR-LTFDDQINCFKKTKEVIRAKIG  148

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  149  DRAASKHVNDAMYFIGLGSNDYVNNF  174



>ref|XP_007141917.1| hypothetical protein PHAVU_008G236800g [Phaseolus vulgaris]
 gb|ESW13911.1| hypothetical protein PHAVU_008G236800g [Phaseolus vulgaris]
Length=366

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP  Y+FGDSL DVGNNN +  S+ + ++P  G+DY G +ATGRFSNG    DF++EK+G
Sbjct  34   VPVTYIFGDSLTDVGNNNFLQYSLAKCNYPWYGIDYGGGQATGRFSNGRTIGDFISEKLG  93

Query  328  LPTPPPYLSDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            +P+PP YLS   NV   LKGV++ASGGAGI N T    I + L   DQ+  F   ++ + 
Sbjct  94   IPSPPAYLSVSQNVDTLLKGVNYASGGAGILNDTGLYFIQR-LSFDDQISSFKKTKEVIT  152

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
              I   AA +  +++ + I IG+ND +N F
Sbjct  153  ANIKEEAANKHFNEATYFIGIGSNDYVNNF  182



>emb|CDY61423.1| BnaC03g71610D [Brassica napus]
Length=376

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            A  VPA+YV GDSLVD GNNN++  SI +A++PHNGVD+PG  ATGRF NG N+AD +AE
Sbjct  34   AASVPAVYVLGDSLVDAGNNNYLAISISKANYPHNGVDFPGSIATGRFCNGKNAADAIAE  93

Query  319  KVGLPTPPPYL--------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            K GLP PPPYL         ++    L GV+FASGGAGIFN ++   + +++ LS QV  
Sbjct  94   KFGLPLPPPYLSLKGIFKEEERKAAALSGVNFASGGAGIFNGSDQQ-LRQSIPLSYQVNN  152

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++ ++L++Q+  + A+  LSKS F ++IG+ND+ +YF
Sbjct  153  WLSIHKELMSQLDPSEAQIHLSKSLFFVVIGSNDIFDYF  191



>ref|NP_001047688.1| Os02g0669000 [Oryza sativa Japonica Group]
 dbj|BAD28305.1| putative anter-specific proline-rich protein APG [Oryza sativa 
Japonica Group]
 dbj|BAD28139.1| putative anter-specific proline-rich protein APG [Oryza sativa 
Japonica Group]
 dbj|BAF09602.1| Os02g0669000 [Oryza sativa Japonica Group]
 dbj|BAG96154.1| unnamed protein product [Oryza sativa Japonica Group]
Length=362

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 103/158 (65%), Gaps = 13/158 (8%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHID--SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            KVPA+YVFGDS  DVGNNN++   ++ RA+FPHNG+D+P  + TGRFSNG N  DFLA  
Sbjct  25   KVPAIYVFGDSTADVGNNNYLTGAAVPRANFPHNGIDFPTSRPTGRFSNGYNGVDFLALN  84

Query  322  VGL-PTPPPYLS----DKNNVF--LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFS  480
            +G   +PPP+L+      N +F  L+G +FAS G+GI +ST   II     +S QV+ F+
Sbjct  85   MGFRRSPPPFLAVANKTSNPLFRGLQGTNFASAGSGILDSTGQSIIP----MSKQVQQFA  140

Query  481  TVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             VQ+ +  +I   AA   LS+S FLI  G ND+  +F+
Sbjct  141  AVQRNISARISQQAADTVLSRSLFLISTGGNDIFAFFS  178



>ref|XP_004953406.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=384

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 103/160 (64%), Gaps = 13/160 (8%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHI--DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            + KVPA+YVFGDS  DVGNNN++   ++ RA+FPHNGVD+P  + TGRFSNG N  DFLA
Sbjct  45   SNKVPAIYVFGDSTADVGNNNYLPGSAVPRANFPHNGVDFPTSRPTGRFSNGYNGVDFLA  104

Query  316  EKVGLP-TPPPYLSDKN----NVF--LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
              +G   +PPP+L+  N     VF  L GV+FAS G+GI ++T + II     LS QV  
Sbjct  105  MNMGFKRSPPPFLAVANKTNKQVFRGLLGVNFASAGSGILDTTGSSIIP----LSQQVEQ  160

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            F  +Q+ +  +I   AA   LS+S FL+  G NDL  +F+
Sbjct  161  FDALQRNISARITQGAADAVLSRSVFLVSTGGNDLFAFFS  200



>ref|XP_010482926.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Camelina sativa]
Length=379

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 109/156 (70%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP +YVFGDSLVD GNNN++  SI ++++PHNG+D+P +K TGRF NG N+AD +AEK G
Sbjct  38   VPGLYVFGDSLVDAGNNNYLPISISKSNYPHNGIDFPNKKPTGRFCNGKNAADAIAEKFG  97

Query  328  LPTPPPYL--------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYL          + +  + GV+FASGGAGIFN ++   + +A+ LS QV  + +
Sbjct  98   LPLPPPYLSLRGLLERETRKSAAVTGVNFASGGAGIFNGSDQK-LGQAIPLSKQVNNWLS  156

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + + L  Q+G + A+  LSKS F ++IG+NDL +YF
Sbjct  157  IHKDLSTQLGPSEAQAHLSKSLFTVVIGSNDLFDYF  192



>ref|XP_006430582.1| hypothetical protein CICLE_v10013564mg [Citrus clementina]
 gb|ESR43822.1| hypothetical protein CICLE_v10013564mg [Citrus clementina]
Length=352

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 99/146 (68%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +VFGDSL +VGNNNH+  S+ R+D+P  G+D+ G++ATGRF+NG    D ++ K+G+P+P
Sbjct  29   FVFGDSLTEVGNNNHLQYSLARSDYPWYGIDFSGQQATGRFTNGRTIGDIISAKLGIPSP  88

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++  LKGV++ASGGAGI N T    I + L   DQ+  F   ++ + ++IG
Sbjct  89   PPYLSLSQNDDELLKGVNYASGGAGILNETGTYFIQR-LSFDDQINYFKKTKETIRSKIG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA +  +++ + + IG+ND +N F
Sbjct  148  EDAANKLCNEAMYFVGIGSNDYVNNF  173



>gb|ACG36192.1| GSDL-motif lipase [Zea mays]
Length=371

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 105/163 (64%), Gaps = 16/163 (10%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDS---IIRADFPHNGVDYPGRKATGRFSNGNNSADF  309
             + KVPAMYVFGDS  DVG NN++     + RA+FPHNGVD+P  + TGRFSNG N  DF
Sbjct  27   SSSKVPAMYVFGDSTADVGTNNYLPGGADVPRANFPHNGVDFPTARPTGRFSNGYNGVDF  86

Query  310  LAEKVGLP-TPPPYLSDKN----NVF--LKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
            LA  +G   +PPP+L+  N     VF  L GV+FAS G+GI ++T + II     LS QV
Sbjct  87   LAVNMGFKRSPPPFLAVANKTNRQVFRGLLGVNFASAGSGILDTTGSSIIP----LSKQV  142

Query  469  RLFSTVQQKLVNQI--GAAAAKQQLSKSPFLILIGNNDLINYF  591
              F+ V++ + +++  G+AAA   LS+S FL+  G NDL  +F
Sbjct  143  EQFAAVRRNISSRVGNGSAAADALLSRSLFLVSTGGNDLFAFF  185



>ref|XP_009132408.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Brassica rapa]
Length=376

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 111/156 (71%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +PA+YV GDSLVD GNNN++  SI +A++PHNGVD+PG  ATGRF  G N+AD +AEK G
Sbjct  37   IPAVYVLGDSLVDAGNNNYLAISISKANYPHNGVDFPGSIATGRFCTGKNAADTIAEKFG  96

Query  328  LPTPPPYL--------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYL         ++    L GV+FASGGAGIFNS++   + +++ LS QV  + +
Sbjct  97   LPLPPPYLSLKGIFKEEERKAAALSGVNFASGGAGIFNSSDQQ-LRQSIPLSYQVNNWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++L++Q+  + A+  LSKS F ++IG+ND+ +YF
Sbjct  156  IHKELMSQLDPSEAQIHLSKSLFFVVIGSNDIFDYF  191



>ref|NP_001148614.1| LOC100282230 precursor [Zea mays]
 gb|ACG32243.1| GSDL-motif lipase [Zea mays]
Length=372

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 105/163 (64%), Gaps = 16/163 (10%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID---SIIRADFPHNGVDYPGRKATGRFSNGNNSADF  309
             + KVPAMYVFGDS  DVG NN++     + RA+FPHNGVD+P  + TGRFSNG N  DF
Sbjct  28   SSSKVPAMYVFGDSTADVGTNNYLPGGAEVPRANFPHNGVDFPTARPTGRFSNGFNGVDF  87

Query  310  LAEKVGLP-TPPPYLSDKN----NVF--LKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
            LA  +G   +PPP+L+  N     VF  L GV+FAS G+GI ++T + II     LS QV
Sbjct  88   LAVNMGFKRSPPPFLAVANKTNRQVFRGLLGVNFASAGSGILDTTGSSIIP----LSKQV  143

Query  469  RLFSTVQQKLVNQI--GAAAAKQQLSKSPFLILIGNNDLINYF  591
              F+ V++ + +++  G+AAA   LS+S FL+  G NDL  +F
Sbjct  144  EQFAAVRRNISSRVGNGSAAADALLSRSLFLVSTGGNDLFAFF  186



>ref|XP_006364625.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Solanum tuberosum]
Length=371

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            A++    YVFGDSL +VGNNN++ S+ +++FP  G+DY G KATGRF+NG    D ++ K
Sbjct  23   AEEQVVTYVFGDSLTEVGNNNYLQSLAKSNFPFYGIDYEGGKATGRFTNGRTIGDIISAK  82

Query  322  VGLPTPPPYLS--DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQK  495
            +G+ +PPPYLS    ++  LKGV++ASGGAGI N T    I + +   DQ++ F   ++ 
Sbjct  83   LGVQSPPPYLSLAPNDDAILKGVNYASGGAGILNDTGLYFIQR-MTFDDQIKSFEKTKEA  141

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +  +IG  AA++ ++++ + I +G+ND +N F
Sbjct  142  IKAKIGQEAAEKHVNQAVYFIGMGSNDYVNNF  173



>ref|XP_004250176.1| PREDICTED: GDSL esterase/lipase At5g37690 [Solanum lycopersicum]
Length=371

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            A++    YVFGDSL +VGNNN++ S+ +++FP  G+DY G KATGRF+NG    D ++ K
Sbjct  23   AEEQVVTYVFGDSLTEVGNNNYLQSLAKSNFPFYGIDYEGGKATGRFTNGRTIGDIISAK  82

Query  322  VGLPTPPPYLS--DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQK  495
            +G+ +PPPYLS    ++  LKGV++ASGGAGI N T    I + +   DQ++ F   ++ 
Sbjct  83   LGVQSPPPYLSLAPNDDAILKGVNYASGGAGILNDTGIYFIQR-MTFDDQIKSFEKTKEA  141

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +  +IG  AA++ ++++ + I +G+ND +N F
Sbjct  142  IKAKIGQEAAEKHVNQAIYFIGMGSNDYVNNF  173



>ref|XP_007032977.1| SGNH hydrolase-type esterase superfamily protein [Theobroma cacao]
 gb|EOY03903.1| SGNH hydrolase-type esterase superfamily protein [Theobroma cacao]
Length=395

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +VFGDSL +VGNNNH+  S+ R+D+P  G+DY G++ATGRF+NG    D ++EK+G+  P
Sbjct  67   FVFGDSLAEVGNNNHLQYSLARSDYPWYGIDYTGKQATGRFTNGRTIGDIISEKLGISPP  126

Query  340  PPYLS--DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPYLS    ++  LKGV++ASGGAGI N T    I + L   DQ+  F   ++ +  +IG
Sbjct  127  PPYLSLLQNDDAILKGVNYASGGAGILNDTGLYFIQR-LTFDDQIDYFKKTKENIRAKIG  185

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA +  +++ + I IG+ND +N F
Sbjct  186  EEAANKLCNEAMYFIGIGSNDYVNNF  211



>gb|KDO50801.1| hypothetical protein CISIN_1g041889mg [Citrus sinensis]
Length=350

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 99/146 (68%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +VFGDSL +VGNNNH+  S+ R+D+P  G+D+ G++ATGRF+NG    D ++ K+G+P+P
Sbjct  27   FVFGDSLTEVGNNNHLQYSLARSDYPWYGIDFSGQQATGRFTNGRTIGDIISAKLGIPSP  86

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++  LKGV++ASGGAGI N T    I + L   DQ+  F   ++ + ++IG
Sbjct  87   PPYLSLSQNDDELLKGVNYASGGAGILNETGTYFIQR-LSFDDQINYFKKTKETIRSKIG  145

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA +  +++ + + +G+ND +N F
Sbjct  146  EDAANKLCNEAMYFVGMGSNDYVNNF  171



>ref|XP_002981505.1| hypothetical protein SELMODRAFT_114853 [Selaginella moellendorffii]
 gb|EFJ17320.1| hypothetical protein SELMODRAFT_114853 [Selaginella moellendorffii]
Length=352

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 101/146 (69%), Gaps = 3/146 (2%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +VPA++ FGDSL DVGNNN++ ++ +A+FP  G ++   K TGRF+NG N  DFLA ++G
Sbjct  24   EVPALFAFGDSLADVGNNNYLVTLAKANFPPYGREFDTGKPTGRFTNGRNQIDFLAARLG  83

Query  328  LPTPPPYL--SDKNNVFLKGVSFASGGAGIFNSTN-NGIISKALHLSDQVRLFSTVQQKL  498
            LP  P ++  S K    L GV+FAS G+GI + TN N +  + + +++QV+ F+ V+++L
Sbjct  84   LPLLPAFMDPSTKGLAMLSGVNFASAGSGILDITNINFVQGQLIQITEQVQNFAKVKEEL  143

Query  499  VNQIGAAAAKQQLSKSPFLILIGNND  576
            V+ +G+A A + LS+S F I  GNND
Sbjct  144  VSMVGSANATEMLSRSLFCIFTGNND  169



>ref|XP_006482381.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Citrus sinensis]
Length=352

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 99/146 (68%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +VFGDSL +VGNNNH+  S+ R+D+P  G+D+ G++ATGRF+NG    D ++ K+G+P+P
Sbjct  29   FVFGDSLTEVGNNNHLQYSLARSDYPWYGIDFSGQQATGRFTNGRTIGDIISAKLGIPSP  88

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++  LKGV++ASGGAGI N T    I + L   DQ+  F   ++ + ++IG
Sbjct  89   PPYLSLSQNDDELLKGVNYASGGAGILNETGTYFIQR-LSFDDQINYFKKTKETIRSKIG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA +  +++ + + +G+ND +N F
Sbjct  148  EDAANKLCNEAMYFVGMGSNDYVNNF  173



>gb|KFK27114.1| hypothetical protein AALP_AA8G336400 [Arabis alpina]
Length=377

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 102/156 (65%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P +YVFGDSLVD GNNNH+  S+ +A++P NGVD+PG K TGRF NG N+AD +AEK G
Sbjct  37   IPGLYVFGDSLVDAGNNNHLAISLAKANYPRNGVDFPGGKPTGRFCNGKNAADAIAEKFG  96

Query  328  LP--------TPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP                + +  + GV+FASGGAGIFN ++     +++ LS QV  + +
Sbjct  97   LPLPPPYLSLKGLLKKKKRESASVTGVNFASGGAGIFNGSDE-TFKQSIPLSHQVNHWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + +++  Q+  + A+  LSKS F ++IG+NDL +YF
Sbjct  156  IHEEITTQLRPSEAQTHLSKSLFFVVIGSNDLFDYF  191



>ref|XP_010905234.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Elaeis guineensis]
Length=376

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 101/160 (63%), Gaps = 12/160 (8%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EA KVPA+YVFGDS  DVGNNN++  +  RA+FPHNG+D+P  + TGRFSNG N  DFLA
Sbjct  37   EAAKVPAIYVFGDSTADVGNNNYLPGNSPRANFPHNGIDFPFSRPTGRFSNGYNGVDFLA  96

Query  316  EKVGL-PTPPPYLSDKNNV------FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
              +G   +PPP+LS  N         LKGV+FASGG+GI   +    IS    ++ Q++ 
Sbjct  97   MHMGFRRSPPPFLSLTNKTKHQIMRGLKGVNFASGGSGIALESMGSTIS----MTKQIQN  152

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            F+ ++  +  +IG   A   LS+S FLI  G ND+  Y++
Sbjct  153  FAMIKSNITARIGTKTADYLLSRSIFLISTGGNDIFAYYS  192



>gb|AFW63334.1| GSDL-motif protein lipase [Zea mays]
Length=371

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 106/163 (65%), Gaps = 16/163 (10%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHID---SIIRADFPHNGVDYPGRKATGRFSNGNNSADF  309
             + KVPA+YVFGDS  DVG NN++     + RA+FPHNGVD+P  + TGRFSNG N  DF
Sbjct  27   SSSKVPALYVFGDSTADVGTNNYLPGGAEVPRANFPHNGVDFPTARPTGRFSNGYNGVDF  86

Query  310  LAEKVGLP-TPPPYLSDKN----NVF--LKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
            LA  +G   +PPP+L+  N     VF  L GV+FAS G+GI ++T + II     LS QV
Sbjct  87   LAVNMGFKRSPPPFLAVANKTNRQVFRGLLGVNFASAGSGILDTTGSSIIP----LSKQV  142

Query  469  RLFSTVQQKLVNQI--GAAAAKQQLSKSPFLILIGNNDLINYF  591
              F++V++ + +++  G+AAA   LS+S FL+  G NDL  +F
Sbjct  143  EQFASVRRNISSRVGNGSAAADALLSRSLFLVSTGGNDLFAFF  185



>ref|XP_004982496.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=371

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 15/162 (9%)
 Frame = +1

Query  145  QKVPA-MYVFGDSLVDVGNNNHI--DSIIRADFPHNGVDYPGR-KATGRFSNGNNSADFL  312
            ++VPA +YVFGDS +DVGN+N++   ++ RAD P+ G+D PG  K  GRFSNG N+ADF 
Sbjct  30   RRVPAAIYVFGDSTMDVGNSNYLPGKNVPRADHPYYGIDMPGSGKPNGRFSNGYNTADFF  89

Query  313  AEKVG-LPTPPPYLS---DKNNV----FLKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
            A+ +G + +PPPYLS     NN+    F  GVS+AS GAGI +STN G   K++ LS QV
Sbjct  90   AQSMGFMSSPPPYLSLAPSSNNLVQTAFATGVSYASSGAGILDSTNAG---KSIPLSRQV  146

Query  469  RLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            + FS    K+V   G+ A    LS+S FLI IG NDL  + N
Sbjct  147  QYFSATCSKMVASKGSGAVSALLSRSIFLIGIGGNDLAAFAN  188



>ref|XP_009789284.1| PREDICTED: GDSL esterase/lipase At5g37690 [Nicotiana sylvestris]
Length=360

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPP  342
            YVFGDSL +VGNNN++ S+ ++++P  G+DY G KATGRF+NG    D ++ K+G+ +PP
Sbjct  29   YVFGDSLTEVGNNNYLQSLAKSNYPFYGIDYEGGKATGRFTNGRTIGDIISAKLGVQSPP  88

Query  343  PYLS--DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGA  516
            PYLS    ++  LKGV++ASGGAGI N T    I + +   DQ++ F   ++ +  +IG 
Sbjct  89   PYLSLAPNDDAILKGVNYASGGAGILNDTGLYFIQR-MTFDDQIKSFENTKEAIKAKIGE  147

Query  517  AAAKQQLSKSPFLILIGNNDLINYF  591
             AA++ ++K+ + I +G+ND +N F
Sbjct  148  EAAEKHVNKAVYFIGMGSNDYVNNF  172



>ref|XP_010450525.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Camelina sativa]
Length=357

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 98/146 (67%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN++  S+ RADFP+ G+D+ G KATGRF+NG    D ++ K+G+P+P
Sbjct  30   YIFGDSLTEVGNNNYLQYSLARADFPYYGIDFSGGKATGRFTNGRTIGDIISTKLGIPSP  89

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++ +L G+++ASGGAGI N T    I + L   DQ+  F   ++ +  +IG
Sbjct  90   PPYLSLSQNDDAYLSGINYASGGAGILNETGIYFIQR-LTFDDQINCFKKTKEVIRAKIG  148

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  149  DRAASKHVNDAMYFIGLGSNDYVNNF  174



>ref|XP_009596775.1| PREDICTED: GDSL esterase/lipase 7-like [Nicotiana tomentosiformis]
Length=359

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 97/151 (64%), Gaps = 4/151 (3%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            E    PA+YVFGDSL D GNNN + +  +ADF   G+++ G  ATGRF+NG   ADF+AE
Sbjct  24   EFPLAPALYVFGDSLFDSGNNNLLPTFAKADFKPYGINFNG-GATGRFTNGKTVADFIAE  82

Query  319  KVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFS-TVQQK  495
             +GLP  PPYLS + +V L G+++ASG  GI   T N II K LHLS+QV LF  TV+Q+
Sbjct  83   FLGLPFSPPYLSLRGSVKLTGLNYASGSCGILPETGN-IIGKCLHLSEQVDLFQRTVEQE  141

Query  496  LVNQI-GAAAAKQQLSKSPFLILIGNNDLIN  585
            L  Q          LS+S FLI  G+ND +N
Sbjct  142  LPKQYDDPEELSSYLSRSIFLISTGSNDYVN  172



>ref|XP_009370610.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Pyrus x bretschneideri]
Length=359

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +VFGDSL DVGNNN++  S+ ++++P  GVDY G + TGRFSNG    D ++EK+G+P+P
Sbjct  24   FVFGDSLTDVGNNNYLQYSLAKSNYPWYGVDYVGGRPTGRFSNGRTIGDLISEKLGIPSP  83

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  N+  LKGV++ASGGAGI NST    I + L   DQ++ F    + +  +IG
Sbjct  84   PPYLSLSRNNDALLKGVNYASGGAGILNSTGLYFIQR-LSFDDQIQNFKKTTEVIKAKIG  142

Query  514  AAAAKQQLSKSPFLILIGNNDLIN  585
            A AA +   ++ F + +G+ND IN
Sbjct  143  AQAAAKLFKEAIFFLGLGSNDYIN  166



>ref|XP_010440879.1| PREDICTED: GDSL esterase/lipase At5g37690 [Camelina sativa]
Length=365

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 98/146 (67%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN++  S+ RADFP+ G+D+ G KATGRF+NG    D ++ K+G+P+P
Sbjct  30   YIFGDSLTEVGNNNYLQYSLARADFPYYGIDFSGGKATGRFTNGRTIGDIISTKLGIPSP  89

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++ +L G+++ASGGAGI N T    I + L   DQ+  F   ++ +  +IG
Sbjct  90   PPYLSLSQNDDAYLSGINYASGGAGILNETGIYFIQR-LTFDDQINCFKKTKEVIRAKIG  148

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  149  DRAASKHVNDAMYFIGLGSNDYVNNF  174



>ref|XP_004966493.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=342

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 101/150 (67%), Gaps = 13/150 (9%)
 Frame = +1

Query  160  MYVFGDSLVDVGNNNHID--SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLP  333
            MYV GDS++DVGNNN++    + RA+ P+ G+D+PGR  TGRFSNG N+AD++A+ +GL 
Sbjct  1    MYVLGDSILDVGNNNYLPGADVFRANRPYYGIDFPGRIPTGRFSNGFNTADYIAKSMGLV  60

Query  334  -TPPPYLS-DKNNVFL------KGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
             +PPPYLS   NN+ L       GVS+AS GAGI +STN+G   K + LS Q+  F+  +
Sbjct  61   RSPPPYLSLAPNNLSLVLAALTTGVSYASAGAGILDSTNSG---KCIPLSRQLEYFNATR  117

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDL  579
             K++   G+ A    LSKS FL+  G+NDL
Sbjct  118  AKMLAAAGSPAVTALLSKSIFLVTFGSNDL  147



>ref|XP_004145849.1| PREDICTED: GDSL esterase/lipase At5g37690 [Cucumis sativus]
 gb|KGN57789.1| hypothetical protein Csa_3G303130 [Cucumis sativus]
Length=374

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 96/145 (66%), Gaps = 3/145 (2%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPP  342
            YVFGDSL +VGNNN ++S+ R+D+P  GVDY G + TGRF+NG    D ++EK+G+  PP
Sbjct  44   YVFGDSLTEVGNNNFLNSLARSDYPWYGVDYNGGQPTGRFTNGRTIGDIISEKLGIEAPP  103

Query  343  PYLS--DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGA  516
            PYLS    ++  + GV++ASGGAGI N T    I + + L DQ++ F   ++ +  +IG 
Sbjct  104  PYLSLTKDDDKLIHGVNYASGGAGILNDTGLYFIQR-MTLDDQIQSFYQTKKAIARKIGE  162

Query  517  AAAKQQLSKSPFLILIGNNDLINYF  591
             AA Q  +++ + I IG+ND +N F
Sbjct  163  EAALQHCNQAIYFIGIGSNDYVNNF  187



>ref|XP_009132409.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Brassica rapa]
Length=376

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 109/155 (70%), Gaps = 10/155 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P +YVFGDSLVD GNNN++  S+ + ++PHNG+D+P +KATGRF NG N AD +AEK+G
Sbjct  36   IPGVYVFGDSLVDAGNNNYLPFSLAKGNYPHNGIDFPKKKATGRFCNGKNFADVIAEKIG  95

Query  328  LPTPPPY--------LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPY           + +  + GV+FASGGAGIF+ ++     +A+ LS Q++ + +
Sbjct  96   LPLPPPYLSLRGLLKWRKRESAAVTGVNFASGGAGIFDGSSQ-FPGQAIPLSQQLKHWLS  154

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            + + L  ++G + A+  LSKS F+++IG+NDL+NY
Sbjct  155  IHKALTRKLGRSKAQIHLSKSLFVMVIGSNDLLNY  189



>ref|XP_002451409.1| hypothetical protein SORBIDRAFT_04g001560 [Sorghum bicolor]
 gb|EES04385.1| hypothetical protein SORBIDRAFT_04g001560 [Sorghum bicolor]
Length=374

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 101/167 (60%), Gaps = 23/167 (14%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            KVPAMYVFGDS  DVGNN+++  SI RADFPHNGVD+PG   TGRFSNG   ADFLA  +
Sbjct  31   KVPAMYVFGDSTADVGNNDYLPWSIARADFPHNGVDFPGGTPTGRFSNGLIGADFLAIAM  90

Query  325  GLP-TPPPYLS-------------DKNNV---FLKGVSFASGGAGIFNSTNNGIISKALH  453
            G   +PPPYLS              +N     ++ G +FAS G+G+ +ST + I      
Sbjct  91   GFSGSPPPYLSLMAATAANSSSEVTRNTTMAAYMSGANFASAGSGLLDSTGSTI-----S  145

Query  454  LSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            ++ Q+  FS ++ ++  ++ A      LSKS FLI  G+ND  ++F+
Sbjct  146  MTQQIGYFSDLKDQMSTRLSAGRVADSLSKSVFLISAGSNDAFDFFS  192



>ref|XP_008381376.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Malus domestica]
Length=356

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 100/144 (69%), Gaps = 4/144 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +VFGDSL +VGNNN++  S+ ++++P  GVDY G +ATGRF+NG    D +++K+G+P+P
Sbjct  26   FVFGDSLTEVGNNNYLSYSLAKSNYPWYGVDYAGGRATGRFTNGRTIGDIISKKLGIPSP  85

Query  340  PPYLS--DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPYLS    ++  LKGV++ASGGAGI N T    I + +   DQ++ F+  ++ +  +IG
Sbjct  86   PPYLSLAQNDDALLKGVNYASGGAGILNDTGLYFIQR-MSFDDQIQKFNKTKEAIKAKIG  144

Query  514  AAAAKQQLSKSPFLILIGNNDLIN  585
            A AA +  S++ + I IG+ND +N
Sbjct  145  AEAAAKLCSEAIYFIGIGSNDYVN  168



>ref|XP_010113268.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXC35275.1| GDSL esterase/lipase [Morus notabilis]
Length=354

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSI-IRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+YVFGDS  DVG NN++     + +FPH+G+DYPG K TGRFSNG NS DFLA+ +G
Sbjct  15   VPAIYVFGDSTADVGTNNYLAECGAKVNFPHHGIDYPGSKPTGRFSNGYNSIDFLAQFLG  74

Query  328  L-PTPPPYL----SDKNNVF---LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
               +PPP+L     DK N     L G +FASGGAG+   T      + + +++QV+ F+ 
Sbjct  75   FEESPPPFLYLLRKDKKNFMRNVLNGANFASGGAGLLGITGKRPYKRVISVAEQVQQFAK  134

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            V+      +G   A+ +LSKS FLI +G+ND+  YF
Sbjct  135  VRNAYTKLLG-NQAEDRLSKSLFLISVGSNDIFEYF  169



>ref|XP_002870554.1| hypothetical protein ARALYDRAFT_493746 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46813.1| hypothetical protein ARALYDRAFT_493746 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 98/146 (67%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN++  S+ RADFP+ GVD+ G K TGRF+NG    D ++ K+G+P+P
Sbjct  29   YIFGDSLTEVGNNNYLQYSLARADFPYYGVDFSGGKVTGRFTNGRTIGDIISTKLGIPSP  88

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++ FL G+++ASGGAGI N T    I + L  +DQ+  F   ++ +  +IG
Sbjct  89   PPYLSLSQNDDAFLSGINYASGGAGILNETGIYFIQR-LTFNDQINYFKKSKEVIRAKIG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  148  DGAANKHVNDAMYFIGLGSNDYVNNF  173



>ref|XP_008457023.1| PREDICTED: GDSL esterase/lipase At5g37690 [Cucumis melo]
Length=378

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 101/155 (65%), Gaps = 5/155 (3%)
 Frame = +1

Query  139  EAQKVPAM--YVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFL  312
            EA+K   +  YVFGDSL +VGNNN+++S+ R+D+P  GVDY G + TGRF+NG    D +
Sbjct  32   EAKKSSELVTYVFGDSLTEVGNNNYLNSLARSDYPWYGVDYNGGQPTGRFTNGRTIGDII  91

Query  313  AEKVGLPTPPPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
            +EK+G+  PPPY  LS  ++  + GV++ASGGAGI N T    I + L   DQ+  F+  
Sbjct  92   SEKLGIEAPPPYLSLSKDDDKLIHGVNYASGGAGILNDTGLYFIQR-LTFDDQIESFNQT  150

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            ++ +  +IG  AA +  +++ + I IG+ND +N F
Sbjct  151  KKGIARKIGEEAALKHCNEAIYFIGIGSNDYVNNF  185



>ref|XP_002984381.1| hypothetical protein SELMODRAFT_120432 [Selaginella moellendorffii]
 gb|EFJ14431.1| hypothetical protein SELMODRAFT_120432 [Selaginella moellendorffii]
Length=363

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 94/148 (64%), Gaps = 3/148 (2%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            + PA +VFGDSLVD GNNN+I S+ +AD P NGVD+PG + TGRF NG    D + E  G
Sbjct  26   QAPASFVFGDSLVDGGNNNYIFSLSKADQPANGVDFPGGRPTGRFCNGRTIPDIIGESFG  85

Query  328  LPTPPPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            +P  PPYL+   +    L+GV++ASGG GI + T    I + L LS Q+  F    ++L 
Sbjct  86   IPYAPPYLAPTTHGAAILRGVNYASGGGGIVDETGRIFIGR-LSLSKQLLYFQNTTRELK  144

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLIN  585
            + +G  AA+Q L+KS F + IG ND +N
Sbjct  145  SMLGEDAARQYLAKSIFSVTIGANDYLN  172



>gb|AES61163.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=212

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
             AQ   A +VFGDSL D GNN+ + + +RADFP  G+DYP  K TGRFSNG N  D ++E
Sbjct  25   HAQPTRAFFVFGDSLADNGNNHLLFTTLRADFPPYGIDYPTHKPTGRFSNGLNIPDIISE  84

Query  319  KVGLPTPPPYLSD--KNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
            ++GL    PYLS        L G +FAS G GI N T    + + LH+  Q++LF   Q+
Sbjct  85   QLGLEQTLPYLSPLLLGEKLLVGANFASAGVGILNDTGIQFL-QILHIHKQLKLFEQYQR  143

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLIN  585
            +L   IGA  AK+ ++K+  LI+IG ND +N
Sbjct  144  RLRAHIGAEEAKKLVNKALVLIIIGGNDFVN  174



>ref|XP_009781455.1| PREDICTED: GDSL esterase/lipase 7-like [Nicotiana sylvestris]
Length=359

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 4/151 (3%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            E    PA+YVFGDSL D GNNN + +  +ADF   G+++ G  ATGRF+NG   ADF+AE
Sbjct  24   EFPLAPALYVFGDSLFDSGNNNLLPTFAKADFKPYGINFNG-GATGRFTNGKTVADFIAE  82

Query  319  KVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFS-TVQQK  495
             +GLP  PPYLS + +V L G+++ASG  GI   T N II K LHLS+QV LF  TV+Q+
Sbjct  83   FLGLPFSPPYLSLRGSVKLTGLNYASGSCGILPETGN-IIGKCLHLSEQVDLFQRTVEQE  141

Query  496  LVNQI-GAAAAKQQLSKSPFLILIGNNDLIN  585
            L  Q          LS+S FL+  G+ND +N
Sbjct  142  LPKQYDDPEELSSYLSRSIFLVSTGSNDYVN  172



>ref|XP_002972805.1| hypothetical protein SELMODRAFT_232013 [Selaginella moellendorffii]
 gb|EFJ26026.1| hypothetical protein SELMODRAFT_232013 [Selaginella moellendorffii]
Length=363

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 94/148 (64%), Gaps = 3/148 (2%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            + PA +VFGDSLVD GNNN+I S+ +AD P NGVD+PG + TGRF NG    D + E  G
Sbjct  26   QAPASFVFGDSLVDGGNNNYIFSLSKADQPANGVDFPGGRPTGRFCNGRTIPDIIGESFG  85

Query  328  LPTPPPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            +P  PPYL+   +    L+GV++ASGG GI + T    I + L LS Q+  F    ++L 
Sbjct  86   IPYAPPYLAPTTHGAAILRGVNYASGGGGIVDETGRIFIGR-LSLSKQLLYFQNTTRELK  144

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLIN  585
            + +G  AA+Q L+KS F + IG ND +N
Sbjct  145  SMLGEDAARQYLAKSIFSVTIGANDYLN  172



>ref|XP_006285681.1| hypothetical protein CARUB_v10007145mg [Capsella rubella]
 gb|EOA18579.1| hypothetical protein CARUB_v10007145mg [Capsella rubella]
Length=357

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 99/146 (68%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN++  S+ RADFP+ GVD+ G KATGRF+NG    D +++K+G+ +P
Sbjct  30   YIFGDSLTEVGNNNYLQYSLARADFPYYGVDFSGGKATGRFTNGRTIGDIISKKLGIASP  89

Query  340  PPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPYLS   N   +L G+++ASGGAGI N T    I + L  +DQ++ F   ++ +  +IG
Sbjct  90   PPYLSLSRNDDAYLSGINYASGGAGILNETGIYFIQR-LTFNDQIKCFKKTKEVIRAKIG  148

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  149  DRAANKHVNDAMYFIGLGSNDYVNNF  174



>ref|XP_006828510.1| PREDICTED: GDSL esterase/lipase At5g37690 [Amborella trichopoda]
 gb|ERM95926.1| hypothetical protein AMTR_s00060p00187780 [Amborella trichopoda]
Length=364

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            P  ++FGDSL DVGNNN++  S+ +++FP  GVDYPG + TGRF+NG    D +AEK+G+
Sbjct  30   PVTFIFGDSLTDVGNNNYLQFSLAKSNFPWYGVDYPGGRPTGRFTNGRTIGDIVAEKLGI  89

Query  331  PTPPPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVN  504
            P+PPPY  LS  ++  L+GV++ASGG GI N T    I K +   DQ+  F   +  +  
Sbjct  90   PSPPPYLSLSPSDDAILRGVNYASGGGGILNETGIYFIQK-MSFDDQINNFKKTKNAMKV  148

Query  505  QIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +IG AAA+   + + + + +G+ND +N F
Sbjct  149  KIGEAAAETLCNNAIYFVGMGSNDYVNNF  177



>ref|XP_006647662.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Oryza brachyantha]
Length=364

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 100/154 (65%), Gaps = 13/154 (8%)
 Frame = +1

Query  160  MYVFGDSLVDVGNNNHID--SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL-  330
            MYVFGDS  DVGNNN++   ++ RA+FPHNG+D+P  + TGRFSNG N  DFLA  +G  
Sbjct  31   MYVFGDSTADVGNNNYLPGAAVPRANFPHNGIDFPTSRPTGRFSNGYNGVDFLALNMGFR  90

Query  331  PTPPPYLS----DKNNVF--LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
             +PPPYL+      N +F  L+GV+FAS G+GI +ST   II     +S QV  F+ VQ+
Sbjct  91   RSPPPYLAVANKTSNPLFRGLQGVNFASAGSGILDSTGQSIIP----MSKQVEQFAIVQR  146

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             + ++I   AA   LS+S FLI  G ND+  +F+
Sbjct  147  NISSRISKQAADSVLSRSLFLISTGGNDIFAFFS  180



>gb|KHN39466.1| GDSL esterase/lipase [Glycine soja]
Length=353

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 4/150 (3%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P  Y+FGDSL DVGNNN +  S+ ++++P  G+DY G +ATGRF+NG    DF++ K+G
Sbjct  23   LPVTYIFGDSLTDVGNNNFLQYSLAKSNYPWYGIDYSGGQATGRFTNGRTIGDFISAKLG  82

Query  328  LPTPPPYLSDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            + +PP YLS   NV   LKGV++ASGGAGI N T    I + L   DQ+  F   ++ + 
Sbjct  83   ISSPPAYLSVSQNVDTLLKGVNYASGGAGILNDTGLYFIQR-LSFDDQINNFKKTKEVIT  141

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
              IG AAA +  +++ + I IG+ND +N F
Sbjct  142  ANIGEAAANKHCNEATYFIGIGSNDYVNNF  171



>ref|XP_003519329.1| PREDICTED: GDSL esterase/lipase At5g37690-like isoform X1 [Glycine 
max]
 gb|KHN41068.1| GDSL esterase/lipase [Glycine soja]
Length=352

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 4/150 (3%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P  Y+FGDSL DVGNNN +  S+ ++++P  G+DY G +ATGRF+NG    DF++ K+G
Sbjct  21   LPVTYIFGDSLTDVGNNNFLQYSLAKSNYPWYGIDYSGGQATGRFTNGRTIGDFISAKLG  80

Query  328  LPTPPPYLSDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            + +PP YLS   NV   LKGV++ASGGAGI N T    I + L   DQ+  F   ++ + 
Sbjct  81   ITSPPAYLSATQNVDTLLKGVNYASGGAGILNDTGLYFIER-LSFDDQINNFKKTKEVIS  139

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
              IG AAA +  +++ + I IG+ND +N F
Sbjct  140  ANIGEAAANKHCNEATYFIGIGSNDYVNNF  169



>ref|XP_004289592.1| PREDICTED: GDSL esterase/lipase At5g37690 [Fragaria vesca subsp. 
vesca]
Length=356

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            P  +VFGDSL DVGNNN +  S+ ++++P  GVDY G +ATGRF+NG    D ++ K+G+
Sbjct  27   PTTFVFGDSLTDVGNNNFLQYSLAKSNYPWYGVDYEGGQATGRFTNGRTVGDIISAKLGI  86

Query  331  PTPPPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVN  504
             +PPPYLS   N    LKGV++ASGGAGI N T    I + L   DQV+ F+  ++ +  
Sbjct  87   SSPPPYLSLSMNDDALLKGVNYASGGAGILNDTGLYFIER-LSFDDQVQSFNKTREAIKA  145

Query  505  QIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +IG+ AA + L+++ + I IG+ND +N F
Sbjct  146  KIGSEAATKLLTEALYFIGIGSNDYVNNF  174



>ref|XP_008228044.1| PREDICTED: GDSL esterase/lipase At5g37690 [Prunus mume]
Length=356

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            P  +VFGDSL +VGNNN++  S+ ++++P  G+DY G +ATGRF+NG    D ++EK+G+
Sbjct  27   PVTFVFGDSLTEVGNNNYLQYSLAKSNYPWYGIDYAGGQATGRFTNGRTIGDIISEKLGI  86

Query  331  PTPPPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVN  504
            P+PPPYLS   N    LKGV++ASGGAGI N T    I +     DQ++ F+   + +  
Sbjct  87   PSPPPYLSVSQNDDALLKGVNYASGGAGILNDTGLYFIQR-FSFDDQIQNFNKTTEAIKA  145

Query  505  QIGAAAAKQQLSKSPFLILIGNNDLIN  585
            +IG  AA +  S++ + I IG+ND +N
Sbjct  146  KIGGEAAAKLCSEAVYFIGIGSNDYVN  172



>ref|XP_010324308.1| PREDICTED: GDSL esterase/lipase At5g55050-like isoform X2 [Solanum 
lycopersicum]
Length=332

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +1

Query  313  AEKVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
            AEK+G+PTPPPYLSDKNN F KGVSFASGGAGIF +TN  +IS AL +S QV+LF  VQQ
Sbjct  54   AEKLGIPTPPPYLSDKNNQFPKGVSFASGGAGIFRTTNGELISFALDMSQQVQLFLLVQQ  113

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +LV Q+G  A  ++LSKS F+++IG+ND+INYF
Sbjct  114  RLVKQLGGDAGMKKLSKSIFVVVIGSNDIINYF  146



>ref|XP_009418683.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Musa acuminata 
subsp. malaccensis]
Length=360

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 98/156 (63%), Gaps = 13/156 (8%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSI-IRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            KVPA+YVFGDS  DVGNNN++     +ADFPH GVD+P +  TGRFSNG N+ DFLA  +
Sbjct  26   KVPAVYVFGDSTADVGNNNYLSGTDAKADFPHYGVDFPHQTPTGRFSNGYNTIDFLAIHM  85

Query  325  GLP-TPPPYLSDKNNVF------LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            G   +PPPYL+  N          +GVSFASGG+GI +ST   I      ++ Q++ F+ 
Sbjct  86   GFKRSPPPYLAVVNKTHPLILRGRRGVSFASGGSGILDSTGTTIT-----MTKQIQDFAA  140

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             +  + +++ AA AK  LSKS  LI  G ND+  +F
Sbjct  141  HESNIASRVTAAVAKGLLSKSVLLISSGGNDVFAFF  176



>ref|XP_002864371.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40630.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=376

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 110/156 (71%), Gaps = 11/156 (7%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VP +YVFGDSLVD GNNNH+  SI +A++PHNGVD+P +K TGRF NG N+AD +AEK G
Sbjct  37   VPGLYVFGDSLVDAGNNNHLLLSISKANYPHNGVDFPNKKPTGRFCNGKNAADAIAEKFG  96

Query  328  LPTPPPYL--------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYL          + +  + GV+FASGGAGIFNS++   + + + LS QV  + +
Sbjct  97   LPLPPPYLSLRGLLKREQRKSAAVTGVNFASGGAGIFNSSDEK-LGQGIPLSKQVNNWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++L+ ++  + A+  LSKS F ++IG+NDL +YF
Sbjct  156  IHEELM-KLEPSEAQIHLSKSLFTVVIGSNDLFDYF  190



>ref|XP_006596502.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Glycine max]
Length=358

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 4/150 (3%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P  Y+FGDSL DVGNNN +  S+ ++++P  G+DY G +ATGRF+NG    DF++ K+G
Sbjct  23   LPVTYIFGDSLTDVGNNNFLQYSLAKSNYPWYGIDYSGGQATGRFTNGRTIGDFISAKLG  82

Query  328  LPTPPPYLSDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            + +PP YLS   NV   LKGV++ASGGAGI N T    I + L   DQ+  F   ++ + 
Sbjct  83   ISSPPAYLSVSQNVDTLLKGVNYASGGAGILNDTGLYFIQR-LSFDDQINNFKKTKEVIT  141

Query  502  NQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
              IG AAA +  +++ + I IG+ND +N F
Sbjct  142  ANIGEAAANKHCNEATYFIGIGSNDYVNNF  171



>ref|XP_008781241.1| PREDICTED: GDSL esterase/lipase At5g55050-like isoform X1 [Phoenix 
dactylifera]
Length=359

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 13/156 (8%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            KVPA+YVFGDS  DVGNNN++  +  +A+FPH G+D+P  + TGRFSNG N  DFLA  +
Sbjct  24   KVPAIYVFGDSTADVGNNNYLPGNDAKANFPHYGIDFPHSRPTGRFSNGFNGIDFLAGHM  83

Query  325  GL-PTPPPYLSDKNNVF------LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            G   +PPPYLS  N         L+GV+FASGG+GI +ST   I      ++ Q++ F+T
Sbjct  84   GFRRSPPPYLSLTNKTSHGILKGLRGVNFASGGSGILDSTGTTIT-----MTKQIKYFAT  138

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            ++ ++  ++ A      LSKS FLI  G NDL  +F
Sbjct  139  IRSRIAARLNAERTNDVLSKSIFLISAGGNDLFAFF  174



>ref|XP_002279442.2| PREDICTED: GDSL esterase/lipase At5g55050-like [Vitis vinifera]
 emb|CBI37763.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 104/157 (66%), Gaps = 14/157 (9%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +PA+++ GDS  DVG N  +  S++RAD P NG+D+P  + TGRFSNG N+ADFLA+ +G
Sbjct  11   LPALFILGDSTADVGTNTLLPQSVVRADLPFNGIDFPHSRPTGRFSNGFNTADFLAKHIG  70

Query  328  L-PTPPPYLSDKNNV------FLKGVSFASGGAGIFNSTNN--GIISKALHLSDQVRLFS  480
               +PPP+LS  ++       FL+GV+FASGG+GI ++T    GII+    L  Q++ F+
Sbjct  71   YRRSPPPFLSILSHSSSLSKKFLRGVNFASGGSGILDTTGQTLGIIT----LGAQIQQFA  126

Query  481  TVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            TV   L   IG    ++ LSKS F+I  G+ND+INYF
Sbjct  127  TVHSNLTAAIGPEETEKFLSKSLFVISTGSNDIINYF  163



>ref|NP_200316.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FIA1.1|GDL87_ARATH RecName: Full=GDSL esterase/lipase At5g55050; AltName: Full=Extracellular 
lipase At5g55050; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10579.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
 gb|AAL59904.1| putative GDSL-motif lipase/hydrolase [Arabidopsis thaliana]
 gb|AAN13154.1| putative GDSL-motif lipase/hydrolase [Arabidopsis thaliana]
 gb|AED96573.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=376

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 112/156 (72%), Gaps = 11/156 (7%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P +YVFGDSLVD GNNN++  SI +A++PHNGVD+P +K TGRF NG N+AD +AEK G
Sbjct  37   IPGLYVFGDSLVDAGNNNYLPISISKANYPHNGVDFPNKKPTGRFCNGKNAADAIAEKFG  96

Query  328  LPTPPPYL--------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYL          + +  + GV+FASGGAGIFNS++   + +A+ LS QV  + +
Sbjct  97   LPLPPPYLSLRGLLKREKRKSAAVTGVNFASGGAGIFNSSDQK-LGQAIPLSKQVNNWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + ++++ ++  +AA+  LSKS F ++IG+NDL +YF
Sbjct  156  IHEEVM-KLEPSAAQLHLSKSLFTVVIGSNDLFDYF  190



>emb|CAN75126.1| hypothetical protein VITISV_042427 [Vitis vinifera]
Length=345

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 104/157 (66%), Gaps = 14/157 (9%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +PA+++ GDS  DVG N  +  S++RAD P NG+D+P  + TGRFSNG N+ADFLA+ +G
Sbjct  11   LPALFILGDSTADVGTNTLLPQSVVRADLPFNGIDFPHSRPTGRFSNGFNTADFLAKHIG  70

Query  328  L-PTPPPYLSDKNNV------FLKGVSFASGGAGIFNSTNN--GIISKALHLSDQVRLFS  480
               +PPP+LS  ++       FL+GV+FASGG+GI ++T    GII+    L  Q++ F+
Sbjct  71   YRRSPPPFLSILSHSSSLSKKFLRGVNFASGGSGILDTTGQTLGIIT----LGAQIQQFA  126

Query  481  TVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            TV   L   IG    ++ LSKS F+I  G+ND+INYF
Sbjct  127  TVHSNLTAAIGPEETEKFLSKSLFVISTGSNDIINYF  163



>ref|XP_009367135.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Pyrus x bretschneideri]
Length=356

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 100/144 (69%), Gaps = 4/144 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +VFGDSL +VGNNN++  S+ R+++P  GVDY G +ATGRF+NG    D +++K+G+P+P
Sbjct  26   FVFGDSLTEVGNNNYLSYSLARSNYPWYGVDYDGGRATGRFTNGRTIGDIISKKLGIPSP  85

Query  340  PPYLS--DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPYLS    ++  LKGV++ASGGAGI N T    I + +   DQ++ F+  ++ +  +IG
Sbjct  86   PPYLSLAQNDDALLKGVNYASGGAGILNDTGLYFIQR-MSFDDQIQNFNKTREVIKAKIG  144

Query  514  AAAAKQQLSKSPFLILIGNNDLIN  585
            A AA +  S++ + I +G+ND +N
Sbjct  145  AEAAAKLCSEAIYFIGLGSNDYVN  168



>ref|XP_004289054.2| PREDICTED: uncharacterized protein LOC101311518 [Fragaria vesca 
subsp. vesca]
Length=911

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 99/161 (61%), Gaps = 11/161 (7%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSI-IRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            E   VPA+Y+FGDS VDVG N+++     RAD PHNG+DYPG KATGRFSNG+N ADFLA
Sbjct  32   ENITVPAIYIFGDSTVDVGTNSYLPKCKARADMPHNGIDYPGSKATGRFSNGHNVADFLA  91

Query  316  EKVGL-PTPPPYLS--------DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
            + +G   +PPP+LS         K  +  KGV+FASGG+G+ + T   +    +    QV
Sbjct  92   QFLGYKESPPPFLSLLNKKKQIPKRRIPTKGVNFASGGSGLLDDTGKLLWGDVVSFGKQV  151

Query  469  RLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + F TV+  +    GA      +SKS F+I +G+ND+   F
Sbjct  152  QQFRTVRNNISESWGAGGLA-NISKSIFIISVGSNDMFELF  191


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 93/162 (57%), Gaps = 11/162 (7%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            E     A+++FGDS VDVG N  +  S  RADF  NG+D+P    TGRFSNG NSAD + 
Sbjct  618  EVAPPAAIFIFGDSTVDVGTNTLLLQSKARADFSPNGLDFPYSVPTGRFSNGINSADQIV  677

Query  316  EKVGL-PTPPPYLSDKNNV------FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
               G   +PPP+L   N++       L+GV+FAS G+GIF+ T      + + L +Q++ 
Sbjct  678  RLFGYQKSPPPFLYTLNHMSTFKRDILQGVNFASAGSGIFSDTGIKKWIEVVSLGNQIQQ  737

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNND---LINYF  591
            F  V+  +   +G       LS+S F+I IG+ND   L++Y+
Sbjct  738  FEAVRGNISKIVGHNKTDTLLSQSLFIISIGSNDLFELVDYY  779



>ref|XP_006405842.1| hypothetical protein EUTSA_v10027814mg [Eutrema salsugineum]
 gb|ESQ47295.1| hypothetical protein EUTSA_v10027814mg [Eutrema salsugineum]
Length=357

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            YVFGDSL +VGNNN++  S+ R+DFP  G+D+ G KATGRF+NG    D ++ K+G+P+P
Sbjct  29   YVFGDSLTEVGNNNYLQYSLARSDFPWYGIDFTGGKATGRFTNGRTIGDIISTKLGIPSP  88

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++ FL G+++ASGGAGI N T    I + L   DQ+  F   ++ +  +IG
Sbjct  89   PPYLSLSQNDDAFLNGINYASGGAGILNETGLYFIQR-LTFDDQIICFKKTKEVIRAKIG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  148  DRAANKHVNNAMYFIGLGSNDYVNNF  173



>ref|XP_008798242.1| PREDICTED: GDSL esterase/lipase At4g16230-like [Phoenix dactylifera]
Length=357

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 101/153 (66%), Gaps = 9/153 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+++FGDS  DVGNNN +  S  +ADF  NG+D+   +ATGRFSNG NSADFLA+ +G
Sbjct  26   VPAVFIFGDSTADVGNNNFLPASQAKADFLPNGIDFVRSRATGRFSNGLNSADFLAKMLG  85

Query  328  LP-TPPPYLSDKNNVFLK----GVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
               +PPP+LS  +N  LK    G++FASGG+GI   T    +   + ++ QV+ F TV+ 
Sbjct  86   FKRSPPPFLSLTSNTLLKQAKRGINFASGGSGILEITGRRYV---ISMAKQVQYFETVRS  142

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             L+  +G +A ++ L  S F +  G+ND+++YF
Sbjct  143  NLIAHMGMSATEKLLENSVFFVSTGSNDILDYF  175



>ref|XP_004490816.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Cicer arietinum]
Length=367

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 96/146 (66%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL DVGNNN +  S+ ++++P  G+DY G +ATGRF+NG    D ++ K+G+P+P
Sbjct  27   YIFGDSLTDVGNNNFLQYSLAKSNYPWYGIDYSGGQATGRFTNGRTIGDIISSKLGIPSP  86

Query  340  PPYLSDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            P YLS   NV   LKGV++ASGGAGI N T    I + L   DQ+  F   ++ +  ++G
Sbjct  87   PAYLSVSQNVDALLKGVNYASGGAGILNDTGLYFIQR-LTFDDQINSFKKTKEAITTELG  145

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
             AAA +  +++ + I IG+ND +N F
Sbjct  146  EAAAYKHFNEAMYFIGIGSNDYVNNF  171



>ref|XP_004956485.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=383

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 100/151 (66%), Gaps = 13/151 (9%)
 Frame = +1

Query  160  MYVFGDSLVDVGNNNHIDS--IIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLP  333
            M+VFGDS +DVGNNN++    + RA+ P+ G+D+PG  +TGRFSNG N AD+LA+ +G P
Sbjct  43   MFVFGDSTLDVGNNNYLSGPDVPRANKPYYGIDFPGSVSTGRFSNGYNIADYLAKSLGFP  102

Query  334  -TPPPYLSDKNN-------VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
             +PPPYLS   +           GVS+ASGGAGI +STN G     + LS QV+ F T +
Sbjct  103  WSPPPYLSLAPSSGRLVQAAVAGGVSYASGGAGILDSTNAG---NNIPLSKQVQYFKTTK  159

Query  490  QKLVNQIGAAAAKQQLSKSPFLILIGNNDLI  582
             ++V ++G+ AA   L+KS FL  +G+NDL 
Sbjct  160  SQMVAKLGSRAANLLLTKSVFLFSVGSNDLF  190



>ref|XP_008645092.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X1 [Zea 
mays]
Length=382

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 113/190 (59%), Gaps = 15/190 (8%)
 Frame = +1

Query  55   MGFACSLRKMNVFIVflsfsfflsgsfsEAQKVPAMYVFGDSLVDVGNNNHIDS--IIRA  228
            MG+   L  M   +V       LS +  E ++VPAMYVFGDS +DVGNNNH+    + RA
Sbjct  1    MGWYDGLLLMKALVVLTGSMLVLSAAAVERRRVPAMYVFGDSTLDVGNNNHLQGKQVPRA  60

Query  229  DFPHNGVDYPGR-KATGRFSNGNNSADFLAEKVGLP-TPPPYLSDKNNVFL------KGV  384
            + P+ G+D PG  K TGRFSNG N ADF+A+ +G   +P  YL  K   +L      +GV
Sbjct  61   NKPYYGIDLPGSGKPTGRFSNGYNVADFVAKHLGFEKSPLAYLVLKARNYLIPSAITRGV  120

Query  385  SFASGGAGIFNST--NNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLI  558
            S+AS GAGI +ST  N G     L LS QVRLF+  +  +  ++GA A  + LS+S FL+
Sbjct  121  SYASAGAGILDSTVRNAG---GNLPLSQQVRLFAATRAAMEAKVGARAVAELLSRSFFLV  177

Query  559  LIGNNDLINY  588
             +G+ND   +
Sbjct  178  GVGSNDFFAF  187



>ref|XP_010271296.1| PREDICTED: GDSL esterase/lipase At5g37690 [Nelumbo nucifera]
Length=377

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 97/148 (66%), Gaps = 3/148 (2%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLP  333
            P  +VFGDSL +VGNNN++ S+ ++++P  GVDY G + TGRF+NG    D ++ K+G+P
Sbjct  25   PVTFVFGDSLTEVGNNNYLQSLAKSNYPWYGVDYIGGQPTGRFTNGRTIGDIISAKLGIP  84

Query  334  TPPPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQ  507
            +PPPY  LS  ++  LKGV++ASGGAGI N T    I + L   DQ+  F   ++ +  +
Sbjct  85   SPPPYLSLSPNDDKILKGVNYASGGAGILNDTGLYFIQR-LSFDDQISYFEKTKEAIKAK  143

Query  508  IGAAAAKQQLSKSPFLILIGNNDLINYF  591
            IG  AA +  +++ + I IG+ND +N F
Sbjct  144  IGEEAANKLCNEAIYFIGIGSNDYVNNF  171



>ref|XP_002455881.1| hypothetical protein SORBIDRAFT_03g026750 [Sorghum bicolor]
 gb|EES01001.1| hypothetical protein SORBIDRAFT_03g026750 [Sorghum bicolor]
Length=381

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 100/155 (65%), Gaps = 14/155 (9%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHID--SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            + PAM+VFG S++DVGNNN++   ++ RA+ P+NGVD+PG   TGRFSNG N AD++A+ 
Sbjct  33   RAPAMFVFGSSILDVGNNNYLQGATVGRANSPYNGVDFPGSVPTGRFSNGYNIADYVAKN  92

Query  322  VGLP-TPPPYLSDKNN--------VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            +G   +PPPYLS   +            G+++ASGGAGI +STN G     + LS +V+ 
Sbjct  93   MGFACSPPPYLSMVQSSSGPLVQTALTSGINYASGGAGILDSTNAG---STIPLSKEVKY  149

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDL  579
            F   + K+V  +G   A   +S+S FLI +GNNDL
Sbjct  150  FGATKAKMVAAVGPNTANPAISQSIFLIGMGNNDL  184



>ref|XP_010108989.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXC20629.1| GDSL esterase/lipase [Morus notabilis]
Length=361

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 99/144 (69%), Gaps = 4/144 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +VFGDSL +VGNNN++  S+ +++FP  GVDYPG +ATGRF+NG    D ++EK+G+ +P
Sbjct  35   FVFGDSLTEVGNNNYLQYSLAKSNFPWYGVDYPGSQATGRFTNGRTIGDIISEKLGVSSP  94

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            P Y  LS  N+  LKGV++ASGGAGI N T    I + +   DQ++ F+  ++ + ++IG
Sbjct  95   PAYLSLSPNNDAILKGVNYASGGAGILNDTGLYFIQR-MTFDDQIQNFNKTREAIKSKIG  153

Query  514  AAAAKQQLSKSPFLILIGNNDLIN  585
             AAA +   ++ + I IG+ND +N
Sbjct  154  VAAASKLCKEAMYFIGIGSNDYVN  177



>gb|AAM61634.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
Length=355

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN +  S+ RADFP+ GVD+ G KATGRF+NG    D ++ K+G+ +P
Sbjct  29   YIFGDSLTEVGNNNFLQYSLARADFPYYGVDFSGGKATGRFTNGRTIGDIISTKLGILSP  88

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++ FL G+++ASGGAGI N T    I + L  +DQ+  F   ++ +  +IG
Sbjct  89   PPYLSLSQNDDAFLSGINYASGGAGILNETGIYFIQR-LTFNDQINCFKKTKEVIRAKIG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  148  DGAANKHINDAMYFIGLGSNDYVNNF  173



>ref|XP_008778519.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Phoenix dactylifera]
Length=368

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 102/160 (64%), Gaps = 12/160 (8%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLA  315
            EA KVPA+YVFGDS  DVGNNN++ ++  +A+FPHNG+D+P  + TGRFSNG N+ DF A
Sbjct  29   EAAKVPAIYVFGDSTADVGNNNYLPENSPKANFPHNGIDFPFSRPTGRFSNGYNAIDFFA  88

Query  316  EKVGL-PTPPPYLSDKNNV------FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
              +G   +PPP LS  N         LKGV+FASGG+GI   +    I+    ++ Q++ 
Sbjct  89   IHMGFRRSPPPSLSLSNKTNHQIMRGLKGVNFASGGSGIALDSMGSTIT----MTKQIQN  144

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            F+ ++  +  +IG+  A   LSKS FLI  G ND+  Y++
Sbjct  145  FAMIKSNITARIGSKTADHLLSKSIFLISTGGNDIFAYYS  184



>dbj|BAJ87244.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96797.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 110/190 (58%), Gaps = 14/190 (7%)
 Frame = +1

Query  43   SSRMMGFACSLRKMNVFIVflsfsfflsgsfsEAQKVPAMYVFGDSLVDVGNNNHIDS--  216
            S  M G   SL   ++  V L  S    G     + VPAMYVFGDS +DVGNNN++    
Sbjct  7    SPSMKGLVASLTTFSILRVCLIISAAAGGPGKMVRLVPAMYVFGDSTLDVGNNNYLPGPN  66

Query  217  IIRADFPHNGVDYPG-RKATGRFSNGNNSADFLAEKVGL-PTPPPYLSDKN-------NV  369
            + RA+ P NGVD+PG  +ATGRFSNG + ADF+A K+GL  +PP YLS          + 
Sbjct  67   VPRANMPFNGVDFPGGARATGRFSNGYHVADFIAIKLGLKESPPAYLSLAPRPTALLLSA  126

Query  370  FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSP  549
               GV++AS GAGI +STN G     + LS QVR   + +  +   +G AA +  LS+S 
Sbjct  127  LATGVNYASAGAGILDSTNAG---NNIPLSRQVRYMESTKAAMEASVGKAATRLLLSRSF  183

Query  550  FLILIGNNDL  579
            FL  IGNNDL
Sbjct  184  FLFNIGNNDL  193



>ref|XP_006646796.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Oryza brachyantha]
Length=386

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 103/177 (58%), Gaps = 33/177 (19%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            KVPA++VFGDS VDVGNNN++  S  RADFPHNGVD+PG K TGRFSNG    DF+A  +
Sbjct  32   KVPAIFVFGDSTVDVGNNNYLPWSSARADFPHNGVDFPGGKPTGRFSNGLIGVDFIAAAM  91

Query  325  GLP-TPPPYLS------------------DKNNVF--------LKGVSFASGGAGIFNST  423
            G   +PPPYLS                  +KNN          +KG +FASGG+G+ +ST
Sbjct  92   GFGRSPPPYLSLVAMAANSSSSNSSVEVMNKNNRTMMAAASSGMKGANFASGGSGLLDST  151

Query  424  NNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
               I     +++ Q+  FS ++ ++   + A  A   LSKS FLI  G ND  ++F+
Sbjct  152  GTTI-----NMTKQIEYFSDLRDQISTMLSADKASTLLSKSIFLISAGGNDAFDFFS  203



>ref|NP_198585.2| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FHQ1.1|GDL80_ARATH RecName: Full=GDSL esterase/lipase At5g37690; AltName: Full=Extracellular 
lipase At5g37690; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08315.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
 gb|AED94220.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=356

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN +  S+ RADFP+ GVD+ G KATGRF+NG    D ++ K+G+ +P
Sbjct  29   YIFGDSLTEVGNNNFLQYSLARADFPYYGVDFSGGKATGRFTNGRTIGDIISTKLGILSP  88

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++ FL G+++ASGGAGI N T    I + L  +DQ+  F   ++ +  +IG
Sbjct  89   PPYLSLSQNDDAFLSGINYASGGAGILNETGIYFIQR-LTFNDQINCFKKTKEVIRAKIG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  148  DGAANKHVNDAMYFIGLGSNDYVNNF  173



>gb|KFK33277.1| hypothetical protein AALP_AA6G354100 [Arabis alpina]
Length=380

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 96/146 (66%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN++  S+ R+DFP  G+D+ G KATGRF+NG    D ++ K+G+ +P
Sbjct  30   YIFGDSLTEVGNNNYLQYSLARSDFPWYGIDFSGGKATGRFTNGRTIGDIISTKLGIASP  89

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++ +L G+++ASGGAGI N T    I + L   DQ+  F   +Q +  +IG
Sbjct  90   PPYLSLSQNDDAYLSGINYASGGAGILNETGLYFIQR-LTFDDQINCFKKTKQVIRAKIG  148

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  149  DGAANKHVNDAMYFIGLGSNDYVNNF  174



>ref|XP_002963578.1| hypothetical protein SELMODRAFT_80680 [Selaginella moellendorffii]
 gb|EFJ35449.1| hypothetical protein SELMODRAFT_80680 [Selaginella moellendorffii]
Length=367

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +VPA++ FGDSL DVGNNN++ ++ +A+FP  G ++   K TGRF+NG N  DFLA ++G
Sbjct  24   EVPALFAFGDSLADVGNNNYLVTLAKANFPPYGREFDTGKPTGRFTNGRNQIDFLAARLG  83

Query  328  LPTPPPYL--SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLV  501
            LP  P ++  S K    L GV+FAS G+GI + TN   + + + +++QV+ F+ V+++LV
Sbjct  84   LPLLPAFMDPSTKGLAMLSGVNFASAGSGILDITNIN-VGQLIQITEQVQNFAKVKEELV  142

Query  502  NQIGAAAAKQQLSKSPFLILIGNND  576
            + +G+A A   LS+S F I  GNND
Sbjct  143  SMVGSANATDMLSRSLFSIFTGNND  167



>ref|XP_010448960.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Camelina sativa]
Length=378

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 106/156 (68%), Gaps = 10/156 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            +P +YVFGDSLVD GNNN++  SI ++++PHNGVD+P +K TGRF NG N+AD +AEK G
Sbjct  37   IPGLYVFGDSLVDAGNNNYLPISISKSNYPHNGVDFPNKKPTGRFCNGKNAADAIAEKFG  96

Query  328  LPTPPPYL--------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            LP PPPYL          + +  + GV+FASGGAGIFN ++   + +A+ LS QV  + +
Sbjct  97   LPLPPPYLSLRGLLERETRKSAAVTGVNFASGGAGIFNGSDQK-LGQAIPLSKQVNNWLS  155

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +   L  Q+  + A+  L KS F I+IG+NDL +YF
Sbjct  156  IHNDLTTQLEPSEAQAHLLKSLFTIVIGSNDLFDYF  191



>gb|KFK33276.1| hypothetical protein AALP_AA6G354100 [Arabis alpina]
Length=357

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 96/146 (66%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN++  S+ R+DFP  G+D+ G KATGRF+NG    D ++ K+G+ +P
Sbjct  30   YIFGDSLTEVGNNNYLQYSLARSDFPWYGIDFSGGKATGRFTNGRTIGDIISTKLGIASP  89

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++ +L G+++ASGGAGI N T    I + L   DQ+  F   +Q +  +IG
Sbjct  90   PPYLSLSQNDDAYLSGINYASGGAGILNETGLYFIQR-LTFDDQINCFKKTKQVIRAKIG  148

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  149  DGAANKHVNDAMYFIGLGSNDYVNNF  174



>ref|XP_010062263.1| PREDICTED: GDSL esterase/lipase At5g37690 [Eucalyptus grandis]
 gb|KCW69375.1| hypothetical protein EUGRSUZ_F02859 [Eucalyptus grandis]
Length=356

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            ++FGDSL +VGNNNH   S+ R+D+P  G+DY G +ATGRF+NG    D L+ K+G+ +P
Sbjct  29   FIFGDSLTEVGNNNHFQYSLARSDYPFYGIDYEGGQATGRFTNGRTIGDILSAKLGISSP  88

Query  340  PPY--LSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPY  LS  ++  L+GVS+ASGGAGI N T    I + L   DQ+  F+  ++ ++ ++G
Sbjct  89   PPYLSLSPNDDAILQGVSYASGGAGILNETGLYFIQR-LSFDDQINYFNKTREVIIAKLG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA +  +K+ + I +G+ND +N F
Sbjct  148  EEAANKFCNKALYFIGLGSNDYVNNF  173



>gb|KJB43244.1| hypothetical protein B456_007G190000 [Gossypium raimondii]
Length=362

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 100/155 (65%), Gaps = 9/155 (6%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            PA+Y+FGDS++DVG NN+I + + +ADF  NG+D+P  + TGRFSNG N+AD +   +GL
Sbjct  29   PAVYIFGDSILDVGTNNYIPECLAKADFYFNGIDFPYSEPTGRFSNGLNTADEIVRLLGL  88

Query  331  P-TPPPYLSDKNNVF------LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQ  489
              +PPP+L   N+        LKG +FASGG+GI NST      + + + DQV+ FSTV+
Sbjct  89   RRSPPPFLQLVNDPLTFRKNILKGANFASGGSGILNSTGQYQYIRVISMGDQVQQFSTVR  148

Query  490  QKLVNQIGAAAAKQQ-LSKSPFLILIGNNDLINYF  591
              + N   + AA    LSK+ FLI +G+ND+  Y 
Sbjct  149  SNITNMTASDAATDAILSKAFFLISVGSNDIFEYL  183



>ref|XP_008679095.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Zea mays]
 gb|AFW63823.1| hypothetical protein ZEAMMB73_185154 [Zea mays]
Length=394

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            P  YVFGDS+ DVGNNN+   S+ ++++P  G+DYPGR+ATGRF+NG    D++AEK G+
Sbjct  47   PVTYVFGDSMSDVGNNNYFPTSLAKSNYPWYGIDYPGREATGRFTNGKTIGDYMAEKFGV  106

Query  331  PTPPPYLSDK--NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVN  504
            P PPP+LS +      L GV+FASGGAGI N T    + + L   +Q+  F  V++ ++ 
Sbjct  107  PPPPPFLSLRMTGKDVLGGVNFASGGAGILNETGVYFV-QYLSFDEQISCFEIVKRAMIA  165

Query  505  QIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +IG  AA+   + + F I +G+ND IN F
Sbjct  166  KIGKDAAEAAANAALFQIGLGSNDYINNF  194



>ref|XP_010030697.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Eucalyptus grandis]
Length=361

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 7/156 (4%)
 Frame = +1

Query  142  AQKVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            +++ PA++V GDS  DVG NN +  S  RADFPHNG+D+P  +ATGRFSNG NSA+FLA+
Sbjct  25   SEEKPAVFVLGDSTADVGTNNFLPGSNARADFPHNGIDFPHSRATGRFSNGLNSANFLAK  84

Query  319  KVGLP-TPPPYLSDKNNVFLK-----GVSFASGGAGIFNSTNNGIISKALHLSDQVRLFS  480
             +G   +PPP+LS  +   LK     G++FASGG+ I + T      K + LS+Q+  FS
Sbjct  85   LLGHKRSPPPFLSLNSTKALKRHSLNGINFASGGSRILDMTGVRPTRKVITLSEQIMQFS  144

Query  481  TVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            TV+  L   +GA   ++ L KS   I IG+ND++ Y
Sbjct  145  TVRDTLTAVMGATETEKFLVKSLLFISIGSNDILLY  180



>ref|XP_011092996.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Sesamum indicum]
Length=396

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 100/156 (64%), Gaps = 12/156 (8%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
             P ++V GDS  DVG NN +  S  RA+FPHNGVD+P  +ATGRFSNG N+AD LA++ G
Sbjct  43   TPVIFVLGDSTADVGTNNFLHHSKARANFPHNGVDFPNSRATGRFSNGFNTADLLAKRFG  102

Query  328  LP-TPPPYL-------SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            L  +PPP+L         K + F KGV+FASGG+G+ + T  G     + LS+Q+  F++
Sbjct  103  LKRSPPPFLFLRKLKCHCKKHPF-KGVNFASGGSGLLDIT--GSKPTVVPLSEQIAQFAS  159

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            V+   V  +G AA +  LSKS F I IG+ND+  YF
Sbjct  160  VRDDFVATMGPAATEAILSKSLFFISIGSNDIFGYF  195



>ref|XP_004955199.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Setaria italica]
Length=401

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            K P  YVFGDS+ DVGNNN+   S+ ++++P  G+DYPGR+ATGRF+NG    D++A+K 
Sbjct  50   KGPVTYVFGDSMSDVGNNNYFPMSLAKSNYPWYGIDYPGREATGRFTNGKTIGDYMADKF  109

Query  325  GLPTPPPYLSDK--NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKL  498
            G+P+PPP+LS        L GV+FASGGAGI N T    + +     +Q+  F TV++ +
Sbjct  110  GVPSPPPFLSLSLAGKDVLGGVNFASGGAGILNETGVYFV-QYFSFDEQITCFETVKKAM  168

Query  499  VNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            + +IG  AA+  ++ + F I +G+ND IN F
Sbjct  169  IAKIGKEAAEAAVNAALFQIGLGSNDYINNF  199



>gb|AFW87567.1| hypothetical protein ZEAMMB73_404117 [Zea mays]
Length=297

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 94/157 (60%), Gaps = 16/157 (10%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHI--DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            + PAMYVFG S++DVGNNN++   ++ RA+ PHNG+D+P    TGRFSNG N AD++A+ 
Sbjct  28   RPPAMYVFGSSILDVGNNNYLLGPAVDRANHPHNGIDFPASIPTGRFSNGYNIADYVAKS  87

Query  322  VGLP-TPPPYLSDKNNV----------FLKGVSFASGGAGIFNSTNNGIISKALHLSDQV  468
            +G   +PP YLS                  GV++ASGGAGI  STN G     + LS QV
Sbjct  88   MGFACSPPAYLSLAPTTTSSGTLVQAGLSHGVNYASGGAGILESTNAG---NTVPLSKQV  144

Query  469  RLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDL  579
            R F   + K+V   G  A    LS S FL+ IGNND+
Sbjct  145  RYFGATKAKMVAAAGTRAVDALLSSSVFLLGIGNNDM  181



>gb|EAY85532.1| hypothetical protein OsI_06905 [Oryza sativa Indica Group]
Length=516

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 13/158 (8%)
 Frame = +1

Query  145  QKVPAMYVFGDSLVDVGNNNHIDSII--RADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            Q+VPA++VFGDS +DVGNNN++   I  RAD P+ GVDYP  + TGRFSNG N ADF+A+
Sbjct  44   QQVPAVFVFGDSTMDVGNNNYLSGEIVPRADKPYYGVDYPTSRPTGRFSNGYNVADFIAK  103

Query  319  KVGL-PTPPPYLS--DKNNVFL-----KGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
             +G   +PP YLS   ++N  +     +GVS+AS GAGI +ST  G   + + LS QVR 
Sbjct  104  ALGFNESPPAYLSLAPRSNSLVVAAVSRGVSYASAGAGILDSTYAG---ENITLSKQVRY  160

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            F +    +  + G+ A  + LS+S FL  IG+NDL  Y
Sbjct  161  FESTMAHVEARHGSRATSKFLSRSLFLFGIGSNDLFTY  198



>ref|XP_009418684.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Musa acuminata 
subsp. malaccensis]
Length=360

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 101/156 (65%), Gaps = 13/156 (8%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSI-IRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            KVPA+YVFGDS  DVGNNN++     +ADFPH GVD+P +  TGRFSNG N+ DFLA  +
Sbjct  26   KVPAVYVFGDSTADVGNNNYLPGKDAKADFPHYGVDFPHQTPTGRFSNGYNTIDFLAIHM  85

Query  325  GLP-TPPPYLSDKNN---VFL---KGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            G   +PPPY++  N    + L   +GVSFASGG+GI +ST   I      ++ Q++ F+ 
Sbjct  86   GFKRSPPPYVAVVNKPHPLILRGRRGVSFASGGSGILDSTGTTIT-----MTKQIQDFAA  140

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
             +  + +++ +A AK  LSKS FLI  G ND+  +F
Sbjct  141  HESNIASRVTSAVAKGLLSKSVFLISSGGNDVFAFF  176



>ref|XP_009395376.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 100/156 (64%), Gaps = 13/156 (8%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSI-IRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            KVPA+YVFGDS  DVGNNN++     +A+FPH G+D+P ++ TGRFSNG N  DF+A  +
Sbjct  22   KVPAVYVFGDSTADVGNNNYLPGDDAKANFPHYGIDFPHQRPTGRFSNGYNGVDFMAIHM  81

Query  325  GL-PTPPPYLSDKNNVF------LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            G   +PPPYLS  N         L+GV+FASGG+GI ++T + I      ++ QV+ F+ 
Sbjct  82   GFRRSPPPYLSIVNETHTPILRGLRGVNFASGGSGILDTTGSTIT-----MTKQVQDFAA  136

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            +   +V+   A+ AK  LS+S FLI  G ND+  +F
Sbjct  137  LASNIVSHTNASRAKYLLSRSVFLISSGGNDVFAFF  172



>gb|KEH28240.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=326

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 95/146 (65%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL DVGNNN +  S+ +++FP  G+DY G +ATGRF+NG    D ++ K+G+P+P
Sbjct  27   YIFGDSLTDVGNNNFLQYSLAKSNFPWYGIDYSGGQATGRFTNGRTIGDIISSKLGIPSP  86

Query  340  PPYLSDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            P YLS   NV   LKGV++ASGGAGI N T    + + L   DQ++ F   +  +  ++G
Sbjct  87   PAYLSVPQNVDALLKGVNYASGGAGILNDTGLYFLQR-LTFDDQIKSFKKTKVAITAKLG  145

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA +  +++ + I IG+ND +N F
Sbjct  146  EDAANKHFNEATYFIGIGSNDYVNNF  171



>ref|XP_004233932.2| PREDICTED: GDSL esterase/lipase 7-like [Solanum lycopersicum]
Length=359

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 96/151 (64%), Gaps = 3/151 (2%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            E    PA+YVFGDS+ D GNNN + ++ +ADF   G ++ G +ATGRF+NG   ADF+AE
Sbjct  23   EIPLAPALYVFGDSIFDSGNNNVLPTLAKADFKPYGSNFDGGRATGRFTNGKTVADFIAE  82

Query  319  KVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFS-TVQQK  495
             +GLP  PPYLS + ++ L G+++ASG  GI   T N  I K LH S+QV LF  TV+++
Sbjct  83   FLGLPFSPPYLSLRGSLKLTGLNYASGSCGILPYTGN-FIGKCLHFSEQVDLFQRTVERE  141

Query  496  LVNQIGAAAA-KQQLSKSPFLILIGNNDLIN  585
            L  +          LS+S F++  GNND +N
Sbjct  142  LPRKFDDPEEFSSYLSRSIFVVSTGNNDYVN  172



>ref|XP_009389191.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 98/150 (65%), Gaps = 7/150 (5%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHIDS-IIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            PA++VFGDSLVDVGNNN + S   + +FP  G+DYPGR  TGRF+NG N AD++A+ VGL
Sbjct  28   PAVFVFGDSLVDVGNNNFLPSDAPKVNFPPWGIDYPGRTPTGRFTNGFNYADYVAKAVGL  87

Query  331  P-TPPPYLSDKN-NVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVN  504
              +PPP+LS  N N  L+GV+FASGG GI ++T   +I+ A  + D    F  V   L  
Sbjct  88   AMSPPPFLSLSNGNQMLRGVNFASGGTGILDTTGGDVIAMATQIED----FEQVAANLTE  143

Query  505  QIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            ++G  +A   L KS   +++G+ND+   ++
Sbjct  144  RLGKKSAAVFLEKSLVHLIVGSNDIYALYS  173



>ref|XP_010935212.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Elaeis guineensis]
Length=359

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 99/156 (63%), Gaps = 13/156 (8%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            KVPA+YVFGDS  DVGNNN++  +  +A+FPH G+D+P  + TGRFSNG N  DFLA  +
Sbjct  24   KVPAIYVFGDSTADVGNNNYLPGNNAKANFPHYGIDFPHSRPTGRFSNGYNGIDFLAGHM  83

Query  325  GL-PTPPPYLSDKNNVF------LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            G   +PPPYLS  N         L+GV+FASGG+GI +ST   I      ++ Q++ F+T
Sbjct  84   GFRRSPPPYLSLTNKTSRGILKGLRGVNFASGGSGILDSTGTTIT-----MTQQIKYFAT  138

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
            ++ ++  ++    +   LSKS FLI  G ND+  +F
Sbjct  139  LKSRIAERLNLERSNDVLSKSIFLISDGGNDVFAFF  174



>gb|AES99241.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=353

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 95/146 (65%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL DVGNNN +  S+ +++FP  G+DY G +ATGRF+NG    D ++ K+G+P+P
Sbjct  27   YIFGDSLTDVGNNNFLQYSLAKSNFPWYGIDYSGGQATGRFTNGRTIGDIISSKLGIPSP  86

Query  340  PPYLSDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            P YLS   NV   LKGV++ASGGAGI N T    + + L   DQ++ F   +  +  ++G
Sbjct  87   PAYLSVPQNVDALLKGVNYASGGAGILNDTGLYFLQR-LTFDDQIKSFKKTKVAITAKLG  145

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA +  +++ + I IG+ND +N F
Sbjct  146  EDAANKHFNEATYFIGIGSNDYVNNF  171



>ref|XP_004292275.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Fragaria vesca 
subsp. vesca]
Length=363

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 103/157 (66%), Gaps = 9/157 (6%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGR-KATGRFSNGNNSADFLAEKV  324
            +P +++ GDS  D+G NN++  S  RADFPHNG+D+P   +ATGRFSNG NSADFLA   
Sbjct  28   LPPVFILGDSTADIGTNNYLPGSTARADFPHNGIDFPNSPRATGRFSNGLNSADFLARHF  87

Query  325  GLP-TPPPYLSDKNNVF----LKGVSFASGGAGIFNSTNNGIISK--ALHLSDQVRLFST  483
            G   +P P+LS           +G++FASGG+G+F+ T   + ++   + L++Q++ FS+
Sbjct  88   GYKRSPRPFLSLSATSLQKKKFRGINFASGGSGLFDLTGQSLNNQKNVVPLTEQIQQFSS  147

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            V+  L   +GAAA K+ LSKS   I IG+NDL  Y++
Sbjct  148  VKNSLTALMGAAATKKFLSKSLIFISIGSNDLFRYYH  184



>ref|XP_003616283.1| GDSL esterase/lipase [Medicago truncatula]
Length=363

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 95/146 (65%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL DVGNNN +  S+ +++FP  G+DY G +ATGRF+NG    D ++ K+G+P+P
Sbjct  27   YIFGDSLTDVGNNNFLQYSLAKSNFPWYGIDYSGGQATGRFTNGRTIGDIISSKLGIPSP  86

Query  340  PPYLSDKNNV--FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            P YLS   NV   LKGV++ASGGAGI N T    + + L   DQ++ F   +  +  ++G
Sbjct  87   PAYLSVPQNVDALLKGVNYASGGAGILNDTGLYFLQR-LTFDDQIKSFKKTKVAITAKLG  145

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA +  +++ + I IG+ND +N F
Sbjct  146  EDAANKHFNEATYFIGIGSNDYVNNF  171



>ref|XP_008365776.1| PREDICTED: GDSL esterase/lipase At5g37690-like [Malus domestica]
Length=174

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            +VFGDSL +VGNNN++  S+ ++++P  GVDY G +ATGRF+NG    D +++K+G+P+P
Sbjct  26   FVFGDSLTEVGNNNYLSYSLAKSNYPWYGVDYAGGRATGRFTNGRTIGDIISKKLGIPSP  85

Query  340  PPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPYLS   N    LKGV++ASGGAGI N T    I + +   DQ++ F+  ++ +  +IG
Sbjct  86   PPYLSLAQNDDALLKGVNYASGGAGILNDTGLYFIQR-MSFDDQIQKFNKTKEAIKAKIG  144

Query  514  AAAAKQQLSKSPFLILI  564
            A AA +  S++ + I I
Sbjct  145  AEAAAKLCSEAIYFIGI  161



>ref|XP_004965496.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=414

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 96/151 (64%), Gaps = 13/151 (9%)
 Frame = +1

Query  157  AMYVFGDSLVDVGNNNHID--SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            AMYVFG S++DVGNNN++   S+ RA+  +NG+D+P    TGRFSNG N AD++A+ +G 
Sbjct  62   AMYVFGSSILDVGNNNYLPGASVARANRRYNGIDFPSSIPTGRFSNGYNIADYVAKSMGF  121

Query  331  P-TPPPYLSDK-------NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
              +PP YLS          N    G+S+ASGGAGI +STN G     + LS QV+ F T 
Sbjct  122  ASSPPAYLSLAPSSGPLVQNAVANGISYASGGAGILDSTNAG---NTIRLSKQVQYFGTT  178

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDL  579
            + K+V  +G   A   LS+S FLI IGNND+
Sbjct  179  KAKMVAALGPNVANALLSRSIFLIGIGNNDM  209



>ref|XP_002439050.1| hypothetical protein SORBIDRAFT_10g030550 [Sorghum bicolor]
 gb|EER90417.1| hypothetical protein SORBIDRAFT_10g030550 [Sorghum bicolor]
Length=374

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 13/158 (8%)
 Frame = +1

Query  145  QKVPAMYVFGDSLVDVGNNNHIDS--IIRADFPHNGVDYPGR-KATGRFSNGNNSADFLA  315
            ++VPAMYVFGDS +DVGNNN+++   + RA+ P+ G+D PG  K TGRFSNG N ADF+A
Sbjct  32   RRVPAMYVFGDSTLDVGNNNYLEGEQVPRANKPYYGIDLPGSGKPTGRFSNGYNVADFVA  91

Query  316  EKVGLP-TPPPYLSDKNNVFL------KGVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            + +G   +P  YL  K   +L       GVS+AS GAGI +STN G     + LS QVRL
Sbjct  92   KNLGFEKSPLAYLVLKARNYLIPSAISTGVSYASAGAGILDSTNAG---GNIPLSQQVRL  148

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            F + +  + +++G  A  Q LSKS FLI +G+ND   +
Sbjct  149  FESTKAAMESKVGPRAVSQLLSKSFFLIGVGSNDFFAF  186



>ref|XP_009139742.1| PREDICTED: GDSL esterase/lipase At5g37690 [Brassica rapa]
Length=360

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 95/146 (65%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNNN++  S+ R+DFP  G+D+ G +ATGRF+NG    D ++  +G+P+P
Sbjct  29   YIFGDSLTEVGNNNYLQYSLARSDFPWYGIDFSGGQATGRFTNGRTIGDIISTNLGIPSP  88

Query  340  PPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPYLS   N   FL G+++ASGGAGI N T    I + L   DQ+  F   ++ +  +IG
Sbjct  89   PPYLSLSRNDDAFLNGINYASGGAGILNETGLYFIQR-LTFDDQINCFKKTKEVIRAKIG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLINYF  591
              AA + ++ + + I +G+ND +N F
Sbjct  148  DRAANKHVNDAMYFIGLGSNDYVNNF  173



>ref|XP_004966494.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=363

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 100/156 (64%), Gaps = 15/156 (10%)
 Frame = +1

Query  145  QKVPAMYVFGDSLVDVGNNNHID--SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            Q  P MYVFGDS +DVGNNN++   ++ RA+ P+ G+D+PG   TGRFSNG N+AD++A+
Sbjct  24   QPPPPMYVFGDSYLDVGNNNYLSGPNVPRANRPYYGIDFPGFP-TGRFSNGYNTADYIAK  82

Query  319  KVGLP--TPPPYLSDK-------NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVR  471
            K+GL   +PPPYLS         +     G+S+ASGGAGI +STN G     + LS QV+
Sbjct  83   KIGLAAGSPPPYLSVAWSSSLVVSTALTIGMSYASGGAGILDSTNAG---DNIPLSKQVQ  139

Query  472  LFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDL  579
             F+  + K+V  +G+ A    LS+S  LI  G NDL
Sbjct  140  YFNATRSKMVAAVGSGAVDTLLSRSVVLIGAGGNDL  175



>ref|XP_009589693.1| PREDICTED: GDSL esterase/lipase At5g37690 [Nicotiana tomentosiformis]
Length=361

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 98/145 (68%), Gaps = 3/145 (2%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPP  342
            YVFGDSL +VGNNN++ S+ ++++P  G+D+ G +ATGRF+NG    D ++ K+G+ +PP
Sbjct  30   YVFGDSLTEVGNNNYLQSLAKSNYPFYGIDFEGGRATGRFTNGRTIGDIISAKLGVQSPP  89

Query  343  PYLS--DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGA  516
            PYLS    ++  L+GV++ASGGAGI N T    I + +   DQ+  F   ++ +  +IG 
Sbjct  90   PYLSLAPNDDAILQGVNYASGGAGILNDTGLYFIQR-MTFDDQIMSFDKTKEAIKAKIGE  148

Query  517  AAAKQQLSKSPFLILIGNNDLINYF  591
             AA++ ++K+ + I +G+ND +N F
Sbjct  149  VAAEKHVNKAVYFIGMGSNDYVNNF  173



>ref|XP_008236136.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Prunus mume]
Length=358

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 6/154 (4%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            VPA+++ GDS  DVG NN +  S+ RADFPHNGVD+P  +ATGRFSNG NSADFL+++ G
Sbjct  26   VPAIFILGDSTADVGTNNFLPGSMARADFPHNGVDFPFSRATGRFSNGLNSADFLSKQFG  85

Query  328  LP-TPPPYLSDKNNVF----LKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
            L  +P P+LS           +GV+FASGG+G+ + T        + LS+Q++  S V+ 
Sbjct  86   LKRSPRPFLSLNTTSLHKKSFRGVNFASGGSGLLDITGRTNRKNVISLSEQIQQLSLVKS  145

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             L    G    ++ +SKS F I  G+NDL  Y++
Sbjct  146  NLAAIKGQRLTEKLISKSLFFISTGSNDLFGYYH  179



>ref|XP_006365666.1| PREDICTED: GDSL esterase/lipase 7-like [Solanum tuberosum]
Length=359

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 104/173 (60%), Gaps = 3/173 (2%)
 Frame = +1

Query  73   LRKMNVFIVflsfsfflsgsfsEAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVD  252
            + K N   V +    ++    SE    PA+YVFGDS+ D GNNN + ++ +ADF   G +
Sbjct  1    MEKFNFVAVIIVLLMYIESVKSEIPLAPALYVFGDSIFDSGNNNVLPTLAKADFKPYGSN  60

Query  253  YPGRKATGRFSNGNNSADFLAEKVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNG  432
            + G +ATGRF+NG   ADF+AE +GLP  PPYLS + ++ L G+++ASG  GI   T N 
Sbjct  61   FDGGRATGRFTNGKTVADFIAEFLGLPFSPPYLSLRGSLKLTGLNYASGSCGILPYTGN-  119

Query  433  IISKALHLSDQVRLFS-TVQQKLVNQIGAAAA-KQQLSKSPFLILIGNNDLIN  585
             I K LH S+QV LF  TV+++L  +          LS+S F++  G+ND +N
Sbjct  120  FIGKCLHFSEQVDLFERTVERELPRKFNDPEEFSSYLSRSIFVVSTGSNDYVN  172



>gb|KCW55612.1| hypothetical protein EUGRSUZ_I01477, partial [Eucalyptus grandis]
Length=333

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 100/155 (65%), Gaps = 10/155 (6%)
 Frame = +1

Query  145  QKVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            ++ PA++V GDS  DVG NN +  S  RADFPHNG+D+P  +ATGRFSNG NSA+FLA+ 
Sbjct  1    EEKPAVFVLGDSTADVGTNNFLPGSNARADFPHNGIDFPHSRATGRFSNGLNSANFLAKL  60

Query  322  VGLP-TPPPYLSDKNNVFLK-----GVSFASGGAGIFNSTNNGIISKALHLSDQVRLFST  483
            +G   +PPP+LS  +   LK     G++FASGG+ I + T      K + LS+Q+  FST
Sbjct  61   LGHKRSPPPFLSLNSTKALKRHSLNGINFASGGSRILDMTGT---RKVITLSEQIMQFST  117

Query  484  VQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            V+  L   +GA   ++ L KS   I IG+ND++ Y
Sbjct  118  VRDTLTAVMGATETEKFLVKSLLFISIGSNDILLY  152



>ref|XP_011001569.1| PREDICTED: GDSL esterase/lipase At5g37690 [Populus euphratica]
Length=355

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 93/144 (65%), Gaps = 4/144 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            Y+FGDSL +VGNN ++  S+ R+D+P  G+D+ G +ATGRF+NG    D ++ K+G+P+P
Sbjct  29   YIFGDSLTEVGNNKYLQYSLARSDYPWYGIDFSGGQATGRFTNGRTIGDIISAKLGIPSP  88

Query  340  PPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PPYLS   N    L GV++ASGGAGI N T    I + L   DQ+  F   ++ +  +IG
Sbjct  89   PPYLSLSKNDDALLTGVNYASGGAGILNETGLYFIQR-LSFDDQIECFKKTKESIKAKIG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLIN  585
              AA +  +K+ + I +G+ND +N
Sbjct  148  EDAANRLCNKAMYFIGLGSNDYVN  171



>ref|XP_007041706.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOX97537.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=358

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 100/155 (65%), Gaps = 8/155 (5%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            +VPA+++ GDS  DVG NN++ +S IRADFPHNGVD+P  +ATGRFSNG N+ADFLA++ 
Sbjct  24   EVPAIFILGDSTADVGTNNYLPESGIRADFPHNGVDFPFARATGRFSNGLNTADFLAKQF  83

Query  325  GLP-TPPPYLSDKNNVFLK-----GVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTV  486
                +PP YLS      +K     G++F+S G+G+ ++T        + + +QV  FSTV
Sbjct  84   NFKRSPPSYLSLNATSAIKRRRFRGINFSSAGSGLLDTTGQTPQKNVVPMGEQVYQFSTV  143

Query  487  QQKLVNQIGAAAAKQQLSKSPFLILIGNNDLI-NY  588
               L+   G +  K  LSKS F I IG+ND++ NY
Sbjct  144  YNDLLAIKGPSETKNLLSKSLFFISIGSNDILGNY  178



>ref|NP_001132708.1| hypothetical protein precursor [Zea mays]
 gb|ACF81666.1| unknown [Zea mays]
 tpg|DAA60903.1| TPA: hypothetical protein ZEAMMB73_211014 [Zea mays]
Length=378

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 101/155 (65%), Gaps = 13/155 (8%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHI--DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            + PAM+VFGDS +DVGNNN++    + +A+ P+ G+D+PG   TGRFSNG N AD+LA+ 
Sbjct  28   RPPAMFVFGDSTLDVGNNNYLAGPGVPQANKPYYGIDFPGSVPTGRFSNGYNIADYLAKS  87

Query  322  VGLP-TPPPYLS---DKNNVFL----KGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF  477
            +G   +PPPYLS       + L     GVS+ASGGAGI +STN G     + LS QV+ F
Sbjct  88   MGFASSPPPYLSLAPSTGRLVLTARGSGVSYASGGAGILDSTNAG---NNIPLSKQVQYF  144

Query  478  STVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLI  582
             + + +LV ++G+ A    LS+S FL  +G+NDL 
Sbjct  145  KSTKAQLVTKLGSRATHLLLSRSVFLFSVGSNDLF  179



>ref|XP_003572800.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Brachypodium 
distachyon]
Length=366

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 99/154 (64%), Gaps = 13/154 (8%)
 Frame = +1

Query  160  MYVFGDSLVDVGNNNHI--DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLP  333
            +YVFGDS  DVG+NN++   ++ RA+FPHNG+D+P  +ATGRFSNG N  DFLA  +G  
Sbjct  33   LYVFGDSTADVGSNNYLPGSAVPRANFPHNGIDFPTSRATGRFSNGYNGIDFLALNMGFK  92

Query  334  -TPPPYLSDKNNV------FLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQ  492
             +PPP+LS  N         L GV+FAS G+GI ++T + I++    +S QV  F+T++ 
Sbjct  93   RSPPPFLSVANKTNKQISQGLLGVNFASAGSGILDTTGDSIVA----MSKQVEQFATLRC  148

Query  493  KLVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
             +  +I   AA   LS+S FLI  G ND+  +F+
Sbjct  149  NISARISREAADDVLSRSLFLISTGGNDIFAFFS  182



>ref|XP_006372567.1| hypothetical protein POPTR_0017s02870g [Populus trichocarpa]
 gb|ERP50364.1| hypothetical protein POPTR_0017s02870g [Populus trichocarpa]
Length=355

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 94/144 (65%), Gaps = 4/144 (3%)
 Frame = +1

Query  163  YVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTP  339
            ++FGDSL +VGNN ++  S+ R+D+P  G+D+PG +ATGRF+NG    D ++ K+G+P+P
Sbjct  29   FIFGDSLTEVGNNKYLQYSLARSDYPWYGIDFPGGRATGRFTNGRTIGDIISAKLGIPSP  88

Query  340  PPYLSDKNN--VFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIG  513
            PP+LS   N    L GV++ASGGAGI N T    I K L   DQ+  F   ++ +  +IG
Sbjct  89   PPFLSLSKNDDALLTGVNYASGGAGILNDTGLYFIQK-LSFYDQIECFKKTKESIRAKIG  147

Query  514  AAAAKQQLSKSPFLILIGNNDLIN  585
              AA +  +++ + I +G+ND +N
Sbjct  148  EDAANKLCNEAMYFIGLGSNDYVN  171



>gb|EEC81334.1| hypothetical protein OsI_24509 [Oryza sativa Indica Group]
Length=384

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 101/163 (62%), Gaps = 18/163 (11%)
 Frame = +1

Query  145  QKVPAMYVFGDSLVDVGNNNHIDS--IIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
            ++V A++V GDS +DVGNNN++ S  + RA+ P+NG+DYP  K TGRFSNG N ADF+A 
Sbjct  35   RQVAAVFVLGDSTLDVGNNNYLPSKDVFRANKPYNGIDYPASKPTGRFSNGYNVADFIAM  94

Query  319  KVGL-PTPPPYLS------DKNNVFLK------GVSFASGGAGIFNSTNNGIISKALHLS  459
            K+G   +PP YLS         N+ L       GVSFASGGAG+ +ST  G   K + LS
Sbjct  95   KLGFKKSPPAYLSLLQGPAAAANLTLAIKALTGGVSFASGGAGVLDSTYAG---KCIPLS  151

Query  460  DQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
             Q+R     +  +V+++G  A    L++S FL+ + NND+  +
Sbjct  152  TQLRSMEATRAAMVSKVGTRAVAAHLARSFFLLGVANNDMFVF  194



>ref|XP_004977709.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=377

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 100/155 (65%), Gaps = 14/155 (9%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHI--DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEK  321
            + PAMYVFG S++DVGNNN++   ++ RA+  +NG+D+P    TGRFSNG N AD++A+ 
Sbjct  25   RPPAMYVFGSSILDVGNNNYLPGGAVGRANRRYNGIDFPASIPTGRFSNGYNIADYVAKN  84

Query  322  VGLP-TPPPYLS---DKNNVFLK-----GVSFASGGAGIFNSTNNGIISKALHLSDQVRL  474
            +G   +PP YLS   D +   +      G+S+ASGGAGI +STN G     + LS QV+ 
Sbjct  85   MGFACSPPAYLSLAPDSSGPLVHTAVAYGISYASGGAGILDSTNTG---NTIPLSKQVQY  141

Query  475  FSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDL  579
            F   + K+V  IG  A   +LS++ F+I IGNND+
Sbjct  142  FGATKAKMVAAIGPCAVNARLSRAIFVIAIGNNDM  176



>ref|XP_004952105.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Setaria italica]
Length=375

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 98/168 (58%), Gaps = 25/168 (15%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKV  324
            KVPAMYVFGDS  DVGNN+++  SI RADFPHNGVD+PG K TGRFSNG    DF+A  +
Sbjct  30   KVPAMYVFGDSTADVGNNDYLPWSIARADFPHNGVDFPGGKPTGRFSNGLIGVDFIAIAM  89

Query  325  GLP-TPPPYLSDKNNV------------------FLKGVSFASGGAGIFNSTNNGIISKA  447
            G   +PPPYLS   N                   +  G +FASGG+G+ +ST + I    
Sbjct  90   GFSRSPPPYLSLLANAANSSSEMTRNMTMAAAAAYATGANFASGGSGLLDSTGSTI----  145

Query  448  LHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFLILIGNNDLINYF  591
              ++ Q+  FS ++ ++  ++ A      LSKS FLI  G ND  ++F
Sbjct  146  -SMTQQIEYFSDLKDQMSTRLSAGRVSALLSKSIFLISAGANDAFDFF  192



>ref|XP_008382487.1| PREDICTED: GDSL esterase/lipase At5g55050-like [Malus domestica]
Length=356

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 96/153 (63%), Gaps = 9/153 (6%)
 Frame = +1

Query  154  PAMYVFGDSLVDVGNNNHI-DSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            P +++FGDS  DVG NN +  S  RADFPHNG+D+P  + TGRFSNG NSADFL+   GL
Sbjct  28   PLIFIFGDSTADVGTNNFLLTSTARADFPHNGIDFPSSEPTGRFSNGLNSADFLSMTFGL  87

Query  331  P-TPPPYLS----DKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQK  495
              +PPP+ S      +N    GV+FASGG+G+F+ T    +   + L++Q++ FSTV+  
Sbjct  88   KRSPPPFFSLNATSLSNKTFGGVNFASGGSGLFDITGKKSVKNVVPLAEQIQQFSTVKSN  147

Query  496  LVNQIGAAAAKQQLSKSPFLILIGNNDLINYFN  594
            L    G    ++   +S F I IG+NDL  Y++
Sbjct  148  LTAIKG---GRRVTERSLFFISIGSNDLFGYYH  177



>ref|XP_002972662.1| hypothetical protein SELMODRAFT_98542 [Selaginella moellendorffii]
 gb|EFJ25883.1| hypothetical protein SELMODRAFT_98542 [Selaginella moellendorffii]
Length=355

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +1

Query  148  KVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVG  327
            + PA++VFGDSLVD GNNN++++  RA+FP  G+++   +ATGRF++G    D++A  + 
Sbjct  24   QTPALFVFGDSLVDAGNNNYLNTFSRANFPPFGINFDQHRATGRFTDGRLIPDYIASFLN  83

Query  328  LPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQ  507
            LP PPPYL    NV ++G +F SGGAGI NST  G+   A  L  Q+  F   ++ L + 
Sbjct  84   LPFPPPYLGAGGNV-IQGANFGSGGAGIHNSTGAGMGDHA-PLYRQIEYFREAKEALDSS  141

Query  508  IGAAAAKQQLSKSPFLILIGNNDLIN  585
            +GA  +   +SKS F I IGNND  N
Sbjct  142  LGAYNSSLLVSKSIFYISIGNNDFAN  167



>ref|XP_010694317.1| PREDICTED: GDSL esterase/lipase 7 [Beta vulgaris subsp. vulgaris]
Length=357

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            VPA+YVFGDSL D GNNN + ++ +A++   GV++PG   TGRF+NG   ADF+AE +GL
Sbjct  27   VPALYVFGDSLFDSGNNNFLPTLAKANYYPYGVNFPGSYPTGRFTNGKTVADFIAEYLGL  86

Query  331  PTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLF-STVQQKLVNQ  507
            P PPP +S      L G +FASG  GI   T    I + L L +Q++LF +TV+ +L ++
Sbjct  87   PFPPPRVSILRPKSLMGYNFASGSCGILPETGK-FIGECLSLGEQIKLFETTVKIQLASK  145

Query  508  IGAA-AAKQQLSKSPFLILIGNNDLIN-YF  591
                    Q L+KS F+  +GNND IN YF
Sbjct  146  FKTGDQLSQHLAKSIFIFSVGNNDYINTYF  175



>ref|XP_002973211.1| hypothetical protein SELMODRAFT_413745 [Selaginella moellendorffii]
 gb|EFJ25585.1| hypothetical protein SELMODRAFT_413745 [Selaginella moellendorffii]
Length=336

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 91/150 (61%), Gaps = 4/150 (3%)
 Frame = +1

Query  139  EAQKVPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAE  318
             AQ VPA++ FGDSLVD GNNN + +I RA+ P  G ++    ATGRF +G    DFLA 
Sbjct  15   SAQIVPALFAFGDSLVDSGNNNMLPTIARANHPPYGYNFDNHAATGRFCDGKLIPDFLAS  74

Query  319  KVGLPTPPPYLSDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKL  498
             +GLP PPPYLS  +N+  +GVSF S  +GI   T  G +   L  ++QV  F  VQ +L
Sbjct  75   LLGLPFPPPYLSAGDNI-TQGVSFGSASSGIGRWTGQGFV---LSFANQVDGFREVQSRL  130

Query  499  VNQIGAAAAKQQLSKSPFLILIGNNDLINY  588
            V ++G   A   +S+S F I   NND+ N+
Sbjct  131  VRRLGPMRAMSLISRSIFYICTANNDVNNF  160



>dbj|BAK02158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=468

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 112/197 (57%), Gaps = 4/197 (2%)
 Frame = +1

Query  10   RERHQKSYQETSSRMMGFACSLRKMNVFIVflsfsfflsgsfsEAQKVPAMYVFGDSLVD  189
            + +H+  Y+E   +   +  S  +   F +    +   +   +   K P +Y+FGDS+ D
Sbjct  11   QHKHRGIYREGKQKAQQWQLSAPRPWPFAILALATVAGAALGTATTKKPVIYIFGDSMSD  70

Query  190  VGNNNHID-SIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGLPTPPPYLS--DK  360
            VGNNN++  SI + ++P  G+DY G   TGRF+NG    D +A K G+P PPP+LS    
Sbjct  71   VGNNNYLLLSIAKCNYPWYGIDYEGGYPTGRFTNGRTIGDIMAAKFGVPPPPPFLSLYMT  130

Query  361  NNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLS  540
            ++  L GV+FASGGAG+ N T    + + L   +Q+  F  ++  ++ +IG  AA++ ++
Sbjct  131  DDEVLGGVNFASGGAGLLNETGIYFV-EYLSFDNQISYFEQIKNAMIGKIGKKAAEEVVN  189

Query  541  KSPFLILIGNNDLINYF  591
             + F I +G+ND +N F
Sbjct  190  GAIFQIGLGSNDYVNNF  206



>ref|NP_001183248.1| hypothetical protein precursor [Zea mays]
 gb|ACR36193.1| unknown [Zea mays]
 gb|AFW69560.1| hypothetical protein ZEAMMB73_173356 [Zea mays]
Length=379

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 112/191 (59%), Gaps = 16/191 (8%)
 Frame = +1

Query  52   MMGFACSLRKMNVFIVflsfsfflsgsfsE--AQKVPAMYVFGDSLVDVGNNNHI--DSI  219
            MMG+ C +  M V ++ L      +   S+     VPA+YVFGDS +DVGNNN++    +
Sbjct  1    MMGW-CEVGMMKVLVLSLVAGAVAAVRPSKLLPAAVPAVYVFGDSTLDVGNNNYLPGKDV  59

Query  220  IRADFPHNGVDYPGR-KATGRFSNGNNSADFLAEKVGL-PTPPPYLSDKNNVFL------  375
             RAD P+ G+D PG  K TGRFSNG N+ADF+A+ +G   +P  YL  K    L      
Sbjct  60   PRADKPYYGIDLPGSGKPTGRFSNGYNTADFVAQALGFKKSPLAYLELKARKMLIPSAVT  119

Query  376  KGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVNQIGAAAAKQQLSKSPFL  555
            +GVS+AS GAGI +STN G     + LS QVRLF + + ++   +G  A ++ LS S FL
Sbjct  120  RGVSYASAGAGILDSTNAG---NNIPLSQQVRLFESTKAEMEAAVGQRAVRKLLSASFFL  176

Query  556  ILIGNNDLINY  588
            +  G+ND   +
Sbjct  177  VSAGSNDFFAF  187



>ref|XP_002994082.1| hypothetical protein SELMODRAFT_45524, partial [Selaginella moellendorffii]
 gb|EFJ04869.1| hypothetical protein SELMODRAFT_45524, partial [Selaginella moellendorffii]
Length=318

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 92/147 (63%), Gaps = 4/147 (3%)
 Frame = +1

Query  151  VPAMYVFGDSLVDVGNNNHIDSIIRADFPHNGVDYPGRKATGRFSNGNNSADFLAEKVGL  330
            VPAM++FGDSLVDVGNNN++ ++ +A+    G+D P   ATGRF NG    D + E +GL
Sbjct  2    VPAMFIFGDSLVDVGNNNYLLTLAKANVAPYGIDSP-WGATGRFCNGKTVLDVVCELIGL  60

Query  331  PTPPPYL--SDKNNVFLKGVSFASGGAGIFNSTNNGIISKALHLSDQVRLFSTVQQKLVN  504
            P  P +L  S KN   LKGV++ASG  GI + +    I + + +S Q+  F      LV 
Sbjct  61   PYVPAFLDPSTKNARILKGVNYASGAGGILDESGKNYIER-ISMSQQLHYFQQTLSGLVQ  119

Query  505  QIGAAAAKQQLSKSPFLILIGNNDLIN  585
            Q+G++  +Q LS S F I+IGNND IN
Sbjct  120  QLGSSGCQQLLSDSLFAIVIGNNDYIN  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 790907177704