BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1598

Length=1221
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    268   3e-109   Solanum lycopersicum
emb|CDP07225.1|  unnamed protein product                                267   2e-106   Coffea canephora [robusta coffee]
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    260   2e-103   Sesamum indicum [beniseed]
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg             245   9e-102   
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    269   5e-101   
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                  248   1e-99    Medicago truncatula
ref|XP_012072679.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    245   3e-99    Jatropha curcas
gb|KDP37816.1|  hypothetical protein JCGZ_06718                         246   3e-99    Jatropha curcas
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    241   8e-99    Glycine max [soybeans]
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                        240   2e-98    Glycine soja [wild soybean]
ref|XP_012072678.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    245   2e-98    
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    262   2e-97    Sesamum indicum [beniseed]
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        238   3e-97    Prunus mume [ume]
ref|XP_006359948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    257   4e-97    Solanum tuberosum [potatoes]
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg                241   6e-97    Erythranthe guttata [common monkey flower]
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                  249   6e-96    
ref|XP_006385149.1|  alcohol oxidase-related family protein             249   1e-95    
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        246   2e-95    Populus euphratica
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...    243   3e-95    
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    253   9e-94    
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        229   1e-93    Eucalyptus grandis [rose gum]
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                     229   1e-93    Eucalyptus grandis [rose gum]
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                    235   7e-93    Arabis alpina [alpine rockcress]
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg             238   2e-92    Capsella rubella
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    239   1e-91    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg                229   3e-91    Erythranthe guttata [common monkey flower]
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        234   6e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                   239   9e-91    
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    224   1e-90    Cucumis melo [Oriental melon]
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    233   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    234   1e-89    
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    226   6e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006878629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        234   1e-87    Amborella trichopoda
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    216   1e-87    Tarenaya hassleriana [spider flower]
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    216   2e-87    Tarenaya hassleriana [spider flower]
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    231   2e-87    Beta vulgaris subsp. vulgaris [field beet]
gb|EPS61567.1|  hypothetical protein M569_13229                         209   3e-86    Genlisea aurea
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    212   3e-83    Phoenix dactylifera
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        227   5e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        213   2e-80    Elaeis guineensis
gb|AGK82821.1|  alcohol oxidase                                         273   4e-80    Solanum pimpinellifolium [currant tomato]
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    213   5e-80    Phoenix dactylifera
gb|AGK82832.1|  alcohol oxidase                                         272   8e-80    Solanum habrochaites
gb|AGK82806.1|  alcohol oxidase                                         272   8e-80    Solanum lycopersicum
gb|AGK82825.1|  alcohol oxidase                                         272   9e-80    Solanum pennellii
ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    272   1e-79    
gb|EPS64229.1|  hypothetical protein M569_10552                         224   3e-79    Genlisea aurea
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        266   3e-77    Nicotiana sylvestris
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    264   7e-77    
ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        263   4e-76    Nicotiana tomentosiformis
ref|XP_011072475.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    260   9e-76    
ref|XP_010274420.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    234   3e-75    
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g             257   1e-73    Phaseolus vulgaris [French bean]
gb|KHN27504.1|  Long-chain-alcohol oxidase FAO4A                        251   8e-73    Glycine soja [wild soybean]
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    254   1e-72    Cicer arietinum [garbanzo]
gb|ABR17814.1|  unknown                                                 196   2e-72    Picea sitchensis
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    253   4e-72    Glycine max [soybeans]
gb|KHN11789.1|  Long-chain-alcohol oxidase FAO4A                        249   4e-72    Glycine soja [wild soybean]
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein            253   4e-72    Medicago truncatula
ref|XP_002519938.1|  electron carrier, putative                         250   6e-72    Ricinus communis
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    249   4e-71    Glycine max [soybeans]
gb|KDP37817.1|  hypothetical protein JCGZ_06719                         245   9e-71    Jatropha curcas
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g             249   9e-71    Phaseolus vulgaris [French bean]
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    248   2e-70    Nelumbo nucifera [Indian lotus]
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    248   3e-70    Glycine max [soybeans]
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    190   3e-70    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO72345.1|  hypothetical protein CISIN_1g0039902mg                  243   4e-69    Citrus sinensis [apfelsine]
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        243   6e-69    Brassica rapa
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    243   9e-69    Citrus sinensis [apfelsine]
ref|XP_006283178.1|  hypothetical protein CARUB_v10004208mg             238   4e-68    
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg             241   4e-68    Citrus clementina [clementine]
ref|XP_008438494.1|  PREDICTED: long-chain-alcohol oxidase FAO1         193   1e-67    Cucumis melo [Oriental melon]
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    240   1e-67    Cicer arietinum [garbanzo]
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg             238   2e-67    
ref|XP_010023906.1|  PREDICTED: long-chain-alcohol oxidase FAO1         187   7e-67    Eucalyptus grandis [rose gum]
gb|KCW60303.1|  hypothetical protein EUGRSUZ_H03017                     187   8e-67    Eucalyptus grandis [rose gum]
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                      236   1e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134405.1|  PREDICTED: long-chain-alcohol oxidase FAO1         189   1e-66    Cucumis sativus [cucumbers]
emb|CDX98615.1|  BnaA03g44000D                                          234   3e-66    
emb|CAA18625.1|  putative protein                                       234   4e-66    Arabidopsis thaliana [mouse-ear cress]
gb|KEH15695.1|  long-chain-alcohol oxidase FAO1                         181   1e-65    Medicago truncatula
gb|AES89853.2|  long-chain-alcohol oxidase FAO2-like protein            181   1e-65    Medicago truncatula
emb|CAN71289.1|  hypothetical protein VITISV_019349                     192   3e-65    Vitis vinifera
emb|CDY01593.1|  BnaC07g35830D                                          233   3e-65    
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    233   4e-65    Brassica rapa
ref|XP_002314488.2|  alcohol oxidase-related family protein             179   4e-65    
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        233   5e-65    Vitis vinifera
ref|XP_010920358.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    194   3e-64    Elaeis guineensis
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728             230   3e-64    
ref|XP_002967201.1|  hypothetical protein SELMODRAFT_87684              179   4e-64    
gb|KEH30749.1|  long-chain-alcohol oxidase FAO2-like protein            176   5e-64    Medicago truncatula
ref|XP_002960521.1|  hypothetical protein SELMODRAFT_74601              179   6e-64    
ref|XP_002285334.1|  PREDICTED: long-chain-alcohol oxidase FAO1         187   7e-64    Vitis vinifera
ref|XP_010684652.1|  PREDICTED: long-chain-alcohol oxidase FAO2         171   1e-63    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003554295.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    173   1e-63    Glycine max [soybeans]
ref|XP_004289970.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    184   2e-63    Fragaria vesca subsp. vesca
ref|XP_008447391.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    182   2e-63    
ref|XP_010934290.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    184   3e-63    Elaeis guineensis
ref|XP_011030464.1|  PREDICTED: long-chain-alcohol oxidase FAO1         177   3e-63    Populus euphratica
ref|XP_004152057.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    177   3e-63    Cucumis sativus [cucumbers]
gb|KHN02487.1|  Long-chain-alcohol oxidase FAO2                         171   3e-63    Glycine soja [wild soybean]
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                     227   4e-63    Eucalyptus grandis [rose gum]
ref|XP_004505474.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    172   4e-63    Cicer arietinum [garbanzo]
ref|XP_011659885.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    218   7e-63    Cucumis sativus [cucumbers]
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    227   7e-63    Eucalyptus grandis [rose gum]
gb|ACF22878.1|  alcohol oxidase                                         173   1e-62    Glycine max [soybeans]
ref|XP_002529832.1|  electron carrier, putative                         171   2e-62    Ricinus communis
ref|XP_007224435.1|  hypothetical protein PRUPE_ppa021498mg             175   3e-62    
ref|XP_010036770.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    174   3e-62    Eucalyptus grandis [rose gum]
ref|XP_003571871.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    177   4e-62    Brachypodium distachyon [annual false brome]
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    224   4e-62    Cucumis melo [Oriental melon]
gb|KJB10006.1|  hypothetical protein B456_001G179800                    177   5e-62    Gossypium raimondii
ref|XP_008364320.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    176   6e-62    
dbj|BAJ86655.1|  predicted protein                                      173   7e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO60414.1|  hypothetical protein CISIN_1g004496mg                   174   8e-62    Citrus sinensis [apfelsine]
gb|EYU46421.1|  hypothetical protein MIMGU_mgv1a001868mg                171   8e-62    Erythranthe guttata [common monkey flower]
ref|XP_004150760.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        220   2e-61    Cucumis sativus [cucumbers]
ref|XP_006367233.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    175   2e-61    Solanum tuberosum [potatoes]
ref|XP_004495357.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    169   2e-61    Cicer arietinum [garbanzo]
ref|XP_008668721.1|  PREDICTED: uncharacterized protein LOC100274...    171   3e-61    Zea mays [maize]
ref|XP_009336115.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    177   4e-61    Pyrus x bretschneideri [bai li]
gb|KJB72414.1|  hypothetical protein B456_011G177100                    183   4e-61    Gossypium raimondii
ref|XP_012069873.1|  PREDICTED: long-chain-alcohol oxidase FAO1         177   5e-61    Jatropha curcas
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    173   5e-61    Citrus sinensis [apfelsine]
ref|XP_008224323.1|  PREDICTED: long-chain-alcohol oxidase FAO1         172   5e-61    Prunus mume [ume]
ref|XP_012085273.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    174   6e-61    
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg             174   7e-61    Citrus clementina [clementine]
gb|AGC65582.1|  fatty alcohol oxidase                                   180   8e-61    Simmondsia chinensis [goatnut]
ref|XP_010038987.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    176   9e-61    
ref|XP_010069617.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    179   1e-60    Eucalyptus grandis [rose gum]
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1         169   1e-60    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg             172   1e-60    Citrus clementina [clementine]
gb|EMS48507.1|  Long-chain-alcohol oxidase FAO1                         176   1e-60    Triticum urartu
ref|XP_008804287.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    178   1e-60    Phoenix dactylifera
ref|XP_007050220.1|  Alcohol oxidase                                    178   1e-60    
ref|XP_006443786.1|  hypothetical protein CICLE_v10018992mg             169   2e-60    Citrus clementina [clementine]
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    173   2e-60    
gb|KHG08529.1|  Long-chain-alcohol oxidase FAO2                         175   2e-60    Gossypium arboreum [tree cotton]
ref|XP_010466677.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    173   3e-60    Camelina sativa [gold-of-pleasure]
ref|XP_004982881.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    170   3e-60    Setaria italica
gb|KJB10008.1|  hypothetical protein B456_001G179800                    177   3e-60    Gossypium raimondii
ref|XP_008382148.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    219   3e-60    
ref|XP_010264984.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    170   4e-60    Nelumbo nucifera [Indian lotus]
ref|XP_002272123.2|  PREDICTED: long-chain-alcohol oxidase FAO2-like    177   4e-60    Vitis vinifera
ref|XP_011091281.1|  PREDICTED: long-chain-alcohol oxidase FAO1         165   6e-60    Sesamum indicum [beniseed]
gb|KHG17178.1|  Long-chain-alcohol oxidase FAO1                         179   6e-60    Gossypium arboreum [tree cotton]
ref|XP_011628129.1|  PREDICTED: long-chain-alcohol oxidase FAO2         179   7e-60    Amborella trichopoda
ref|XP_010262397.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    176   8e-60    Nelumbo nucifera [Indian lotus]
ref|XP_009369441.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    170   1e-59    Pyrus x bretschneideri [bai li]
ref|XP_003540021.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    177   2e-59    Glycine max [soybeans]
gb|KHN28101.1|  Long-chain-alcohol oxidase FAO1-like protein            170   3e-59    Glycine soja [wild soybean]
ref|XP_006582261.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    170   4e-59    Glycine max [soybeans]
ref|XP_010093072.1|  Long-chain-alcohol oxidase FAO2                    178   4e-59    Morus notabilis
ref|XP_003607656.1|  Annotation was added to scaffolds in Novembe...    181   4e-59    
ref|XP_002311685.2|  alcohol oxidase-related family protein             175   5e-59    Populus trichocarpa [western balsam poplar]
gb|AAK64154.1|  unknown protein                                         174   6e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004247518.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    167   7e-59    Solanum lycopersicum
gb|KGN56837.1|  hypothetical protein Csa_3G134850                       189   7e-59    Cucumis sativus [cucumbers]
emb|CDY66156.1|  BnaA01g34950D                                          211   1e-58    Brassica napus [oilseed rape]
gb|EYU46424.1|  hypothetical protein MIMGU_mgv1a001883mg                171   1e-58    Erythranthe guttata [common monkey flower]
ref|NP_194586.1|  Long-chain-alcohol oxidase FAO4B                      174   2e-58    Arabidopsis thaliana [mouse-ear cress]
gb|AAM63097.1|  unknown                                                 174   2e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009369442.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    171   2e-58    Pyrus x bretschneideri [bai li]
ref|XP_009594479.1|  PREDICTED: long-chain-alcohol oxidase FAO2         168   2e-58    Nicotiana tomentosiformis
ref|XP_011029789.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    173   2e-58    Populus euphratica
ref|XP_007200494.1|  hypothetical protein PRUPE_ppa018458mg             170   3e-58    Prunus persica
ref|XP_003574052.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    172   4e-58    Brachypodium distachyon [annual false brome]
gb|KJB72416.1|  hypothetical protein B456_011G177100                    183   4e-58    Gossypium raimondii
ref|XP_010501308.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    167   5e-58    Camelina sativa [gold-of-pleasure]
ref|XP_010457422.1|  PREDICTED: long-chain-alcohol oxidase FAO1         169   5e-58    Camelina sativa [gold-of-pleasure]
ref|XP_010262396.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    176   7e-58    
ref|XP_006589281.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    170   7e-58    Glycine max [soybeans]
ref|XP_010512451.1|  PREDICTED: long-chain-alcohol oxidase FAO3         169   1e-57    Camelina sativa [gold-of-pleasure]
emb|CDX99382.1|  BnaC01g11700D                                          208   1e-57    
ref|XP_004247745.1|  PREDICTED: long-chain-alcohol oxidase FAO1         166   1e-57    Solanum lycopersicum
emb|CDX92884.1|  BnaC07g41420D                                          178   1e-57    
emb|CDP11641.1|  unnamed protein product                                174   2e-57    Coffea canephora [robusta coffee]
ref|XP_009790215.1|  PREDICTED: long-chain-alcohol oxidase FAO1         167   2e-57    Nicotiana sylvestris
ref|XP_008785203.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    173   2e-57    Phoenix dactylifera
gb|ERN18825.1|  hypothetical protein AMTR_s00067p00112750               180   2e-57    Amborella trichopoda
ref|XP_002869492.1|  hypothetical protein ARALYDRAFT_491906             175   2e-57    Arabidopsis lyrata subsp. lyrata
ref|XP_010488398.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    169   4e-57    Camelina sativa [gold-of-pleasure]
ref|XP_010475034.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    169   5e-57    Camelina sativa [gold-of-pleasure]
ref|XP_008235630.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    170   5e-57    Prunus mume [ume]
ref|XP_002528823.1|  disulfide oxidoreductase, putative                 170   8e-57    Ricinus communis
ref|XP_009764096.1|  PREDICTED: long-chain-alcohol oxidase FAO2         170   1e-56    Nicotiana sylvestris
ref|XP_007035183.1|  Fatty alcohol oxidase 3 isoform 1                  184   1e-56    
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    209   1e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008664883.1|  PREDICTED: long-chain-alcohol oxidase FAO1         154   2e-56    Zea mays [maize]
ref|XP_006354463.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    162   2e-56    Solanum tuberosum [potatoes]
ref|XP_009376994.1|  PREDICTED: long-chain-alcohol oxidase FAO1         175   2e-56    Pyrus x bretschneideri [bai li]
ref|XP_006306477.1|  hypothetical protein CARUB_v10012453mg             167   3e-56    Capsella rubella
ref|NP_566729.1|  long-chain-alcohol oxidase FAO3                       165   3e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296686.1|  hypothetical protein CARUB_v10013046mg             168   3e-56    Capsella rubella
ref|XP_002883430.1|  hypothetical protein ARALYDRAFT_479855             164   3e-56    
gb|EYU18303.1|  hypothetical protein MIMGU_mgv1a001896mg                150   4e-56    Erythranthe guttata [common monkey flower]
ref|XP_010532671.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    163   5e-56    Tarenaya hassleriana [spider flower]
ref|XP_010529119.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    163   5e-56    Tarenaya hassleriana [spider flower]
gb|KJB10007.1|  hypothetical protein B456_001G179800                    177   6e-56    Gossypium raimondii
ref|XP_006412936.1|  hypothetical protein EUTSA_v10024496mg             187   7e-56    Eutrema salsugineum [saltwater cress]
ref|XP_008382898.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    172   1e-55    
gb|EEC67160.1|  hypothetical protein OsI_34014                          170   1e-55    Oryza sativa Indica Group [Indian rice]
gb|KHG12235.1|  Long-chain-alcohol oxidase FAO1                         170   1e-55    Gossypium arboreum [tree cotton]
emb|CDY51703.1|  BnaA03g58930D                                          179   1e-55    Brassica napus [oilseed rape]
ref|XP_009102621.1|  PREDICTED: long-chain-alcohol oxidase FAO3         165   1e-55    Brassica rapa
emb|CDX77517.1|  BnaA07g06550D                                          164   2e-55    
ref|XP_002464495.1|  hypothetical protein SORBIDRAFT_01g019470          171   2e-55    Sorghum bicolor [broomcorn]
ref|XP_006283182.1|  hypothetical protein CARUB_v10004212mg             172   2e-55    Capsella rubella
gb|KJB38384.1|  hypothetical protein B456_006G252500                    167   3e-55    Gossypium raimondii
gb|KFK29401.1|  hypothetical protein AALP_AA7G128800                    172   3e-55    Arabis alpina [alpine rockcress]
ref|XP_004982884.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    155   3e-55    Setaria italica
ref|XP_009610950.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    164   3e-55    Nicotiana tomentosiformis
gb|KDP26499.1|  hypothetical protein JCGZ_17657                         175   4e-55    Jatropha curcas
emb|CDX94858.1|  BnaC03g43300D                                          162   9e-55    
ref|XP_006418179.1|  hypothetical protein EUTSA_v10006882mg             164   1e-54    Eutrema salsugineum [saltwater cress]
ref|XP_010447958.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    171   1e-54    Camelina sativa [gold-of-pleasure]
ref|XP_007162567.1|  hypothetical protein PHAVU_001G162800g             155   2e-54    Phaseolus vulgaris [French bean]
emb|CDX85097.1|  BnaC07g08090D                                          159   2e-54    
ref|XP_010532673.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    164   2e-54    Tarenaya hassleriana [spider flower]
ref|XP_007132926.1|  hypothetical protein PHAVU_011G136600g             167   2e-54    Phaseolus vulgaris [French bean]
ref|NP_001176205.1|  Os10g0474966                                       160   3e-54    
gb|EPS58840.1|  hypothetical protein M569_15969                         162   3e-54    Genlisea aurea
gb|EPS66779.1|  hypothetical protein M569_07992                         169   3e-54    Genlisea aurea
ref|XP_006406028.1|  hypothetical protein EUTSA_v10020141mg             161   4e-54    Eutrema salsugineum [saltwater cress]
ref|NP_001142399.1|  uncharacterized protein LOC100274574               171   6e-54    Zea mays [maize]
emb|CDP03771.1|  unnamed protein product                                156   7e-54    Coffea canephora [robusta coffee]
ref|XP_010532672.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    166   8e-54    Tarenaya hassleriana [spider flower]
ref|XP_010433200.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        169   9e-54    Camelina sativa [gold-of-pleasure]
gb|AAP54248.2|  GMC oxidoreductase family protein, expressed            164   1e-53    Oryza sativa Japonica Group [Japonica rice]
gb|KEH23950.1|  long-chain-alcohol oxidase FAO1                         159   3e-53    Medicago truncatula
ref|XP_009137800.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        179   3e-53    Brassica rapa
gb|KFK39637.1|  hypothetical protein AALP_AA3G269600                    165   3e-53    Arabis alpina [alpine rockcress]
emb|CBI29206.3|  unnamed protein product                                198   4e-53    Vitis vinifera
ref|XP_010438427.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    166   5e-53    Camelina sativa [gold-of-pleasure]
ref|XP_011080081.1|  PREDICTED: long-chain-alcohol oxidase FAO2         162   1e-52    Sesamum indicum [beniseed]
ref|XP_007035188.1|  Fatty alcohol oxidase 3 isoform 6                  183   1e-52    
emb|CDX92985.1|  BnaA03g37070D                                          159   1e-52    
emb|CAC87643.1|  alcohol oxidase                                        165   2e-52    Arabidopsis thaliana [mouse-ear cress]
emb|CDY18199.1|  BnaC05g02220D                                          166   2e-52    Brassica napus [oilseed rape]
emb|CDX89850.1|  BnaA10g02320D                                          166   3e-52    
ref|XP_009119340.1|  PREDICTED: long-chain-alcohol oxidase FAO1         165   4e-52    Brassica rapa
emb|CDO99261.1|  unnamed protein product                                176   6e-52    Coffea canephora [robusta coffee]
ref|XP_004309279.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    185   7e-52    Fragaria vesca subsp. vesca
ref|XP_009136067.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    157   1e-51    Brassica rapa
ref|XP_011080082.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    160   2e-51    Sesamum indicum [beniseed]
ref|XP_002889487.1|  hypothetical protein ARALYDRAFT_470376             159   2e-51    Arabidopsis lyrata subsp. lyrata
gb|EMT04470.1|  Putative GMC-type oxidoreductase                        171   4e-51    
ref|XP_010548742.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    176   1e-50    Tarenaya hassleriana [spider flower]
ref|NP_001148058.1|  oxidoreductase                                     144   1e-50    
gb|ACN27562.1|  unknown                                                 144   1e-50    Zea mays [maize]
gb|EEC73620.1|  hypothetical protein OsI_08118                          155   2e-50    Oryza sativa Indica Group [Indian rice]
ref|XP_002464496.1|  hypothetical protein SORBIDRAFT_01g019480          154   2e-50    
ref|XP_004296386.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...    154   3e-50    Fragaria vesca subsp. vesca
ref|NP_001047464.1|  Os02g0621800                                       154   4e-50    
ref|XP_006412937.1|  hypothetical protein EUTSA_v10024496mg             188   1e-49    
ref|NP_171895.2|  long-chain-alcohol oxidase FAO1                       160   2e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006354464.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    162   2e-49    Solanum tuberosum [potatoes]
gb|AAL31024.1|AC078948_8  putative alcohol oxidase                      164   4e-49    Oryza sativa Japonica Group [Japonica rice]
gb|EEE57396.1|  hypothetical protein OsJ_07570                          154   5e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007035186.1|  Alcohol oxidase, putative isoform 4                184   3e-48    
ref|XP_006662437.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    173   5e-48    
sp|B5WWZ9.1|FAO2_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    169   5e-48    Lotus japonicus
gb|KJB72415.1|  hypothetical protein B456_011G177100                    184   6e-48    Gossypium raimondii
ref|XP_010526493.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    169   7e-48    Tarenaya hassleriana [spider flower]
ref|XP_004982885.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    155   2e-47    
ref|XP_004493801.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    157   3e-47    Cicer arietinum [garbanzo]
ref|XP_003607676.1|  Annotation was added to scaffolds in Novembe...    176   1e-45    
sp|B5WWZ8.1|FAO1_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    175   9e-45    Lotus japonicus
gb|EMT02982.1|  Putative GMC-type oxidoreductase                        117   1e-44    
ref|XP_010523169.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    146   3e-44    
tpg|DAA49654.1|  TPA: hypothetical protein ZEAMMB73_468308              171   8e-44    
gb|EEE51131.1|  hypothetical protein OsJ_31875                          170   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AAL31049.1|AC078893_12  putative oxidase                             170   2e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AAL31021.1|AC078948_5  putative alcohol oxidase                      170   3e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006589282.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    170   3e-43    
gb|KHN30591.1|  Long-chain-alcohol oxidase FAO1                         170   3e-43    Glycine soja [wild soybean]
ref|XP_011462285.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...    155   5e-43    Fragaria vesca subsp. vesca
ref|XP_007144044.1|  hypothetical protein PHAVU_007G124200g             167   6e-42    Phaseolus vulgaris [French bean]
ref|XP_006662436.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    166   7e-42    
ref|XP_002464494.1|  hypothetical protein SORBIDRAFT_01g019460          166   8e-42    
gb|AAD10696.1|  Unknown protein                                         160   2e-41    
ref|NP_001064839.2|  Os10g0474800                                       164   3e-41    
gb|EAY78905.1|  hypothetical protein OsI_34008                          163   5e-41    
ref|XP_002982582.1|  hypothetical protein SELMODRAFT_116855             163   6e-41    
ref|XP_002994642.1|  hypothetical protein SELMODRAFT_138935             163   6e-41    
ref|XP_002981110.1|  hypothetical protein SELMODRAFT_114089             163   7e-41    
gb|AAL31027.1|AC078948_11  putative alcohol oxidase                     160   5e-40    
gb|KEH23951.1|  long-chain-alcohol oxidase FAO1                         160   6e-40    
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621              161   7e-40    
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531              160   8e-40    
gb|EEE51130.1|  hypothetical protein OsJ_31873                          160   9e-40    
ref|XP_001761391.1|  predicted protein                                  160   1e-39    
gb|EEC67159.1|  hypothetical protein OsI_34012                          160   1e-39    
ref|XP_006386919.1|  hypothetical protein POPTR_0002s26130g             158   2e-39    
ref|XP_011024801.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    157   1e-38    
gb|KHN10761.1|  Long-chain-alcohol oxidase FAO2                         154   7e-38    
ref|XP_004953134.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    155   1e-37    
ref|XP_001763007.1|  predicted protein                                  154   3e-37    
ref|XP_003575383.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    150   4e-36    
gb|KFK42743.1|  hypothetical protein AALP_AA1G034000                    149   5e-36    
dbj|BAK00483.1|  predicted protein                                      147   2e-35    
ref|XP_001753124.1|  predicted protein                                  146   7e-35    
ref|XP_002454190.1|  hypothetical protein SORBIDRAFT_04g026390          147   8e-35    
ref|XP_002454188.1|  hypothetical protein SORBIDRAFT_04g026370          147   9e-35    
dbj|BAK02336.1|  predicted protein                                      145   2e-34    
ref|XP_004982883.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    144   3e-34    
ref|XP_006648845.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    138   4e-34    
ref|XP_004982882.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    144   5e-34    
gb|AES61079.2|  long-chain-alcohol oxidase FAO1-like protein            141   2e-33    
ref|XP_003590828.1|  Annotation was added to scaffolds in Novembe...    140   2e-33    
gb|ACF88407.1|  unknown                                                 126   1e-28    
ref|XP_005650828.1|  FAD/NAD(P)-binding domain-containing protein       125   2e-28    
ref|XP_010102592.1|  Long-chain-alcohol oxidase FAO1                    125   9e-28    
gb|KGN53995.1|  hypothetical protein Csa_4G246410                       119   1e-27    
ref|XP_001591990.1|  hypothetical protein SS1G_07437                    125   2e-27    
ref|XP_005644346.1|  FAD/NAD(P)-binding domain-containing protein       122   2e-27    
ref|XP_003869427.1|  hypothetical protein CORT_0D04520                  124   2e-27    
emb|CCD42906.1|  similar to long chain fatty alcohol oxidase            124   3e-27    
gb|EMR84578.1|  putative long chain fatty alcohol protein               124   3e-27    
ref|XP_001554225.1|  hypothetical protein BC1G_07362                    124   3e-27    
ref|XP_001268562.1|  long chain fatty alcohol oxidase, putative         123   6e-27    
ref|XP_009831231.1|  hypothetical protein H257_07412                    123   6e-27    
ref|XP_753079.1|  long chain fatty alcohol oxidase                      123   8e-27    
gb|KEY78297.1|  long chain fatty alcohol oxidase                        123   9e-27    
ref|XP_001214264.1|  conserved hypothetical protein                     122   1e-26    
ref|XP_007680563.1|  hypothetical protein BAUCODRAFT_274597             122   1e-26    
emb|CDY66155.1|  BnaA01g34940D                                          114   2e-26    
ref|XP_010644266.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    115   2e-26    
ref|XP_002569337.1|  Pc21g23700                                         121   2e-26    
gb|KFH71384.1|  hypothetical protein MVEG_01683                         121   3e-26    
gb|ESZ93853.1|  hypothetical protein SBOR_5750                          121   3e-26    
emb|CDM31622.1|  Alcohol dehydrogenase, long-chain fatty                121   3e-26    
gb|ACF87929.1|  unknown                                                 119   3e-26    
emb|CDX99381.1|  BnaC01g11710D                                          113   5e-26    
ref|XP_001264046.1|  long chain fatty alcohol oxidase, putative         120   6e-26    
ref|XP_007373525.1|  fatty alcohol oxidase                              120   7e-26    
gb|KKA24666.1|  Uncharacterized protein T310_1298                       120   7e-26    
gb|EMS51759.1|  Long-chain-alcohol oxidase FAO2                       80.5    1e-25    
ref|XP_007375878.1|  fatty alcohol oxidase                              119   2e-25    
emb|CCX32413.1|  Similar to Long-chain-alcohol oxidase FAO1; acc....    118   2e-25    
ref|XP_008871238.1|  hypothetical protein H310_07609                    116   5e-25    
gb|KJJ27046.1|  Alcohol dehydrogenase long-chain fatty                  117   5e-25    
ref|XP_008871240.1|  hypothetical protein, variant 2                    116   6e-25    
gb|KGO74925.1|  Alcohol dehydrogenase, long-chain fatty                 117   9e-25    
ref|XP_007697741.1|  hypothetical protein COCSADRAFT_295770             117   9e-25    
ref|XP_006489751.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    115   1e-24    
tpg|DAA49655.1|  TPA: hypothetical protein ZEAMMB73_468308              114   1e-24    
ref|XP_002618046.1|  hypothetical protein CLUG_01505                    116   1e-24    
gb|KFY41130.1|  hypothetical protein V494_03193                         116   1e-24    
ref|XP_008026917.1|  hypothetical protein SETTUDRAFT_20639              116   1e-24    
gb|AAS46880.1|  fatty alcohol oxidase                                   116   1e-24    
gb|KGO40669.1|  Alcohol dehydrogenase, long-chain fatty                 116   1e-24    
ref|XP_001792978.1|  hypothetical protein SNOG_02371                    116   1e-24    
gb|KFY15271.1|  hypothetical protein V492_02111                         116   2e-24    
ref|XP_007684042.1|  GMC oxidoreductase                                 115   2e-24    
ref|XP_003298648.1|  hypothetical protein PTT_09421                     115   2e-24    
gb|EPS25096.1|  hypothetical protein PDE_00027                          115   3e-24    
emb|CDR40807.1|  RHTO0S05e07470g1_1                                     115   3e-24    
gb|EMD94921.1|  hypothetical protein COCHEDRAFT_1201414                 115   4e-24    
gb|EMS23820.1|  long chain fatty alcohol oxidase                        115   4e-24    
gb|AAS46879.1|  fatty alcohol oxidase                                   115   4e-24    
ref|XP_007296903.1|  hypothetical protein MBM_09014                     115   4e-24    
ref|XP_007412898.1|  hypothetical protein MELLADRAFT_78490              114   4e-24    
ref|XP_002422236.1|  fatty alcohol oxidase, putative                    114   5e-24    
gb|EUN25552.1|  hypothetical protein COCVIDRAFT_39053                   114   6e-24    
gb|KGT63535.1|  hypothetical protein MEK_06076                          114   7e-24    
gb|KGU00959.1|  hypothetical protein MEQ_06042                          114   7e-24    
gb|KGU18308.1|  hypothetical protein MG7_05986                          114   7e-24    
gb|KHC59946.1|  hypothetical protein MGI_06027                          114   7e-24    
gb|KHC28526.1|  hypothetical protein MGQ_06035                          114   7e-24    
gb|KGU21594.1|  hypothetical protein MGM_06048                          114   7e-24    
ref|XP_712350.1|  potential long chain fatty acid alcohol oxidase       114   7e-24    
gb|EMG50258.1|  Long chain fatty alcohol oxidase                        109   7e-24    
gb|KGR05615.1|  hypothetical protein MG9_06083                          114   7e-24    
gb|KGQ81329.1|  hypothetical protein MG1_06098                          114   7e-24    
ref|XP_712386.1|  potential long chain fatty acid alcohol oxidase       114   7e-24    
gb|KGQ82028.1|  hypothetical protein MEO_06026                          114   8e-24    
ref|XP_007837981.1|  hypothetical protein PFICI_11209                   113   1e-23    
ref|XP_007706606.1|  hypothetical protein COCCADRAFT_81154              113   1e-23    
ref|XP_008871236.1|  hypothetical protein, variant                      112   1e-23    
dbj|GAA82032.1|  long chain fatty alcohol oxidase                       113   1e-23    
gb|EGU13115.1|  Long chain fatty alcohol oxidase                        112   2e-23    
gb|KFZ16786.1|  hypothetical protein V502_04902                         112   2e-23    
gb|KFY68894.1|  hypothetical protein V496_00717                         112   2e-23    
gb|KFY96639.1|  hypothetical protein V500_02373                         112   2e-23    
ref|XP_008871235.1|  hypothetical protein H310_07607                    112   3e-23    
ref|XP_001389382.1|  long chain fatty alcohol oxidase                   112   3e-23    
emb|CAB75353.1|  long chain fatty alcohol oxidase                       112   3e-23    
gb|EHA26798.1|  long chain fatty alcohol oxidase                        112   3e-23    
gb|KHC44433.1|  hypothetical protein MGC_06050                          112   3e-23    
gb|KIL90183.1|  hypothetical protein FAVG1_06922                        112   3e-23    
gb|KHC28037.1|  hypothetical protein MGO_06014                          112   3e-23    
ref|XP_001940486.1|  long chain fatty alcohol oxidase                   112   3e-23    
gb|KGU01716.1|  hypothetical protein MEY_06068                          112   4e-23    
gb|KGQ81126.1|  hypothetical protein MEU_06065                          112   4e-23    
gb|KFY31288.1|  hypothetical protein V493_01243                         112   4e-23    
gb|KGR01100.1|  hypothetical protein MG3_06097                          112   4e-23    
gb|KGU01103.1|  hypothetical protein MEM_06199                          112   4e-23    
gb|KFZ10506.1|  hypothetical protein V501_05178                         112   4e-23    
gb|EEQ43775.1|  hypothetical protein CAWG_02023                         111   4e-23    
gb|KFY76557.1|  hypothetical protein V499_03848                         112   4e-23    
gb|EFH90466.1|  glucose-methanol-choline oxidoreductase                 111   4e-23    
ref|WP_040443572.1|  hypothetical protein                               111   5e-23    
emb|CCE42799.1|  hypothetical protein CPAR2_204420                      111   5e-23    
ref|XP_009831227.1|  hypothetical protein, variant 5                    110   5e-23    
emb|CCE42800.1|  hypothetical protein CPAR2_204430                      110   7e-23    
ref|XP_009831228.1|  hypothetical protein, variant 3                    110   7e-23    
ref|XP_001386087.1|  long chain fatty acid oxidase                      110   7e-23    
ref|XP_009831229.1|  hypothetical protein, variant 1                    110   8e-23    
ref|XP_007912489.1|  putative long chain fatty acid oxidase protein     110   8e-23    
gb|KIN05921.1|  hypothetical protein OIDMADRAFT_189585                  110   1e-22    
gb|KFY64266.1|  hypothetical protein V496_03367                         110   1e-22    
gb|KDE02581.1|  hypothetical protein MVLG_06864                         110   1e-22    
ref|XP_003344707.1|  hypothetical protein SMAC_06361                    110   1e-22    
ref|XP_003869426.1|  hypothetical protein CORT_0D04510                  109   2e-22    
ref|XP_008728349.1|  hypothetical protein G647_05801                    110   2e-22    
ref|XP_003328562.1|  hypothetical protein PGTG_10521                    109   2e-22    
gb|EDK39369.2|  hypothetical protein PGUG_03467                         109   3e-22    
ref|XP_001484086.1|  hypothetical protein PGUG_03467                    109   3e-22    
gb|KIV82752.1|  hypothetical protein PV11_04836                         109   3e-22    
gb|KGR00851.1|  hypothetical protein MG5_06042                          109   3e-22    
gb|ENH81120.1|  long chain fatty alcohol oxidase                        109   3e-22    
gb|KIW34818.1|  hypothetical protein PV07_01571                         109   3e-22    
ref|XP_007754800.1|  hypothetical protein A1O7_02579                    108   3e-22    
gb|EMG50326.1|  Fatty alcohol oxidase                                   103   3e-22    
gb|KFY98584.1|  hypothetical protein V500_01604                         109   4e-22    
gb|KIV95783.1|  hypothetical protein PV10_03397                         108   4e-22    
gb|KFH47883.1|  Long-chain-alcohol oxidase-like protein                 108   5e-22    
gb|ELR05461.1|  hypothetical protein GMDG_01756                         108   6e-22    
ref|XP_658227.1|  hypothetical protein AN0623.2                         108   7e-22    
emb|CCT75976.1|  related to long chain fatty alcohol oxidase            108   7e-22    
gb|ACX81419.1|  fatty alcohol oxidase                                   107   8e-22    
gb|EFQ33355.1|  GMC oxidoreductase                                      107   8e-22    
emb|CCF43856.1|  GMC oxidoreductase                                     107   1e-21    
gb|KFY45551.1|  hypothetical protein V495_02926                         107   1e-21    
gb|KFY10153.1|  hypothetical protein V492_05166                         107   1e-21    
ref|XP_007595248.1|  GMC oxidoreductase                                 107   1e-21    
gb|ENH62892.1|  Long-chain-alcohol oxidase FAO2                         107   1e-21    
gb|KIW55196.1|  hypothetical protein PV05_07498                         107   1e-21    
gb|KFY02756.1|  hypothetical protein O988_01934                         107   1e-21    
emb|CAB75352.1|  long chain fatty alcohol oxidase                       107   2e-21    
gb|KFY48297.1|  hypothetical protein V495_01464                         107   2e-21    
gb|EGU81929.1|  hypothetical protein FOXB_07532                         106   2e-21    
gb|EWG51602.1|  hypothetical protein FVEG_10526                         106   2e-21    
gb|KFY79221.1|  hypothetical protein V499_01756                         107   2e-21    
gb|KFY36052.1|  hypothetical protein V494_05366                         106   2e-21    
gb|EXK25528.1|  hypothetical protein FOMG_17829                         106   2e-21    
gb|KIW70477.1|  hypothetical protein PV04_02744                         106   2e-21    
gb|KIZ02920.1|  hypothetical protein MNEG_5037                          106   3e-21    
gb|EWZ83069.1|  hypothetical protein FOWG_13006                         106   3e-21    
gb|EWZ33891.1|  hypothetical protein FOZG_13577                         105   3e-21    
gb|KDN64457.1|  putative GMC oxidoreductase                             105   3e-21    
gb|AAS46878.1|  fatty alcohol oxidase                                   105   3e-21    
gb|EMG48162.1|  Fatty alcohol oxidase                                   100   4e-21    
ref|XP_003607655.1|  Annotation was added to scaffolds in Novembe...    100   4e-21    
gb|ELR10689.1|  hypothetical protein GMDG_04950                         105   4e-21    
gb|KIW04861.1|  hypothetical protein PV09_04043                         105   4e-21    
ref|XP_006687527.1|  hypothetical protein CANTEDRAFT_108652             105   5e-21    
gb|KFY01862.1|  hypothetical protein V490_00733                         105   6e-21    
ref|XP_459506.2|  DEHA2E04268p                                          105   6e-21    
gb|EXA34422.1|  hypothetical protein FOVG_14401                         104   7e-21    
gb|EXK85609.1|  hypothetical protein FOQG_10402                         104   7e-21    
gb|EXM19432.1|  hypothetical protein FOTG_12485                         104   7e-21    
ref|XP_002841296.1|  hypothetical protein                               104   9e-21    
gb|KIW89940.1|  hypothetical protein Z519_09370                         104   1e-20    
gb|KFZ00641.1|  hypothetical protein V501_10589                         104   1e-20    
gb|EER37923.1|  long chain fatty acid oxidase                           103   1e-20    
gb|EGC44059.1|  long chain fatty acid oxidase                           103   1e-20    
gb|EMT74381.1|  Long-chain-alcohol oxidase FAO2                         103   1e-20    
gb|KIY02207.1|  hypothetical protein Z520_02345                         103   1e-20    
gb|KIX07916.1|  hypothetical protein Z518_02570                         103   2e-20    
gb|EXL94556.1|  hypothetical protein FOIG_12751                         103   2e-20    
ref|WP_019946571.1|  hypothetical protein                               103   2e-20    
gb|EKG12277.1|  Glucose-methanol-choline oxidoreductase                 103   2e-20    
gb|EQB53611.1|  GMC oxidoreductase                                      103   2e-20    
gb|KKA26714.1|  hypothetical protein TD95_005322                        103   2e-20    
ref|XP_001385255.2|  long chain fatty acid oxidase                      103   2e-20    
ref|XP_003869428.1|  hypothetical protein CORT_0D04530                  103   2e-20    
gb|EWY81831.1|  hypothetical protein FOYG_16040                         103   3e-20    
gb|KEQ97416.1|  hypothetical protein AUEXF2481DRAFT_72855               103   3e-20    
ref|XP_007746921.1|  hypothetical protein A1O5_08147                    103   3e-20    
gb|EXL42725.1|  hypothetical protein FOCG_15170                         103   3e-20    
ref|XP_007922551.1|  hypothetical protein MYCFIDRAFT_52380              102   4e-20    
gb|KEQ64225.1|  long-chain fatty alcohol dehydrogenase                  102   4e-20    
ref|WP_033369528.1|  hypothetical protein                               102   4e-20    
gb|KEQ70398.1|  long-chain fatty alcohol dehydrogenase                  102   4e-20    
gb|KIW81465.1|  hypothetical protein Z517_04490                         102   5e-20    
ref|XP_001525361.1|  hypothetical protein LELG_03289                    102   5e-20    
gb|ESA06032.1|  hypothetical protein GLOINDRAFT_82554                   102   5e-20    
dbj|GAA98883.1|  hypothetical protein E5Q_05571                         102   6e-20    
gb|KDO33323.1|  hypothetical protein SPRG_02132                         102   6e-20    
ref|WP_044005244.1|  hypothetical protein                               101   6e-20    
gb|AHJ99440.1|  hypothetical protein Hsw_3845                           101   7e-20    
ref|XP_008615139.1|  hypothetical protein SDRG_10901                    102   7e-20    
gb|KJX98957.1|  long chain fatty alcohol oxidase like protein           102   7e-20    
gb|EXX66452.1|  hypothetical protein RirG_123640                        102   7e-20    
dbj|GAM35263.1|  hypothetical protein TCE0_017r03459                    101   8e-20    
gb|KEQ82382.1|  long-chain fatty alcohol dehydrogenase                  101   9e-20    
ref|XP_001243546.1|  hypothetical protein CIMG_02987                    101   9e-20    
gb|EWY79768.1|  hypothetical protein FOYG_17058                         101   1e-19    



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score =   268 bits (686),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 189/244 (77%), Gaps = 11/244 (5%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAK  692
             GY GPDP   +++++  +   +DD     FGPL++GII L   ++ +F+RL +LG SV+K
Sbjct  185   GYSGPDPDFKKQKQENMNSKKKDDQP---FGPLHEGIISLKNSQKIIFHRLQELGFSVSK  241

Query  693   PKPPG--------PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLS  848
             P            P+F+IECDAVVVGSG GGGVI+G+LA AG+KV+VLEKG+Y AR+NLS
Sbjct  242   PHNFNNARRSTECPAFIIECDAVVVGSGSGGGVIAGILANAGHKVIVLEKGSYLARSNLS  301

Query  849   LLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGL  1028
             LLEGPSMD+M+LG GLL+T+D+D++LLAGSTVGGGS VNWSASI+TP +VL+EW E + L
Sbjct  302   LLEGPSMDQMYLGSGLLITQDMDVMLLAGSTVGGGSTVNWSASIQTPRHVLKEWSESYNL  361

Query  1029  ELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCG  1208
              LF S++Y +AM+ VC KMGVQ E EDE FQNM+LRKGC+EL YPV  IP NAPSDHYCG
Sbjct  362   RLFESELYKEAMEIVCEKMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSDHYCG  421

Query  1209  WCTF  1220
             WC+ 
Sbjct  422   WCSM  425


 Score =   156 bits (394),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 108/160 (68%), Gaps = 8/160 (5%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPE--------TTDASVTNFFQTSAASTGTPHQVAWV  214
            LS +Q+++L+ LC+TF+P+I++A             D S   F QTSA+  GTP  +AW+
Sbjct  26   LSSNQLDSLTTLCDTFVPSIHDANSYGHQDQGNIDDDDSYAKFLQTSASMNGTPQHIAWM  85

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  394
            IN R++HPK+N   L LW LSTRIGT +LCGK SLSTQFP+L  F  IS KKRE  V SW
Sbjct  86   INNRLQHPKMNLCRLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNISPKKREESVKSW  145

Query  395  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ATS  + +R  F A K LVLLVF+T V+D+  N SWKA+G
Sbjct  146  ATSCFKLLRILFFAAKILVLLVFYTQVNDENKNSSWKALG  185



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   267 bits (682),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 184/254 (72%), Gaps = 18/254 (7%)
 Frame = +3

Query  513   GYCGPDP----------SISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNR  662
             GYCGPDP          ++ +  +  +    ++   E LFGPLYKGI++L+ P++ VF +
Sbjct  197   GYCGPDPDFKRQTQRIKTLKQMFESAEDQKQDEASAEELFGPLYKGIVNLDRPKQFVFEK  256

Query  663   LTKLGCSV--------AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEK  818
             L   G SV        AK K   PSF I+CDAVVVGSG GGGV++G+LA AGYK LVLEK
Sbjct  257   LQNAGFSVSASSHLKNAKSKYNRPSFRIKCDAVVVGSGSGGGVVAGILAKAGYKTLVLEK  316

Query  819   GNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYV  998
             GNY+ARTNLSLLEG +MD+M+LG G + T+ +D++ LAGSTVGGGSAVNWS+SI+TPP+V
Sbjct  317   GNYFARTNLSLLEGSTMDQMYLGSGFMATEKMDVIFLAGSTVGGGSAVNWSSSIRTPPHV  376

Query  999   LREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIP  1178
             ++EW E + LELF S +Y +A+D VC KMGVQ E E+E F NMVLRKGC EL YPV  IP
Sbjct  377   IKEWSESYELELFDSKLYEEALDAVCQKMGVQSEIENEGFNNMVLRKGCEELGYPVNTIP  436

Query  1179  QNAPSDHYCGWCTF  1220
             +NA +DHYCGWC F
Sbjct  437   RNATADHYCGWCCF  450


 Score =   148 bits (374),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 111/164 (68%), Gaps = 1/164 (1%)
 Frame = +2

Query  41   NTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  220
            N  + +LS  QME+L ALC+T+LP+I+       D S   F+QTSA+  GTP ++  +I+
Sbjct  41   NPYSSSLSSRQMESLKALCDTYLPSID-GFHTKHDESTARFYQTSASVAGTPQRLGGLIS  99

Query  221  QRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  400
            +R++HPKL    L LWFLST IGT  +CG  SLS  FP+L +F ++S +KRE+IV SW+ 
Sbjct  100  ERLQHPKLFMARLALWFLSTSIGTFAMCGIASLSGNFPYLQKFSQVSPEKREQIVLSWSR  159

Query  401  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            S +  +R  FTA+K L+LLVFF+ VDDK +N SWKAIG     P
Sbjct  160  SIIFPLRLLFTALKVLILLVFFSQVDDKEENLSWKAIGYCGPDP  203



>ref|XP_011072398.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Sesamum 
indicum]
Length=761

 Score =   260 bits (664),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 182/254 (72%), Gaps = 18/254 (7%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdhe-----------ddieeLLFGPLYKGIIDLNLPEEHVFN  659
             GYCGPDP  ++ ++    +  +              +E LFG LYKGII+L+ P E   +
Sbjct  163   GYCGPDPGCTKTRRLNAENTQQPPEECEEKLADGASKEELFGSLYKGIINLSQPREDPLS  222

Query  660   RLTKLGCSVAKP-------KPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEK  818
             +L  LG SV+ P       K   PSF+++CDAVVVGSG GGGV++GVLA AG+KVLVLEK
Sbjct  223   KLQNLGFSVSIPHSRNRRMKSLNPSFIVKCDAVVVGSGSGGGVMAGVLANAGHKVLVLEK  282

Query  819   GNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYV  998
             G+Y+AR NLSLLEG +MD+M+LG G+  T +LD++LLAGSTVGGGS +NWSASI TPP+V
Sbjct  283   GSYFARANLSLLEGEAMDQMYLGKGMATTDNLDVLLLAGSTVGGGSTINWSASIHTPPHV  342

Query  999   LREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIP  1178
             +REW E H L+LF S VY +A+D VC KMGVQ E E E F NM+LRKGC +L YPV  +P
Sbjct  343   IREWSEKHKLKLFESKVYQQALDVVCQKMGVQSEVEHEGFNNMILRKGCEKLGYPVETVP  402

Query  1179  QNAPSDHYCGWCTF  1220
             +NAPSDHYCGWC F
Sbjct  403   RNAPSDHYCGWCCF  416


 Score =   145 bits (366),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 105/161 (65%), Gaps = 4/161 (2%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
            S  QME LSALC+TFLPAI+    +  P+   +    F+QTSA+  G PH V   +  ++
Sbjct  9    SCGQMEALSALCDTFLPAIDVDNYDVGPQLHSSLHRQFYQTSASMAGIPHHVGEFLGGKV  68

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
            +HPK+    L +  LSTRIG+L+LCG+ SLS +FP+   F ++S ++RE I+ SW+TSS 
Sbjct  69   EHPKMCLARLAIMLLSTRIGSLILCGRKSLSPKFPYFQTFSKVSCERREEILLSWSTSSF  128

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
              +R  FTA+K   LL+FFT V++KG+N SWKAIG     P
Sbjct  129  LLLRILFTALKIFTLLLFFTQVNEKGENLSWKAIGYCGPDP  169



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score =   245 bits (625),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 166/215 (77%), Gaps = 7/215 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPK-----PPGPSFVIECDAvvvgsgc  755
             LFGPL +GII+L+ P++ V + L+  G   SV   +        PS  I CDAVV+GSG 
Sbjct  242   LFGPLNRGIINLDKPKDLVVDALSTFGIPASVLHSEKTVNCSSNPSLTIRCDAVVIGSGS  301

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLATAGYKV+V+EKGNY+AR NL+LLEGP+MD+M+L GGL+ T D+ + +LAG
Sbjct  302   GGGVVAGVLATAGYKVVVIEKGNYHARKNLTLLEGPAMDQMYLSGGLIATDDMGVFVLAG  361

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGSA+NWSASI+TP +V++EWC  H LELF S +Y +A+D VC KMGVQ + ++E 
Sbjct  362   STVGGGSAINWSASIRTPQHVIKEWCNDHELELFDSKLYQEALDVVCEKMGVQSQIQEEG  421

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             F N +LRKGC+EL YPV NIP+N+P +HYCGWC F
Sbjct  422   FNNAILRKGCQELGYPVNNIPRNSPPNHYCGWCCF  456


 Score =   154 bits (390),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 121/170 (71%), Gaps = 1/170 (1%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            +LS  +ME+L+ALC+TFLP+I+ +   TT+AS+  F++TSA+  GTP +V  +I++RMKH
Sbjct  51   SLSSREMESLTALCDTFLPSIDVS-DTTTNASLVAFYRTSASMAGTPQRVGGLISERMKH  109

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
            PKL  + L LWFLST IG+ +LCG+ SLS+QFP+   FP++SQ+KRE I+ SW+ S    
Sbjct  110  PKLWLMRLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEILLSWSLSYFYL  169

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRPFHF*KTKETEA  565
            +R  F +MK L LLVFFT V++K +N SWKAI      P    KTK+ +A
Sbjct  170  LRMLFKSMKLLTLLVFFTQVNEKNENLSWKAIDYTGPDPEFITKTKKFKA  219



>ref|XP_006359947.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=702

 Score =   269 bits (688),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 188/244 (77%), Gaps = 11/244 (5%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAK  692
             GY GPDP   +++++  + + +DD     FGPLY+GII L   ++ +F+RL +LG SV+K
Sbjct  111   GYSGPDPDFKKQKQENMNSNEKDDQP---FGPLYEGIISLKNSQKIIFHRLQELGFSVSK  167

Query  693   P--------KPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLS  848
             P            P+F+IECDAVVVGSG GGGVI+G+LA AG+KVLVLEKG+Y ARTNLS
Sbjct  168   PHNFKNARRSTECPAFIIECDAVVVGSGSGGGVIAGILANAGHKVLVLEKGSYLARTNLS  227

Query  849   LLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGL  1028
             LLEG SMD+M+LG GLL T+D+D++LLAGSTVGGGS +NWSASI+TP +VL+EW E + L
Sbjct  228   LLEGTSMDQMYLGSGLLTTQDMDIMLLAGSTVGGGSTINWSASIQTPQHVLKEWSESYNL  287

Query  1029  ELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCG  1208
             ELF S++Y +AM  VC KMGVQ E EDE FQNM+LRKGC+EL YPV  IP NAPSDHYCG
Sbjct  288   ELFESELYKEAMKIVCEKMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSDHYCG  347

Query  1209  WCTF  1220
             WC+ 
Sbjct  348   WCSM  351


 Score =   128 bits (321),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +2

Query  185  TGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  364
             GTP  +AW+IN R++HPK+N   L LW LSTRIGT +LCGK SLSTQFP+L  F  IS 
Sbjct  2    NGTPQHIAWMINNRLQHPKMNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNISP  61

Query  365  KKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            KKRE  V SWATS  + +R  F A K LVLLVF+T V+D+  N SWKA+G
Sbjct  62   KKREESVKSWATSCFKLLRILFFAAKILVLLVFYTQVNDESQNSSWKALG  111



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score =   248 bits (633),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 166/213 (78%), Gaps = 7/213 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgc  755
             + GPLY+G+++LN P + + + L + G  V+   P         PS VI+CDAVVVGSG 
Sbjct  250   VIGPLYEGLVNLNYPRDIISDSLRRFGFPVSVTPPTNKASTISSPSLVIQCDAVVVGSGS  309

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLA +GYKVLVLEKG+Y+AR NLSLLEGP++D+M+L  GL+ T D+ +++LAG
Sbjct  310   GGGVVAGVLAKSGYKVLVLEKGSYFARNNLSLLEGPTLDQMYLANGLIATDDMSVLVLAG  369

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGSA+NWSASIKTP +V +EWC+ H LELF S++Y +AMD VC KMGVQ E E+E 
Sbjct  370   STVGGGSAINWSASIKTPSHVCKEWCDRHELELFESELYKEAMDAVCEKMGVQSEFEEEG  429

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             F N +LRKGC+E+ YPV NIP+NAP DHYCGWC
Sbjct  430   FNNAILRKGCQEMGYPVSNIPRNAPPDHYCGWC  462


 Score =   144 bits (364),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEA-LPETTDASVTNFFQTSAASTGTPHQVAWVINQRMK  232
            +LSP+QM++L ALC+T LP+I +  +  ++D  + NF++TSA+  GTP  VA ++++++K
Sbjct  59   SLSPTQMKSLVALCDTMLPSIKDNNVAASSDEFLNNFYRTSASMAGTPELVANLVSEKLK  118

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  412
            HP    L L LW LST  GTL+LCG  S+ST+FPF   +P++S +KR++++ SW+ S L+
Sbjct  119  HPSTWLLKLTLWLLSTWFGTLILCGIASISTKFPFFHSYPKLSPEKRQKVMLSWSVSYLR  178

Query  413  FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +R  F  +K L LLVFFT VD++ +NPSWKAIG
Sbjct  179  PLRMLFRTIKLLTLLVFFTQVDEEKNNPSWKAIG  212



>ref|XP_012072679.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Jatropha curcas]
Length=760

 Score =   245 bits (626),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 173/236 (73%), Gaps = 3/236 (1%)
 Frame = +3

Query  516   YCGPDPSISekqkkqkh-hdheddieeLLFGPLYKGIIDLNLPEEHVFN--RLTKLGCSV  686
             Y GPDP   ++Q+       + ++ +E LFGPLYKG+ID+NLP +   N  RL+      
Sbjct  184   YPGPDPEFKKEQEAALKLVKNNEEEKEKLFGPLYKGLIDMNLPRDITANSLRLSGFPVFT  243

Query  687   AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPS  866
              +PK   PS VI+CDAVVVGSG GG V++GVLA AGYKV+V+EKGNY+AR+NLSLLEGPS
Sbjct  244   YRPKINNPSLVIKCDAVVVGSGSGGSVVAGVLAKAGYKVVVIEKGNYFARSNLSLLEGPS  303

Query  867   MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1046
             MD+M+L  GL+ T D+ +V+LAGSTVGGGS +NWSASI+TP +V  EW   +GLE+F S 
Sbjct  304   MDQMYLSAGLMATDDMGVVVLAGSTVGGGSTINWSASIRTPQHVTDEWSNAYGLEIFDSK  363

Query  1047  VYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             +Y +A+D VC KMGVQ E  +E F N +LRKGC EL Y V  IP+N+ SDHYCGWC
Sbjct  364   LYKEALDVVCEKMGVQSEINEEGFNNAILRKGCEELGYNVNTIPRNSSSDHYCGWC  419


 Score =   145 bits (367),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 109/154 (71%), Gaps = 3/154 (2%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEALPETT--DASVTNFFQTSAASTGTPHQVAWVINQRM  229
            +LS  +ME+LSALC+TFLP+ N+ +  +   D S+  FF +SA+  GTP ++  +I+QR+
Sbjct  30   SLSFPEMESLSALCDTFLPS-NDVVSSSAAADDSIAKFFLSSASMAGTPQRIGGLISQRL  88

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
            KHPK   + ++LW LSTR+GT +LCG  S+ST FPF L+F +I   KRE+I+HSW+ S  
Sbjct  89   KHPKKWLIRVVLWMLSTRVGTFILCGLLSISTHFPFFLKFSQIHLHKREKILHSWSLSFF  148

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
              +R  F  +K L LLVFF+ VD+KG+N +WKA+
Sbjct  149  SLLRMLFKTVKLLCLLVFFSQVDEKGENLAWKAM  182



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score =   246 bits (627),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 174/236 (74%), Gaps = 3/236 (1%)
 Frame = +3

Query  516   YCGPDPSISekqkkqkh-hdheddieeLLFGPLYKGIIDLNLPEEHVFN--RLTKLGCSV  686
             Y GPDP   ++Q+       + ++ +E LFGPLYKG+ID+NLP +   N  RL+      
Sbjct  184   YPGPDPEFKKEQEAALKLVKNNEEEKEKLFGPLYKGLIDMNLPRDITANSLRLSGFPVFT  243

Query  687   AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPS  866
              +PK   PS VI+CDAVVVGSG GGGV++GVLA AGYKV+V+EKGNY+AR+NLSLLEGPS
Sbjct  244   YRPKINNPSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVVVIEKGNYFARSNLSLLEGPS  303

Query  867   MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1046
             MD+M+L  GL+ T D+ +V+LAGSTVGGGS +NWSASI+TP +V  EW   +GLE+F S 
Sbjct  304   MDQMYLSAGLMATDDMGVVVLAGSTVGGGSTINWSASIRTPQHVTDEWSNAYGLEIFDSK  363

Query  1047  VYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             +Y +A+D VC KMGVQ E  +E F N +LRKGC EL Y V  IP+N+ SDHYCGWC
Sbjct  364   LYKEALDVVCEKMGVQSEINEEGFNNAILRKGCEELGYNVNTIPRNSSSDHYCGWC  419


 Score =   145 bits (366),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 109/154 (71%), Gaps = 3/154 (2%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEALPETT--DASVTNFFQTSAASTGTPHQVAWVINQRM  229
            +LS  +ME+LSALC+TFLP+ N+ +  +   D S+  FF +SA+  GTP ++  +I+QR+
Sbjct  30   SLSFPEMESLSALCDTFLPS-NDVVSSSAAADDSIAKFFLSSASMAGTPQRIGGLISQRL  88

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
            KHPK   + ++LW LSTR+GT +LCG  S+ST FPF L+F +I   KRE+I+HSW+ S  
Sbjct  89   KHPKKWLIRVVLWMLSTRVGTFILCGLLSISTHFPFFLKFSQIHLHKREKILHSWSLSFF  148

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
              +R  F  +K L LLVFF+ VD+KG+N +WKA+
Sbjct  149  SLLRMLFKTVKLLCLLVFFSQVDEKGENLAWKAM  182



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score =   241 bits (616),  Expect(2) = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 176/250 (70%), Gaps = 16/250 (6%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqk--------hhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLT  668
             GYCGPDP    + K             D ED+  E + GPLYKG++ LN P +   + L 
Sbjct  211   GYCGPDPEFKARLKSHFLDGTSKGGQEDKEDEDAEEVIGPLYKGLVHLNYPRDITADALK  270

Query  669   KLG--CSVAKPKPPG------PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGN  824
             +LG   SV + K         PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG 
Sbjct  271   RLGFPVSVIRQKHKAAANLSSPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGG  330

Query  825   YYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLR  1004
             Y AR NLSLLEGP+MD+M+L GGL+ + D+ + +L+GSTVGGGSA+NWSA IKTP +V +
Sbjct  331   YSARNNLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIKTPQHVCK  390

Query  1005  EWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQN  1184
             EW + HGLELF S++Y +A++ VC KM VQ E EDE F N +LRKGC+E+ YPV NIP+N
Sbjct  391   EWSDKHGLELFESELYREALNAVCEKMEVQSEIEDEGFNNAILRKGCQEMGYPVSNIPRN  450

Query  1185  APSDHYCGWC  1214
             + SDHYCGWC
Sbjct  451   SASDHYCGWC  460


 Score =   148 bits (373),  Expect(2) = 8e-99, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 109/161 (68%), Gaps = 1/161 (1%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
            T TLSP QM++L ALC+T LP+++  + +T+D SVT F+Q SA+ TGTP +   +I++++
Sbjct  58   TNTLSPRQMKSLYALCDTILPSVDHFV-DTSDESVTKFYQISASMTGTPERFGCMISEKL  116

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
            KHP    L  +LW LST  GTL+ CG G  STQFPF+  +P++  +KR++I+ SW+ S L
Sbjct  117  KHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPDLPLQKRQQIMRSWSLSYL  176

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +  R  F  +K L LL+FFT +D+  DN +WKAIG     P
Sbjct  177  RHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDP  217



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score =   240 bits (613),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 176/250 (70%), Gaps = 16/250 (6%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqk--------hhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLT  668
             GYCGPDP    + K             D ED+  E + GPLYKG++ LN P +   + L 
Sbjct  211   GYCGPDPEFKARLKSHFLDGTSKGGQEDKEDEDAEEVIGPLYKGLVHLNYPRDITADALK  270

Query  669   KLG--CSVAKPKPPG------PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGN  824
             +LG   SV + K         PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG 
Sbjct  271   RLGFPVSVIRQKHKAAANLSSPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGG  330

Query  825   YYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLR  1004
             Y AR NLSLLEGP+MD+M+L GGL+ + D+ + +L+GSTVGGGSA+NWSA IKTP +V +
Sbjct  331   YSARNNLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIKTPQHVCK  390

Query  1005  EWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQN  1184
             EW + HGLELF S++Y +A++ VC KM VQ E EDE F N +LRKGC+E+ YPV NIP+N
Sbjct  391   EWSDKHGLELFESELYREALNAVCEKMEVQSEIEDEGFNNAILRKGCQEMGYPVSNIPRN  450

Query  1185  APSDHYCGWC  1214
             + +DHYCGWC
Sbjct  451   SAADHYCGWC  460


 Score =   148 bits (373),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 109/161 (68%), Gaps = 1/161 (1%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
            T TLSP QM++L ALC+T LP+++  + +T+D SVT F+Q SA+ TGTP +   +I++++
Sbjct  58   TNTLSPRQMKSLYALCDTILPSVDHFV-DTSDESVTKFYQISASMTGTPERFGCMISEKL  116

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
            KHP    L  +LW LST  GTL+ CG G  STQFPF+  +P++  +KR++I+ SW+ S L
Sbjct  117  KHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPDLPLQKRQQIMRSWSLSYL  176

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +  R  F  +K L LL+FFT +D+  DN +WKAIG     P
Sbjct  177  RHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDP  217



>ref|XP_012072678.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Jatropha curcas]
Length=725

 Score =   245 bits (626),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 174/236 (74%), Gaps = 3/236 (1%)
 Frame = +3

Query  516   YCGPDPSISekqkkqkh-hdheddieeLLFGPLYKGIIDLNLPEEHVFN--RLTKLGCSV  686
             Y GPDP   ++Q+       + ++ +E LFGPLYKG+ID+NLP +   N  RL+      
Sbjct  149   YPGPDPEFKKEQEAALKLVKNNEEEKEKLFGPLYKGLIDMNLPRDITANSLRLSGFPVFT  208

Query  687   AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPS  866
              +PK   PS VI+CDAVVVGSG GGGV++GVLA AGYKV+V+EKGNY+AR+NLSLLEGPS
Sbjct  209   YRPKINNPSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVVVIEKGNYFARSNLSLLEGPS  268

Query  867   MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1046
             MD+M+L  GL+ T D+ +V+LAGSTVGGGS +NWSASI+TP +V  EW   +GLE+F S 
Sbjct  269   MDQMYLSAGLMATDDMGVVVLAGSTVGGGSTINWSASIRTPQHVTDEWSNAYGLEIFDSK  328

Query  1047  VYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             +Y +A+D VC KMGVQ E  +E F N +LRKGC EL Y V  IP+N+ SDHYCGWC
Sbjct  329   LYKEALDVVCEKMGVQSEINEEGFNNAILRKGCEELGYNVNTIPRNSSSDHYCGWC  384


 Score =   143 bits (360),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 105/148 (71%), Gaps = 3/148 (2%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPETT--DASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  247
            ME+LSALC+TFLP+ N+ +  +   D S+  FF +SA+  GTP ++  +I+QR+KHPK  
Sbjct  1    MESLSALCDTFLPS-NDVVSSSAAADDSIAKFFLSSASMAGTPQRIGGLISQRLKHPKKW  59

Query  248  slllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  427
             + ++LW LSTR+GT +LCG  S+ST FPF L+F +I   KRE+I+HSW+ S    +R  
Sbjct  60   LIRVVLWMLSTRVGTFILCGLLSISTHFPFFLKFSQIHLHKREKILHSWSLSFFSLLRML  119

Query  428  FTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            F  +K L LLVFF+ VD+KG+N +WKA+
Sbjct  120  FKTVKLLCLLVFFSQVDEKGENLAWKAM  147



>ref|XP_011078909.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Sesamum indicum]
Length=755

 Score =   262 bits (670),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 182/249 (73%), Gaps = 13/249 (5%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkh------hdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKL  674
             GYCGPDP  ++ +  +           +   ++ LFGPLYKGII+L+   E   ++L  L
Sbjct  163   GYCGPDPGCAKTRILKTSGPQECEEKEDGASQDELFGPLYKGIINLDQSREEALHKLQSL  222

Query  675   GCSVAKPKPPG-------PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYA  833
             G  V+ P           PSF+++CDAVVVGSG GGGV++GVLA AG+KVLVLEKG+Y+A
Sbjct  223   GFPVSTPHSRNRRLMSLNPSFIVKCDAVVVGSGSGGGVVAGVLANAGHKVLVLEKGSYFA  282

Query  834   RTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWC  1013
             RTNLSLLEG +MD+M+LG G+L+T +LD++++AGSTVGGGS +NWSASI+TP +V+REW 
Sbjct  283   RTNLSLLEGEAMDQMYLGNGMLVTDNLDVLIVAGSTVGGGSTINWSASIRTPSHVMREWS  342

Query  1014  EVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPS  1193
             E H LELFGS+VY +A+D VC KMGVQ E E E F NM+LRKGC  L YPV  +P NAPS
Sbjct  343   EKHELELFGSEVYQQALDVVCQKMGVQSEVEHEGFNNMILRKGCENLGYPVETVPCNAPS  402

Query  1194  DHYCGWCTF  1220
             DHYCGWC F
Sbjct  403   DHYCGWCCF  411


 Score =   123 bits (308),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 103/162 (64%), Gaps = 11/162 (7%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASV-----TNFFQTSAASTGTPHQVAWVINQR  226
            S  QME LSALC+T LP+++       D  +       F+QTSA+ T TPH VA ++  +
Sbjct  14   SCGQMEALSALCDTLLPSVD------VDGQLHPSFHRQFYQTSASMTATPHHVAELLGGK  67

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
            ++HPK+    L +  LSTRIGT +LCG+ SL  +FP+   F E+  ++RE+I+ SW+TS+
Sbjct  68   IEHPKIYLGRLAVGLLSTRIGTFVLCGRKSLCPKFPYFQTFSEVPYEEREQILRSWSTSN  127

Query  407  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
               +R  FTA+K   LL+FFT V++KG+N SWKAIG     P
Sbjct  128  FLLLRILFTALKFFTLLLFFTQVNEKGENLSWKAIGYCGPDP  169



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score =   238 bits (607),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 164/215 (76%), Gaps = 7/215 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPK-----PPGPSFVIECDAvvvgsgc  755
             LFGPL + II+L+ P++ V + L+  G   SV   +     P  PS  I CDAVV+GSG 
Sbjct  186   LFGPLNRCIINLDKPKDLVVDALSTFGIPASVLHSEKTVNCPSNPSLTIRCDAVVIGSGS  245

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLA AGYKV+V+EKGNY+AR NL+LLEGP+MD+M+L GGL+ T D+ + +LAG
Sbjct  246   GGGVVAGVLAKAGYKVVVIEKGNYHARKNLTLLEGPAMDQMYLSGGLIATDDMGVFVLAG  305

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGSA+NWSASI+TP +V++EWC  H LELF S +Y +A+D V  KMGVQ + ++E 
Sbjct  306   STVGGGSAINWSASIRTPQHVIKEWCNDHELELFDSKLYQEALDVVSEKMGVQSQVQEEG  365

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             F N +LRKGC+EL YPV NIP+N+P +HYCGWC F
Sbjct  366   FNNEILRKGCQELGYPVNNIPRNSPPNHYCGWCCF  400


 Score =   146 bits (369),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 115/164 (70%), Gaps = 1/164 (1%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  253
            ME+L+ALC+TFLP+I+ +   TT+AS+  F++TSA+  GTP +V  +I++R+KHPKL  +
Sbjct  1    MESLTALCDTFLPSIDVS-DATTNASLVAFYRTSASMAGTPQRVGGLISERLKHPKLWLM  59

Query  254  llllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  433
             L LWFLST IG+ +LCG+ SLS+QFP+   FP++SQ+KRE I+ SW+ S    +R  F 
Sbjct  60   RLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEILLSWSLSYFYLLRMLFK  119

Query  434  AMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRPFHF*KTKETEA  565
             MK L  LVFFT V++K +N SWKAI      P    KTK+ +A
Sbjct  120  TMKLLTFLVFFTQVNEKNENLSWKAIDYTGPDPEFITKTKKFKA  163



>ref|XP_006359948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=707

 Score =   257 bits (657),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 168/215 (78%), Gaps = 8/215 (4%)
 Frame = +3

Query  600   FGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSFVIECDAvvvgsgc  755
             FGPLY+GII L   ++  F+RL KLG SV+KP            P+F IE D VVVGSG 
Sbjct  142   FGPLYEGIISLKNSQKITFDRLKKLGFSVSKPHNFKNAKRSTECPAFTIESDVVVVGSGS  201

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGVI+G+LA AG+KVLVLEKG+Y AR+NLSLLEG SMD+M+LG G++ TKD+D++LLAG
Sbjct  202   GGGVIAGILANAGHKVLVLEKGSYLARSNLSLLEGTSMDQMYLGSGIVATKDMDIILLAG  261

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASI+TP +VL+EW E + L+LF S++Y +A+  VC KMGVQ E EDE 
Sbjct  262   STVGGGSTINWSASIQTPQHVLKEWSESYNLKLFESELYKEALRIVCEKMGVQSEIEDEG  321

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             FQNM+LRKGC+EL YPV  IP NAPSDHYCGWC+ 
Sbjct  322   FQNMILRKGCQELGYPVETIPTNAPSDHYCGWCSM  356


 Score =   127 bits (318),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            Q+AW+I+ R++HP+LN   L LW LSTRIGT +LCGK SLSTQFP+L  F  IS KKRE 
Sbjct  12   QMAWMISNRLQHPRLNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQNFSNISPKKREE  71

Query  380  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVL  520
            IV SWATS  + +R  + AMK LVLLVFFT V+++  NPSWKA+G +
Sbjct  72   IVKSWATSCFKLLRILYFAMKVLVLLVFFTQVNEESQNPSWKALGYI  118



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score =   241 bits (616),  Expect(2) = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 177/252 (70%), Gaps = 18/252 (7%)
 Frame = +3

Query  513   GYCGPDPSISekqkk-----qkhhdheddieeLLFGPLYKGIIDL-NLPEEHVFNRLTKL  674
             GYCGPDP    ++ +     QK  +    IEE LFGPL+KGII+  + P E    +L   
Sbjct  165   GYCGPDPDFKTRKPQYQECEQKEENDHKSIEEDLFGPLHKGIINFSHQPIEKSLRKLRDS  224

Query  675   GCSVAKPKPP------------GPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEK  818
             G + A    P             PSFV++CDAV+VGSG GGGV++GVLA AG+KV+VLEK
Sbjct  225   GFTTAVVSKPYSEKNTSVGSLLNPSFVLKCDAVIVGSGSGGGVVAGVLAKAGHKVVVLEK  284

Query  819   GNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYV  998
             G+Y AR+NLSLLEG ++D+M+LG G++ + ++D++ LAGSTVGGGSAVNWSAS +TP +V
Sbjct  285   GSYLARSNLSLLEGEALDQMYLGNGIVASDNMDVLFLAGSTVGGGSAVNWSASFRTPSHV  344

Query  999   LREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIP  1178
              +EW E HGLELFGS  Y  A+D VC KMGVQ E +DE F NMVLRKGC  L Y V NIP
Sbjct  345   TKEWSEKHGLELFGSKNYENALDVVCEKMGVQSEFDDEGFNNMVLRKGCEGLGYQVGNIP  404

Query  1179  QNAPSDHYCGWC  1214
             +NAPSDHYCGWC
Sbjct  405   RNAPSDHYCGWC  416


 Score =   142 bits (357),  Expect(2) = 6e-97, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 103/173 (60%), Gaps = 9/173 (5%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAINEA-----LPETTDASVTNFFQTSAASTGT  193
            K    T     S   ME L+ALC+TFLPAI+ +     LP+    SV NF+QTSA+ + T
Sbjct  3    KSNKTTYKNAFSKRDMEALTALCDTFLPAIDVSDHDPHLPQ----SVANFYQTSASMSET  58

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
            P  VA  I +++KHPK+    + +  LST IGT +LCG+ SLS  FP+L RF  +   KR
Sbjct  59   PPLVAEFIAEKVKHPKILLAKVAVKMLSTWIGTFILCGRKSLSDDFPYLQRFSRVESLKR  118

Query  374  ERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            E I+ SW+ S    +R  F+A+K  +L  FFT VD+K DN SWKAIG     P
Sbjct  119  EEILLSWSNSCFSLLRILFSALKIFILFTFFTQVDEKEDNISWKAIGYCGPDP  171



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score =   249 bits (636),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 178/251 (71%), Gaps = 17/251 (7%)
 Frame = +3

Query  513   GYCGPDPSISekqk---------kqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRL  665
             GYCGPDP    + K         +++  +  D+  EL  GPLYKG++ LN P + + + L
Sbjct  249   GYCGPDPEFKAQLKNHFLHGACKEKQDSEEGDNDAELAIGPLYKGLVHLNYPRDIIVDTL  308

Query  666   TKLGCSVA--------KPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKG  821
              + G  V+         P    PS V++CDAVVVGSG GGGV++G+LA AGYKVLVLEKG
Sbjct  309   RRFGFPVSVSRRKQKTAPSLSSPSLVVQCDAVVVGSGSGGGVVAGILANAGYKVLVLEKG  368

Query  822   NYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVL  1001
              Y AR NLSLLEGP+MD+M+  GGL+ T D+++ +L+GSTVGGGSA+NWSA IKTP +V 
Sbjct  369   GYSARNNLSLLEGPTMDQMYQAGGLVATDDMNIFILSGSTVGGGSAINWSACIKTPQHVC  428

Query  1002  REWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQ  1181
             +EWCE HGLELF S++Y +AM+ VC KMGVQ E E+E F N +LRKGC+E+ YPV NIP+
Sbjct  429   KEWCEKHGLELFESELYQEAMEAVCEKMGVQSEIEEEGFNNAILRKGCQEMGYPVNNIPR  488

Query  1182  NAPSDHYCGWC  1214
             NA  DHYCGWC
Sbjct  489   NASPDHYCGWC  499


 Score =   130 bits (328),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 112/191 (59%), Gaps = 23/191 (12%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAINEALP-ETTDASVTNFFQTSAASTGTPHQV  205
            + +  T   +LS  QM++L+ALC+T LP+IN+ +P    D S   F++ SA+  GTP ++
Sbjct  65   REKQKTLKNSLSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERL  124

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
              +I++R+ HP    L L+LWFLST +GT++LCG G LST+FPF+  FP++   KR++I+
Sbjct  125  GGIISERLIHPMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQIM  184

Query  386  HSWATSSLQFIRNFFTAMKALVLLVFFT----------------------SVDDKGDNPS  499
             SW+ S  + +R FF  +K L LL+FFT                       VD+  DN S
Sbjct  185  QSWSLSFFRHLRMFFRTIKLLTLLIFFTQYKILFLLGNDLLYSSLHYTYFQVDESEDNCS  244

Query  500  WKAIGVLWSRP  532
            WKAIG     P
Sbjct  245  WKAIGYCGPDP  255



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score =   249 bits (637),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 178/247 (72%), Gaps = 11/247 (4%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAK  692
             GY GPDP+  ++Q +          +E LFGPLY+G++DLNLP + V + L ++G  V+ 
Sbjct  153   GYPGPDPAALKRQTQTCGLPETLYAKEHLFGPLYRGLVDLNLPRDRVADSLRQIGFPVSI  212

Query  693   PK-----------PPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYART  839
              +              PS VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKGNY+AR 
Sbjct  213   RRGKDIDSSRDFSTSNPSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARN  272

Query  840   NLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEV  1019
             NLSLLEGPSMD+M+LG G+L + D+ +V+LAGSTVGGGS +NWSASIKTP +V+ EW E 
Sbjct  273   NLSLLEGPSMDQMYLGAGMLASDDMGVVVLAGSTVGGGSTINWSASIKTPQHVINEWSET  332

Query  1020  HGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDH  1199
             + LELF S +Y +A+D VC KMGVQ + ++E F + VLR+GC EL YPV  IP+N+  DH
Sbjct  333   YDLELFDSKLYKEALDAVCEKMGVQSDIDEEGFNSAVLRRGCEELGYPVNTIPRNSVPDH  392

Query  1200  YCGWCTF  1220
             YCGWC F
Sbjct  393   YCGWCCF  399


 Score =   129 bits (325),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 101/153 (66%), Gaps = 6/153 (4%)
 Frame = +2

Query  74   METLSALCNTFLPAINEA--LPETTDASVTN----FFQTSAASTGTPHQVAWVINQRMKH  235
            ME+L+A+C+T  P++  +  +  + D   TN    F+Q+SA+  GTP +V  +   R++H
Sbjct  1    MESLTAICDTLFPSVYNSSMMAASADDGSTNSISTFYQSSASMAGTPQRVGELFCDRVQH  60

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
            PK   + L L+ LST IGT +LCG  S+S  FP+ LRF +ISQ KRE+IV SWATS    
Sbjct  61   PKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFLRFSQISQSKREQIVFSWATSFFYL  120

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +R  F ++K ++ LVFF+ VD+K +N +WKAIG
Sbjct  121  LRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIG  153



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score =   246 bits (627),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 167/219 (76%), Gaps = 11/219 (5%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPK---------PPGPSFVIECDAvvv  743
             LFGPLY+G++DLNLP + V + L ++G   S+ + K            PS VI+CDAVVV
Sbjct  239   LFGPLYRGLVDLNLPRDRVADSLRQIGFPVSILRGKNIDSSRDFSTSNPSLVIKCDAVVV  298

Query  744   gsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  923
             GSG GGGV++GVLA AGYKVLVLEKGNY+AR NLSLLEGPSMD+M+LGGG+L + D+ +V
Sbjct  299   GSGSGGGVVAGVLAKAGYKVLVLEKGNYFARNNLSLLEGPSMDQMYLGGGMLASDDMGVV  358

Query  924   LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQREC  1103
             +LAGSTVGGGS +NWSASIKTP +V+ EW E + LELF S +Y +A+D VC KMGVQ + 
Sbjct  359   ILAGSTVGGGSTINWSASIKTPQHVINEWSESYDLELFDSKLYKEALDAVCEKMGVQSDI  418

Query  1104  EDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             ++E F + VLR+GC EL YPV  IP+N+  DHYCGWC F
Sbjct  419   DEEGFNSAVLRRGCEELGYPVNTIPRNSVPDHYCGWCCF  457


 Score =   132 bits (332),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 110/171 (64%), Gaps = 6/171 (4%)
 Frame = +2

Query  20   LHRKMENNTATKTLSPSQMETLSALCNTFLPA------INEALPETTDASVTNFFQTSAA  181
            L  + ++ +   +LS  +ME+L+ALC+T  P+      I  +  + +  S++ F+Q+SA+
Sbjct  28   LGGEKQSCSYVNSLSSREMESLTALCDTLFPSVYNSSMIAASADDGSTNSISTFYQSSAS  87

Query  182  STGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEIS  361
              GTP +V  +  +R++HPK   + L L+ LST IGT +LCG  S+S  FP+  RF +IS
Sbjct  88   MAGTPQRVGELFCERVQHPKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFQRFSQIS  147

Query  362  QKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            Q KRE+IV SWATS    +R  F ++K ++ LVFF+ VD+K +N +WKAIG
Sbjct  148  QSKREQIVFSWATSFFYLLRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIG  198



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score =   243 bits (621),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 175/255 (69%), Gaps = 21/255 (8%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdheddieeL--------------LFGPLYKGIIDLNLPEEH  650
             GYCGPDP    +  + K          +               +GPL +G+I+L  P + 
Sbjct  536   GYCGPDPEFQPQASRLKTSKQNGYGNFICKEQECKEDGEKEERYGPLCRGLINLKHPRDV  595

Query  651   VFNRLTKLGCSVA-KPK---PPG---PSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  809
             V + L + G  V+ +PK   PP    PS  I+CDAV+VGSG GGGV++GVLA AGYKVLV
Sbjct  596   VADNLLRFGLPVSVRPKKINPPNLSHPSLTIKCDAVIVGSGSGGGVVAGVLAKAGYKVLV  655

Query  810   LEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTP  989
             LEKGNY+AR+NLSLLEGPSMD+M++ GG+L T D+ +V+LAGSTVGGGS +NWSASIKTP
Sbjct  656   LEKGNYFARSNLSLLEGPSMDQMYMSGGMLATDDMGVVILAGSTVGGGSTINWSASIKTP  715

Query  990   PYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVV  1169
              +V+ EWC+   LELF S +Y +AMD VC KMGVQ E  +E F N VLRKGC EL YPV 
Sbjct  716   QHVINEWCDRCKLELFDSKLYKEAMDVVCEKMGVQSEIVEEGFNNAVLRKGCEELGYPVN  775

Query  1170  NIPQNAPSDHYCGWC  1214
             +IP+N+P DHYCGWC
Sbjct  776   DIPRNSPPDHYCGWC  790


 Score =   134 bits (337),  Expect(2) = 3e-95, Method: Composition-based stats.
 Identities = 70/158 (44%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +2

Query  41   NTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  220
            N    ++S  +ME+L+A+C+ FLP+++ +       +V  F+Q+SA+   TP +V  +++
Sbjct  381  NCYVNSISSREMESLTAICDAFLPSLHVS--AADADAVATFYQSSASMAATPERVGGLLS  438

Query  221  QRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  400
            +RM+HPK   + L LW LST +GT +LCG  SLST FPF   F ++SQ+KRE I+ SW+ 
Sbjct  439  ERMEHPKKWMIRLALWLLSTWLGTFVLCGPRSLSTNFPFFHTFSQLSQQKREEILLSWSL  498

Query  401  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            S    +R  F + K L LLVFF+ VD+K  N SWKAIG
Sbjct  499  SFFYHLRMLFKSTKLLTLLVFFSQVDEKNQNLSWKAIG  536



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score =   253 bits (646),  Expect(2) = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/252 (56%), Positives = 181/252 (72%), Gaps = 18/252 (7%)
 Frame = +3

Query  513   GYCGPDPSISekqkk----------qkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNR  662
             GYCGPDP    + +           Q+  + ++D  E + GPLYKG++ LN P +   + 
Sbjct  229   GYCGPDPEFKAQLRNHFLHRTCKGGQESEEGDEDDAEQVIGPLYKGLVHLNCPRDITADA  288

Query  663   LTKLG--CSVAKPKPPG------PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEK  818
             L + G   SV + KP        PS VI+CDAVVVGSG GGG+++G+LA AGYKVLVLEK
Sbjct  289   LRRFGFPVSVTRRKPKAAANLSSPSLVIQCDAVVVGSGSGGGLVAGILAKAGYKVLVLEK  348

Query  819   GNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYV  998
             G Y AR+NLSLLEGP++D+M+  GG+L T D+ + +L+GSTVGGGSA+NWSASIKTP +V
Sbjct  349   GGYSARSNLSLLEGPTLDQMYQSGGMLATDDMSVFVLSGSTVGGGSAINWSASIKTPQHV  408

Query  999   LREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIP  1178
              +EWCE HGLELF S++Y +AMD VC KMGVQ E E+E F N +LR+GC+EL YPV  IP
Sbjct  409   CKEWCEKHGLELFESELYREAMDVVCEKMGVQSEIEEEGFNNTILRRGCQELGYPVSTIP  468

Query  1179  QNAPSDHYCGWC  1214
             +N+PSDHYCGWC
Sbjct  469   RNSPSDHYCGWC  480


 Score =   119 bits (299),  Expect(2) = 9e-94, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 99/180 (55%), Gaps = 19/180 (11%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
            T +L   QM++LS L +T LP+IN+ +    D S   F+  SA+  GTP  V  VI++R+
Sbjct  56   TNSLCRRQMKSLSVLADTILPSINDFVAIKDDESAATFYHISASMAGTPELVGGVISERL  115

Query  230  K-HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
              HP    L  +LW LST +GT++LCG    ST+FPF+  FP +   KR+RI+ SW+ S 
Sbjct  116  NYHPMTWLLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQRIMQSWSLSF  175

Query  407  LQFIRNFFTAMKALVLLVFFT------------------SVDDKGDNPSWKAIGVLWSRP  532
             + +R FF  +K L LLVFFT                   +D+  DN SWKAIG     P
Sbjct  176  FRHLRMFFKTIKLLTLLVFFTQIFLLFGTLYSSWHGTYFQIDESEDNCSWKAIGYCGPDP  235



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score =   229 bits (584),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 173/256 (68%), Gaps = 22/256 (9%)
 Frame = +3

Query  513   GYCGPDP---------------SISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEE  647
             GY GPDP               S  E+Q K++        +E  FGPL++G+I +  P +
Sbjct  209   GYAGPDPEFENSKKLKRTSCQISADEQQGKEQATAKNGYEDEAFFGPLHQGLIHMVHPRD  268

Query  648   HVFNRLTKLGCSV-------AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  806
              V   L + G  V          KP  PS  I+CDAVV+GSG GGGV++GVLA AGYKVL
Sbjct  269   IVTKSLRQFGFPVLICPSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGYKVL  328

Query  807   VLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKT  986
             VLEKG+Y AR+NLSLLEGP+MD+M+L GG++ T+D+  ++LAGSTVGGGS +NWSAS++T
Sbjct  329   VLEKGSYCARSNLSLLEGPTMDQMYLSGGVVATEDMSTLVLAGSTVGGGSTINWSASLRT  388

Query  987   PPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPV  1166
             P +V+ EW   + LELF S +Y +A+D VC +MGVQ    +E F N VLRKGC+EL YPV
Sbjct  389   PQHVMNEWSNKYDLELFDSKLYREALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPV  448

Query  1167  VNIPQNAPSDHYCGWC  1214
              NIP+N+P+DHYCGWC
Sbjct  449   SNIPRNSPADHYCGWC  464


 Score =   143 bits (361),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 109/168 (65%), Gaps = 9/168 (5%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAI-NEALPETTDAS--------VTNFFQTSAASTGTPHQVA  208
            +LSP QM+TL+ALC+TFLP+I +   P  TD+         V  F++TSA+  GTP ++ 
Sbjct  48   SLSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLG  107

Query  209  WVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  388
             +I++R+KHPKL  L L LWFLST IGT +LCG+   S+ FP++ RFPEI Q++RE IV 
Sbjct  108  GLISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREEIVR  167

Query  389  SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
             W+ S    +R F   +K L  LVFFT VD+K  N SWKAIG     P
Sbjct  168  RWSRSVFPLLRIFARTVKLLTFLVFFTQVDEKDHNVSWKAIGYAGPDP  215



>gb|KCW78402.1| hypothetical protein EUGRSUZ_D02568 [Eucalyptus grandis]
Length=758

 Score =   229 bits (583),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 173/256 (68%), Gaps = 22/256 (9%)
 Frame = +3

Query  513   GYCGPDP---------------SISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEE  647
             GY GPDP               S  E+Q K++        +E  FGPL++G+I +  P +
Sbjct  209   GYAGPDPEFENSKKLKRTSCQISADEQQGKEQATAKNGYEDEAFFGPLHQGLIHMVHPRD  268

Query  648   HVFNRLTKLGCSV-------AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVL  806
              V   L + G  V          KP  PS  I+CDAVV+GSG GGGV++GVLA AGYKVL
Sbjct  269   IVTKSLRQFGFPVLICPSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGYKVL  328

Query  807   VLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKT  986
             VLEKG+Y AR+NLSLLEGP+MD+M+L GG++ T+D+  ++LAGSTVGGGS +NWSAS++T
Sbjct  329   VLEKGSYCARSNLSLLEGPTMDQMYLSGGVVATEDMSTLVLAGSTVGGGSTINWSASLRT  388

Query  987   PPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPV  1166
             P +V+ EW   + LELF S +Y +A+D VC +MGVQ    +E F N VLRKGC+EL YPV
Sbjct  389   PQHVMNEWSNKYDLELFDSKLYREALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPV  448

Query  1167  VNIPQNAPSDHYCGWC  1214
              NIP+N+P+DHYCGWC
Sbjct  449   SNIPRNSPADHYCGWC  464


 Score =   143 bits (361),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 106/168 (63%), Gaps = 9/168 (5%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVA  208
            +LSP QM+TL+ALC+TFLP+I         +       D  V  F++TSA+  GTP ++ 
Sbjct  48   SLSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLG  107

Query  209  WVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  388
             +I++R+KHPKL  L L LWFLST IGT +LCG+   S+ FP++ RFPEI Q++RE IV 
Sbjct  108  GLISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREEIVR  167

Query  389  SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
             W+ S    +R F   +K L  LVFFT VD+K  N SWKAIG     P
Sbjct  168  RWSRSVFPLLRIFARTVKLLTFLVFFTQVDEKDHNVSWKAIGYAGPDP  215



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score =   235 bits (600),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 160/213 (75%), Gaps = 7/213 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgc  755
             +FGPLY GIIDL  P + V  +LT  G +V+ PK          P   I CDAVVVGSG 
Sbjct  199   IFGPLYNGIIDLTNPRDAVAKKLTGRGFTVSTPKSNKNGSFISDPVMTIRCDAVVVGSGS  258

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLA AGYKVLV+EKGNYYAR+NLSLLEG ++D+M+L  GLL T D+++V+LAG
Sbjct  259   GGGVVAGVLAKAGYKVLVVEKGNYYARSNLSLLEGQALDEMYLSAGLLATSDMNVVILAG  318

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASIKTP +V++EW +   LE+FGSD+Y +AMD VC +MGVQ    +E 
Sbjct  319   STVGGGSTINWSASIKTPEHVMKEWADKSKLEMFGSDLYREAMDVVCERMGVQCGFVEEG  378

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             F N +LRKGC EL   V NIP+N+PSDHYCG+C
Sbjct  379   FNNEILRKGCEELGLQVKNIPRNSPSDHYCGFC  411


 Score =   134 bits (338),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 108/156 (69%), Gaps = 1/156 (1%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEA-LPETTDASVTNFFQTSAASTGTPHQVAWVINQR  226
            T +L+  +ME+L A+C+T +P+I+ + L    D  V  ++  SA+ TGTP +VA ++++R
Sbjct  17   TNSLTAREMESLVAICDTLIPSIDGSKLGHVEDDGVARYYSASASQTGTPDRVARLMSER  76

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
            + HPK   L + LWFLST IG+L+LCG+ S S +FP+  RF ++ +K+RE I+ +W++S 
Sbjct  77   LDHPKKWILRVGLWFLSTWIGSLILCGRKSFSGEFPYFRRFCKLPEKQREEILLNWSSSY  136

Query  407  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +  IR  F ++K +  LVFFT +D++G N +WKAIG
Sbjct  137  IVLIRMLFRSLKLITALVFFTQLDEQGQNLAWKAIG  172



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score =   238 bits (607),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 158/213 (74%), Gaps = 7/213 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgc  755
             +FGPLY GI+DLN P E V  +LT  G +V+  K          P   I CDAVVVGSG 
Sbjct  207   IFGPLYNGIVDLNCPREAVTKKLTGRGFTVSSQKNKSKGSSLSNPVMTIRCDAVVVGSGS  266

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLA AGYKVLV+E GNYYAR+NLSLLEG +M+ M+L GGLL T D ++V+LAG
Sbjct  267   GGGVVAGVLAKAGYKVLVVESGNYYARSNLSLLEGQAMEDMYLSGGLLATSDTNVVILAG  326

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASIKTP +V++EW E   LE+FGSD+Y +AMD VC +MGVQ    +E 
Sbjct  327   STVGGGSTINWSASIKTPEHVMKEWTEKSKLEMFGSDLYREAMDVVCERMGVQCGFVEEG  386

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             F N +LRKGC EL  PV NIP+NAPSDHYCG C
Sbjct  387   FNNEILRKGCEELGLPVKNIPRNAPSDHYCGHC  419


 Score =   130 bits (328),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 104/167 (62%), Gaps = 4/167 (2%)
 Frame = +2

Query  26   RKMENNTA---TKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGT  193
            R+  N T      +L+  +METL A C+T +P+I+   +    D SV  +F  SA+ TGT
Sbjct  14   RRQTNETKPFYANSLTQREMETLVAFCDTLIPSIDGSGVGGHVDDSVAEYFAASASQTGT  73

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
            P +VA ++++R+ HPK   L + LW LST IG+L+LCG+ S + +FP+  RF  +  K+R
Sbjct  74   PDRVARLMSERLDHPKKWILRVALWLLSTWIGSLVLCGRRSFTGEFPYFRRFCRLPTKQR  133

Query  374  ERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            E I+ +W+ S    +R FF  +K +   VFFT VD+KG N +WKAIG
Sbjct  134  EAILLNWSESYFSLLRMFFRCIKLITAFVFFTQVDEKGRNLAWKAIG  180



>ref|XP_010676697.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =   239 bits (609),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 170/258 (66%), Gaps = 24/258 (9%)
 Frame = +3

Query  513   GYCGPDP--------------------SISekqkkqkhhdheddieeLLFGPLYKGIIDL  632
             GYCGPDP                    S       +     +   +  L+GPLYKGII +
Sbjct  199   GYCGPDPDFVSKKRNESSQSLGYITPKSYHSSPTTEVQAQAQAQSKYDLYGPLYKGIISV  258

Query  633   NLPEEHVFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  800
               P+E +   L + G  V+    K     P   I+CD VVVGSG GGGV++GVLA+AGYK
Sbjct  259   KYPQEILTESLKRCGIHVSVNRKKKNSEKPKITIQCDVVVVGSGSGGGVVAGVLASAGYK  318

Query  801   VLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASI  980
             V+V+EKG+YYARTNLSLLEG ++D M+ G G++ T+DL + +LAGSTVGGGS +NWSASI
Sbjct  319   VVVIEKGDYYARTNLSLLEGHTLDHMYEGAGMISTRDLGVNILAGSTVGGGSTINWSASI  378

Query  981   KTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCY  1160
             +TPP+V++EW  VH LE+F S +Y +A++ VC KM VQ +  DE F N VLRKGC EL Y
Sbjct  379   RTPPHVIKEWANVHELEIFDSPLYKEALEVVCEKMEVQSDVSDEGFNNAVLRKGCLELGY  438

Query  1161  PVVNIPQNAPSDHYCGWC  1214
             P+V+IP+NAP DHYCGWC
Sbjct  439   PLVDIPRNAPPDHYCGWC  456


 Score =   126 bits (317),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 107/173 (62%), Gaps = 4/173 (2%)
 Frame = +2

Query  17   SLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPE-TTDASVTNFFQTSAASTGT  193
            SL  + E    T  LS  +M++L+ALC+T LPA++   PE T D S+  F++TSA+  GT
Sbjct  36   SLLMEGEIQIYTNILSAREMDSLTALCDTILPAVDP--PENTADESLVRFYKTSASMAGT  93

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
            P  +  +I+ R++H  +  +  LL+ LSTR+GT +  G  SLS  FPF L+F E+S +KR
Sbjct  94   PEHLGRMISHRLRH-HVFLIRFLLFMLSTRLGTFVFGGIHSLSICFPFFLKFSELSLEKR  152

Query  374  ERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            + I+ S +TS     R  F  +K LVLL FFT VD+  +NPSW+AIG     P
Sbjct  153  QHILLSLSTSCFILFRMAFVGIKLLVLLAFFTQVDESEENPSWEAIGYCGPDP  205



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score =   229 bits (583),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 158/214 (74%), Gaps = 7/214 (3%)
 Frame = +3

Query  600   FGPLYKGIIDLNLPEEHVFNRLTKLGCSV-------AKPKPPGPSFVIECDAvvvgsgcg  758
             FGPLY GI++LN   E    +L K G  V       AK K   PSF+++CD VVVGSG G
Sbjct  178   FGPLYNGIVNLNQSREIALCKLEKSGFPVSIPHSNGAKIKSSDPSFIVKCDVVVVGSGSG  237

Query  759   ggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  938
             GGV++GVLA AGYKVLVLEKG Y AR+NLSLLEG ++D+M+LG G+L T ++D++LLAGS
Sbjct  238   GGVVAGVLAEAGYKVLVLEKGCYIARSNLSLLEGQTIDQMYLGNGVLGTDNMDVLLLAGS  297

Query  939   TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESF  1118
             TVGGGS +NWSASI+TPP+V ++W E H LE+F  ++Y  A+D VC KMGVQ E + E F
Sbjct  298   TVGGGSTINWSASIRTPPHVRKDWSENHKLEMFDGEIYENALDVVCEKMGVQSEFKQEGF  357

Query  1119  QNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
              + +LRKGC +L YPV +IP+NA  DH+CGWC  
Sbjct  358   NSTILRKGCEKLGYPVESIPRNAGPDHHCGWCNL  391


 Score =   135 bits (341),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 103/155 (66%), Gaps = 6/155 (4%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  253
            ME L+A+C+TFLP+I+     +       F+QTSA+ T TPH +A ++ +++KHPK+   
Sbjct  1    MEELTAVCDTFLPSIHL----SDHHRHHQFYQTSASMTQTPHHLAELLGEKIKHPKIYLS  56

Query  254  llllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  433
             L L+ LSTR+GT +LCG+ SLS +FP+L RF  +   KRE+I+ SW+ S    +R  + 
Sbjct  57   RLALFSLSTRLGTFILCGRKSLSEKFPYLQRFSRVLPHKREQILLSWSESCFSLLRILYA  116

Query  434  AMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRPFH  538
             +K   LLVFFT V+DK +N SWKAIG  ++RP H
Sbjct  117  GLKIFTLLVFFTLVNDKDENVSWKAIG--YTRPDH  149



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score =   234 bits (598),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 159/213 (75%), Gaps = 7/213 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP--PGPSF-----VIECDAvvvgsgc  755
             +FGPLY GI+DL  P E V  +LT  G +V+ PK    G S       I CDAVVVGSG 
Sbjct  216   IFGPLYNGIVDLKSPREVVTKKLTDRGFTVSTPKKIQKGSSLSNRVMTIRCDAVVVGSGS  275

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLA AGYKVLV+E GNYYAR+ LSLLEG +M++M+L GGLL T D+++V+LAG
Sbjct  276   GGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLEGQAMEEMYLSGGLLATSDMNVVVLAG  335

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASIKTP +V+ EW E   LE+FGSD Y +AMD VC +MGVQ    +E 
Sbjct  336   STVGGGSTINWSASIKTPEHVMNEWAEKSKLEMFGSDSYREAMDVVCKRMGVQCGFVEEG  395

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             F N +LRKGC EL  PV NIP+NAPSDHYCG+C
Sbjct  396   FNNEILRKGCEELGLPVKNIPRNAPSDHYCGFC  428


 Score =   129 bits (323),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 100/153 (65%), Gaps = 0/153 (0%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            +L+  +ME+L A+C+T +P+I+ +     D SV  +F  SA+ TGTP +VA +I++R+ H
Sbjct  39   SLTQREMESLVAICDTLIPSIDGSGVGHVDDSVAEYFSASASQTGTPDRVAKLISERLDH  98

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
            PK   L + LWFLST IG+ +LCG+ S + +FP+   F  +  K+RE ++ +W+ S    
Sbjct  99   PKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSASYFSL  158

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +R FF  +K +  LVFFT VD KG N +WKAIG
Sbjct  159  LRMFFKCIKLITGLVFFTQVDGKGRNLAWKAIG  191



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score =   239 bits (609),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 172/260 (66%), Gaps = 26/260 (10%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdh----eddieeLLFGPLYKGIIDL-NLPEE-HVFNRLTKL  674
             GY GPDP    +             +   +E+LFGPL  GI+D   LP +  + N L + 
Sbjct  228   GYTGPDPDFKVQNTTTAATTKLDEQQQQQQEILFGPLSSGIVDFKTLPHDLTLINTLKRH  287

Query  675   GCSVAKPKP----------------PG----PSFVIECDAvvvgsgcgggvisgvLATAG  794
             G  V + +P                P     P   I CDAVVVGSG GGGV++G+LA AG
Sbjct  288   GFPVKRRRPCTSILPQERSTHNNKVPSSIFDPFLKIRCDAVVVGSGSGGGVVAGLLARAG  347

Query  795   YKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSA  974
             YKVLVLEKGNYYAR NL+LLEGP++D+M+L  GL+ T D+D++LLAGSTVGGGS +NWSA
Sbjct  348   YKVLVLEKGNYYARNNLTLLEGPTLDQMYLSNGLMATADMDVLLLAGSTVGGGSTINWSA  407

Query  975   SIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCREL  1154
             SI TP +V +EWC+ + LELFGS +Y +A+D VC +M VQ E E+E F N VLRKGC EL
Sbjct  408   SIPTPQHVRKEWCDEYELELFGSKLYEEALDVVCKRMQVQSEIEEEGFNNAVLRKGCEEL  467

Query  1155  CYPVVNIPQNAPSDHYCGWC  1214
              YPV NIP+NAPSDHYCGWC
Sbjct  468   GYPVDNIPRNAPSDHYCGWC  487


 Score =   124 bits (311),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 100/158 (63%), Gaps = 1/158 (1%)
 Frame = +2

Query  41   NTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  220
            N    +LS  QM+TL A+ + FLP+++ +   T D S+  F+ TSA+   TP ++  +I+
Sbjct  72   NIYESSLSRRQMDTLIAVSDAFLPSVDVS-DLTADESLLKFYATSASMAATPQRLGGMIS  130

Query  221  QRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  400
            +R+KHPK   L + LW LST  GT ++CG  S+ST FP+   FP +S ++R+ I++SW+ 
Sbjct  131  ERLKHPKKWLLKVALWALSTWFGTFVMCGIASVSTTFPYFHSFPNLSHQRRQEILNSWSQ  190

Query  401  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            S    +R  + ++K L  LVFFT VD K  N SWKAIG
Sbjct  191  SYFFLLRLLYWSLKLLTFLVFFTQVDSKDHNVSWKAIG  228



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score =   224 bits (570),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 160/212 (75%), Gaps = 6/212 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEH--VFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcg  758
             L+GPL+KGI++L   ++       L K G  V       KPP PS +I+CDAVVVGSG G
Sbjct  260   LYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSG  319

Query  759   ggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  938
             GGV++GVLA AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+   GL+ T ++++++LAGS
Sbjct  320   GGVVAGVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGS  379

Query  939   TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESF  1118
             TVGGGS VNWSASIKTP +V +EW + + LELF S++Y +A+D VC KMGVQ + ++E F
Sbjct  380   TVGGGSTVNWSASIKTPSHVTKEWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGF  439

Query  1119  QNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
              N VLRKGC EL    +NIP+N+ SDHYCGWC
Sbjct  440   NNAVLRKGCEELGGHAINIPRNSTSDHYCGWC  471


 Score =   138 bits (348),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 104/158 (66%), Gaps = 2/158 (1%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  238
            LS ++ME+L+ALC+TFLP++  A     D S   FF+TSA++ GTP +V  +I +R++HP
Sbjct  73   LSAAEMESLAALCDTFLPSVAPAT--AADRSTAVFFETSASAVGTPERVGEMIMERVRHP  130

Query  239  KlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  418
            K   + + LW LST  GT +LCG  SLS  FP+  RF ++SQKKRE+I  SW+ S    +
Sbjct  131  KKWLVRVSLWMLSTWYGTYILCGNESLSNHFPYFKRFSKVSQKKREQIALSWSLSYFFLL  190

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            R FF  +K L LL FFT VD++ +N SWKAI    S P
Sbjct  191  RMFFRTIKILCLLAFFTQVDEEMNNISWKAIDYPGSDP  228



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score =   233 bits (595),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 159/213 (75%), Gaps = 7/213 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPSF-----VIECDAvvvgsgc  755
             +FGPLY GI+DL  P E V  +LT  G +V+ PK  P G S       I CDAVVVGSG 
Sbjct  219   IFGPLYNGIVDLKSPREVVTKKLTDRGFTVSTPKKNPKGSSLSNRVMTIRCDAVVVGSGS  278

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLA AGYKVLV+E GNYYAR+ LSLLEG +M++M+L GGLL T D+++V+LAG
Sbjct  279   GGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLEGQAMEEMYLSGGLLATSDMNVVVLAG  338

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASIKTP +V+ EW E   L++F SD Y +AMD VC +MGVQ    +E 
Sbjct  339   STVGGGSTINWSASIKTPEHVMNEWAEKSKLKMFRSDSYREAMDVVCKRMGVQCGFVEEG  398

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             F N +LRKGC EL  PV NIP+NAPSDHYCG+C
Sbjct  399   FNNEILRKGCEELGLPVKNIPRNAPSDHYCGFC  431


 Score =   128 bits (322),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 102/157 (65%), Gaps = 1/157 (1%)
 Frame = +2

Query  47   ATKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  223
            A  +L+  +ME+L A+C+T +P+I+   +    D SV  +F  SA+ TGTP +VA ++++
Sbjct  38   ANSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLMSE  97

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R+ HPK   L + LWFLST IG+ +LCG+ S + +FP+   F  +  K+RE ++ +W+ S
Sbjct  98   RLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSAS  157

Query  404  SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
                +R FF ++K +  LVFFT VD KG N SWKAIG
Sbjct  158  YFSLLRMFFKSIKLITALVFFTQVDGKGRNLSWKAIG  194



>ref|XP_010274418.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274419.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
Length=775

 Score =   234 bits (597),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 162/249 (65%), Gaps = 13/249 (5%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkh-----hdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG  677
             GYCGPDP    + +  K         E++ +E LFGPLY+ +I+   P + +   L + G
Sbjct  171   GYCGPDPDFKHQTQASKTDQDDLTSEEEEKKEELFGPLYRRLINPRHPRQSIAEYLEQSG  230

Query  678   CSVA--------KPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYA  833
               V          P    PS  I CDAVVVGSG GG V + VLA AGYKVLVLEKG Y+A
Sbjct  231   FPVTINHFHGNKTPSISSPSLTIRCDAVVVGSGSGGSVAAAVLAKAGYKVLVLEKGKYFA  290

Query  834   RTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWC  1013
             R NLSLLEGPS+++M+L GGL  T DL + L AG+TVGGGS VNWSASI+TP +V+ EWC
Sbjct  291   RNNLSLLEGPSLEQMYLDGGLTATDDLGVFLFAGATVGGGSTVNWSASIRTPGHVMEEWC  350

Query  1014  EVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPS  1193
               H LELF    Y +AMD VC +MGVQ +  +ESF N VLR+GC EL YPV  + QNAP 
Sbjct  351   YSHKLELFDRKPYNRAMDVVCNRMGVQVDTREESFNNAVLRRGCLELGYPVSRVSQNAPM  410

Query  1194  DHYCGWCTF  1220
             DHYCGWC F
Sbjct  411   DHYCGWCGF  419


 Score =   124 bits (312),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 107/166 (64%), Gaps = 1/166 (1%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWV  214
            E  T   +LS  +M +L  LC+T LP+IN +  +  D S++NF+  SA++T TP  VA +
Sbjct  13   EKTTTVNSLSSREMHSLCTLCDTLLPSINHSATDEDD-SLSNFYWASASTTATPQLVAGI  71

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  394
            I +++  PK   L L LW LST  GT +L GK SLST+FP+  +F ++SQKKRE I+ SW
Sbjct  72   ITEKLPLPKAGILRLTLWLLSTWFGTFILTGKSSLSTKFPYFQKFSQVSQKKREEILLSW  131

Query  395  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +TSS   +R  F   K L+L VFFT VD+K +NPSWKA+G     P
Sbjct  132  STSSFSLLRMLFKIFKLLLLFVFFTQVDEKNENPSWKALGYCGPDP  177



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score =   226 bits (576),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 154/213 (72%), Gaps = 7/213 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPSF-----VIECDAvvvgsgc  755
             +FGPLY GI+DL  P E V  +LT  G +V+ PK  P G S       I CDAVVVGSG 
Sbjct  219   IFGPLYNGIVDLKSPREVVTKKLTDRGFTVSTPKKNPKGSSLSNRVMTIRCDAVVVGSGS  278

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLA AG+KVLV+E GNYYAR+ LSLLEG +M++M+L GGLL T D+++V+LAG
Sbjct  279   GGGVVAGVLANAGHKVLVVESGNYYARSTLSLLEGQAMEEMYLSGGLLATSDMNVVVLAG  338

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASIKTP +V+ EW E   LE+FGSD Y +AMD VC +MGV        
Sbjct  339   STVGGGSTINWSASIKTPEHVMNEWAEKSKLEMFGSDSYREAMDVVCKRMGVXXXXXXXX  398

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
                  LRKGC EL  PV NIP+NAPSDHYCG+C
Sbjct  399   XXXXXLRKGCEELGLPVKNIPRNAPSDHYCGFC  431


 Score =   127 bits (319),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 101/157 (64%), Gaps = 1/157 (1%)
 Frame = +2

Query  47   ATKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  223
            A  +L+  +ME+L A+C+T +P+I+   +    D SV  +F  SA+ TGTP +VA ++++
Sbjct  38   ANSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLMSE  97

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R+ HPK   L + LWFLST IG+ +LCG+ S + +FP+   F  +  K+RE ++ +W+ S
Sbjct  98   RLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSAS  157

Query  404  SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
                +R FF  +K +  LVFFT VD KG N SWKAIG
Sbjct  158  YFSLLRMFFRCIKLISALVFFTQVDGKGRNLSWKAIG  194



>ref|XP_006878629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score =   234 bits (598),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 164/237 (69%), Gaps = 10/237 (4%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKL-GCSVA  689
             GYCGPDP         +             GPL  G+IDL+  + H F  + +  G +V+
Sbjct  238   GYCGPDPQKESGCPHGQQESK---------GPLQHGVIDLDSMDHHTFAHVLRASGFTVS  288

Query  690   KPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSM  869
             +PK    +F I+CDAVVVGSG GGGV +GVLA AG+KV+VLEKG+Y+AR+ LSLLEGP+M
Sbjct  289   QPKEKFSNFTIKCDAVVVGSGSGGGVAAGVLAVAGHKVVVLEKGHYFARSQLSLLEGPTM  348

Query  870   DKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDV  1049
             D+M+   GL+ T DL  ++LAGSTVGGGSA+NWSA+I+TP +VL EW +VHGLELF S  
Sbjct  349   DQMYDRHGLIATDDLSAIILAGSTVGGGSAINWSAAIRTPDHVLNEWNQVHGLELFESKA  408

Query  1050  YXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             Y +AMD V   MGVQ +  DE      LRKGC+EL +PVVN+P+N+P DHYCGWC F
Sbjct  409   YHQAMDVVARDMGVQTQVSDEGLACSALRKGCQELGFPVVNVPRNSPDDHYCGWCCF  465


 Score =   118 bits (295),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 102/188 (54%), Gaps = 30/188 (16%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAIN------------------------------EALPETTDA  148
            LSP QME+L+ALC+T +P+I+                              +      D 
Sbjct  57   LSPRQMESLTALCDTLIPSIDVDFHGQQPRNAGDDAIRSFATSAFMSDFHGQQQQNAGDD  116

Query  149  SVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ  328
            ++ +FF TSA+ +GTP  VA +++ ++KH     L L LW LST  GT ++CG  SLS+ 
Sbjct  117  AIRSFFATSASMSGTPDHVAGLVSGKVKHALSGVLRLCLWLLSTWYGTFIICGTLSLSSH  176

Query  329  FPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKA  508
            FP+   FP+I Q KRE I+ SW+TSS+  +R  F  +K  V L+F++ VD+   N +W+A
Sbjct  177  FPYFQSFPQIIQPKREEIMLSWSTSSIYLLRALFQCIKFFVHLIFYSKVDENNHNSTWQA  236

Query  509  IGVLWSRP  532
            IG     P
Sbjct  237  IGYCGPDP  244



>ref|XP_010538590.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Tarenaya 
hassleriana]
Length=782

 Score =   216 bits (550),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 156/222 (70%), Gaps = 14/222 (6%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA---------KPKPPG-----PSFVIECDA  734
             +FGP+Y GI+DL  P E V   L + G  V+         + + PG     P   I CDA
Sbjct  217   IFGPIYNGIVDLMNPREVVIETLNRHGFQVSTRTGKNSHGRDRRPGSSISDPVMKIRCDA  276

Query  735   vvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDL  914
             VVVGSG GGGV++GVLA AGYKVLVLEKGNYYAR NLSLLEG +M++M+L  GL+ T D+
Sbjct  277   VVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYYARNNLSLLEGQAMEQMYLSSGLVATADM  336

Query  915   DMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQ  1094
             + V+LAGS+VGGGS VNWSASI+TP  V++EW E  GL+LF S  Y +AMD VC +MGVQ
Sbjct  337   NTVILAGSSVGGGSTVNWSASIRTPENVIKEWSEKCGLKLFESGFYREAMDVVCERMGVQ  396

Query  1095  RECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
                 +E F N +LRKGC  L +PV +IP+N+ +DHYCG+C F
Sbjct  397   SGFVEEGFNNEILRKGCEALGFPVKSIPRNSLADHYCGFCCF  438


 Score =   136 bits (343),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 98/152 (64%), Gaps = 0/152 (0%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            +L+  +ME+L A+C+T +P+IN +     D  V  FF  SA+  GTP +VA  I+  + H
Sbjct  32   SLTAREMESLWAICDTLIPSINGSEVCHVDDHVAGFFAASASQMGTPDRVARKISGTLDH  91

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
            PK   L   LW LST IG+L+LCG+ S S +FP+  RF  + QK+RE I+ SWA+S    
Sbjct  92   PKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREEIMLSWASSFFSL  151

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            +R FF AMK +  LVFFT VD+KG N +W+AI
Sbjct  152  LRMFFKAMKLITALVFFTQVDEKGKNLAWEAI  183



>ref|XP_010538591.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Tarenaya 
hassleriana]
Length=765

 Score =   216 bits (550),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 156/222 (70%), Gaps = 14/222 (6%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA---------KPKPPG-----PSFVIECDA  734
             +FGP+Y GI+DL  P E V   L + G  V+         + + PG     P   I CDA
Sbjct  217   IFGPIYNGIVDLMNPREVVIETLNRHGFQVSTRTGKNSHGRDRRPGSSISDPVMKIRCDA  276

Query  735   vvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDL  914
             VVVGSG GGGV++GVLA AGYKVLVLEKGNYYAR NLSLLEG +M++M+L  GL+ T D+
Sbjct  277   VVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYYARNNLSLLEGQAMEQMYLSSGLVATADM  336

Query  915   DMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQ  1094
             + V+LAGS+VGGGS VNWSASI+TP  V++EW E  GL+LF S  Y +AMD VC +MGVQ
Sbjct  337   NTVILAGSSVGGGSTVNWSASIRTPENVIKEWSEKCGLKLFESGFYREAMDVVCERMGVQ  396

Query  1095  RECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
                 +E F N +LRKGC  L +PV +IP+N+ +DHYCG+C F
Sbjct  397   SGFVEEGFNNEILRKGCEALGFPVKSIPRNSLADHYCGFCCF  438


 Score =   136 bits (342),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 98/152 (64%), Gaps = 0/152 (0%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            +L+  +ME+L A+C+T +P+IN +     D  V  FF  SA+  GTP +VA  I+  + H
Sbjct  32   SLTAREMESLWAICDTLIPSINGSEVCHVDDHVAGFFAASASQMGTPDRVARKISGTLDH  91

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
            PK   L   LW LST IG+L+LCG+ S S +FP+  RF  + QK+RE I+ SWA+S    
Sbjct  92   PKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREEIMLSWASSFFSL  151

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            +R FF AMK +  LVFFT VD+KG N +W+AI
Sbjct  152  LRMFFKAMKLITALVFFTQVDEKGKNLAWEAI  183



>ref|XP_010676700.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=808

 Score =   231 bits (588),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 172/248 (69%), Gaps = 14/248 (6%)
 Frame = +3

Query  513   GYCGPDPS-ISekqkkqkhhdheddieeL-------LFGPLYKGIIDLNLPEEHVFNRL-  665
             GYCGPDP  IS+K  +          + L       L GPLYKGII++   +E +   L 
Sbjct  199   GYCGPDPYFISKKASESNKQSAYLTPKSLHNQPKEDLCGPLYKGIINVKCTQEILIESLK  258

Query  666   -TKLGCSVAKPKP--PGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYAR  836
              +    S+ + K         I+CD VVVGSG GGGV +GVLA+ GYKVLV++KG+YYAR
Sbjct  259   HSNFQVSINRKKKDCQMQVITIKCDVVVVGSGSGGGVAAGVLASLGYKVLVIDKGDYYAR  318

Query  837   TNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCE  1016
             TNLSLLEGP++D+M+ G GLL TKDL + +LAGSTVGGGS +NWSASI+TPP+V++EW +
Sbjct  319   TNLSLLEGPTLDQMYEGAGLLSTKDLGVNILAGSTVGGGSTINWSASIRTPPHVIKEWAD  378

Query  1017  VHGLELFGSDVYXKAMDTVCGKMGVQRECE--DESFQNMVLRKGCRELCYPVVNIPQNAP  1190
             VH LE+F S +Y +A+D VC KM VQ + +  DE F N VLRKGC EL YPVVNIPQNAP
Sbjct  379   VHELEIFDSPLYKEALDVVCEKMEVQSDIDVSDEGFNNAVLRKGCLELGYPVVNIPQNAP  438

Query  1191  SDHYCGWC  1214
              +H CGWC
Sbjct  439   KNHNCGWC  446


 Score =   121 bits (303),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 109/173 (63%), Gaps = 9/173 (5%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINEALPE-TTDASVTNFFQTSAASTGTPHQVAW  211
            E  T T  LS  +ME+L+ALC+T LPA++   PE TTD SV  F++TSA+  GTP  V  
Sbjct  37   EKQTYTNKLSSWEMESLTALCDTLLPAVDP--PESTTDESVVRFYRTSASMNGTPEHVGR  94

Query  212  VINQRMKHPKlnslllllwflSTRIGTLLLCGKG----SLSTQFPFLLRFPEISQKKRER  379
            +I+QR++   +    ++L  L+TR+GT +L   G    +LS ++PFLL+  E+S +KR++
Sbjct  95   MISQRLRQ-HVLLGRIILVLLATRLGTFVLGLLGGGLPNLSPRYPFLLKCSEMSLEKRQQ  153

Query  380  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGD-NPSWKAIGVLWSRPF  535
            +V SW TS    +R  F  MK L+ +V+FT VDD  D NP W+AIG     P+
Sbjct  154  LVLSWRTSWFYLVRMIFFGMKRLISVVYFTQVDDNEDYNPIWEAIGYCGPDPY  206



>gb|EPS61567.1| hypothetical protein M569_13229, partial [Genlisea aurea]
Length=735

 Score =   209 bits (532),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 150/212 (71%), Gaps = 6/212 (3%)
 Frame = +3

Query  600   FGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-KP----KPPGPSFVIECDAvvvgsgcggg  764
              GPL +GIIDL   EE +  +L+ LG  V+  P    +  G S+ +E D VV+GSGCGGG
Sbjct  193   LGPLREGIIDLKSKEESL-QKLSDLGFPVSLNPNRIRRRGGASYAVESDVVVIGSGCGGG  251

Query  765   visgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  944
             V++GVLA  GYK +VLEKG Y+    L LLEG +MD+M+LG G++ T ++D+++LAGSTV
Sbjct  252   VVAGVLAQQGYKTIVLEKGKYFPTARLPLLEGQAMDQMYLGNGIIGTDNMDILILAGSTV  311

Query  945   GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQN  1124
             GGGS +NWSASI+TPP+V +EW E H L+LF S  Y  AMD VCGK+GVQ    +E F N
Sbjct  312   GGGSTINWSASIRTPPHVRKEWSENHELKLFESSAYDDAMDAVCGKIGVQANVAEEGFNN  371

Query  1125  MVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             MVLRKGC EL  P   IP+NA SDHYCG C F
Sbjct  372   MVLRKGCDELRIPAETIPRNASSDHYCGSCCF  403


 Score =   139 bits (349),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 101/150 (67%), Gaps = 0/150 (0%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  241
            S  QME+L+ALC+TFLP +        D  ++ FF+TSA++  TPHQVA ++  +++H +
Sbjct  14   SRRQMESLAALCDTFLPEMEPPSGADDDKDISRFFRTSASTANTPHQVAILMGHKIRHRR  73

Query  242  lnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIR  421
            L    L LW LST IGT +LCG+ SLS +FP+L +F  +S + R+ I+HSWA S    +R
Sbjct  74   LFLAPLALWVLSTAIGTWVLCGRKSLSRRFPYLQKFSRVSTENRKEIMHSWANSHFFVLR  133

Query  422  NFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
              F A+K  + L+FF+ VD+KGDN SW+AI
Sbjct  134  LLFNALKIFITLIFFSQVDEKGDNVSWQAI  163



>ref|XP_008776965.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=766

 Score =   212 bits (539),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 160/240 (67%), Gaps = 6/240 (3%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkh----hdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG-  677
             GYCGPDP ++++ +  +      D      +   GPL   ++ ++ P + +  +L   G 
Sbjct  191   GYCGPDPELADQSQHFRTPPLEEDSVSQEADSCPGPLDSALLYMDSPRDVITRKLQIAGF  250

Query  678   -CSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLL  854
                 +    P     + CD VVVGSG GG V++GVLA AG++V+V+EKG+YY R+ LSLL
Sbjct  251   PTPTSGTNSPSSPLTLHCDVVVVGSGSGGSVVAGVLAKAGHRVIVVEKGHYYHRSELSLL  310

Query  855   EGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLEL  1034
             EGP++ +M+ GGG++ T D+ ++LLAGSTVGGGS VNWSA I+TP +V  EWC   GL L
Sbjct  311   EGPTIAEMYEGGGIISTDDIGVILLAGSTVGGGSTVNWSACIRTPDHVRNEWCNKLGLRL  370

Query  1035  FGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             FGS+ Y  A+D VCG+MGVQ + E+E F N +LRKGC EL YPV N+P+NAP DH CGWC
Sbjct  371   FGSEAYDHALDVVCGRMGVQSDVEEEGFNNAILRKGCVELGYPVSNVPRNAPPDHCCGWC  430


 Score =   126 bits (316),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  238
            LS  +M++L+A C+ FLP+++  + +T D  +  F+ TSA+  GTP ++  +++  M+HP
Sbjct  42   LSKREMDSLTAACDAFLPSVD--VSDTGDEGLIAFYGTSASMAGTPERIGGLLSGGMQHP  99

Query  239  KlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  418
             +  L L LW LST  GT +LCG+ SLS QFP+L +FP++ ++K+E I+ SW+ SSL  +
Sbjct  100  AIGLLRLALWLLSTWYGTFILCGRASLSNQFPYLQKFPQVRREKQEEILLSWSRSSLCPL  159

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +  +  +K L +  +F+ ++DK  NPSW A+G     P
Sbjct  160  KMLYKCLKYLTMKEYFSQINDKETNPSWDALGYCGPDP  197



>ref|XP_009396212.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Musa acuminata subsp. 
malaccensis]
Length=745

 Score =   227 bits (578),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 164/238 (69%), Gaps = 5/238 (2%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdhedd----ieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGC  680
             GYCGPDP + ++ +      H++      E+ +FGPL+  ++ +  P + +   L K G 
Sbjct  171   GYCGPDPDLVDQSQHLGTPQHQEKDPVDQEDDVFGPLHSALLHMEKPRDVITRMLHKAGF  230

Query  681   SVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEG  860
                   P  P   + CDA V+GSG GG V++GVLA AGYKV+V+EKG+YY  + LSLLEG
Sbjct  231   PAPATFPSSP-LTLSCDAAVIGSGSGGSVVAGVLAKAGYKVIVIEKGDYYPSSRLSLLEG  289

Query  861   PSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFG  1040
             P++  M+ GGGL+ T D+  +LLAGSTVGGGS VNWSASI+TP +V REWC+ HGLELF 
Sbjct  290   PALGAMYEGGGLVATDDVGALLLAGSTVGGGSTVNWSASIRTPGHVRREWCDEHGLELFS  349

Query  1041  SDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             S  Y +A+D VC +MGVQ + ++E F NM+LR+GC +L YPV N+P NAP DHYCGWC
Sbjct  350   SKAYDEALDVVCERMGVQSDVKEEGFNNMILRRGCEKLGYPVANVPCNAPPDHYCGWC  407


 Score =   107 bits (266),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 87/152 (57%), Gaps = 2/152 (1%)
 Frame = +2

Query  77   ETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsll  256
            E+L+A+C+T LP ++  +    D  +  F+ TSA+  GT   +  +++  +KHP    L 
Sbjct  28   ESLAAVCDTLLPQVD--VSSVGDEGLVEFYGTSASMVGTSEHIGGLLSGGLKHPAAGLLY  85

Query  257  lllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTA  436
            L LW LST  GT  +CG  SLS QFP+  RF ++ + KRE+I+ SW+  S       F  
Sbjct  86   LALWLLSTWYGTFAMCGTRSLSKQFPYFHRFAKVERTKREQILLSWSLGSFPLYAMLFRC  145

Query  437  MKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +K L + ++FT ++D   NP+WKA+G     P
Sbjct  146  LKYLTMRLYFTQLNDDRTNPAWKAMGYCGPDP  177



>ref|XP_010942998.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Elaeis guineensis]
Length=787

 Score =   213 bits (541),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 169/242 (70%), Gaps = 11/242 (5%)
 Frame = +3

Query  516   YCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-K  692
             YCGP+P ++++ K       EDD     FGPL+  ++ +  P + +   L++ G  +A +
Sbjct  201   YCGPEPELADQVKASVDQSSEDDR----FGPLHCAMVHMESPGDDLAAALSRAGLYLATR  256

Query  693   P----KPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEG  860
             P    +   P   I CDAVVVGSG GGGV++GVLA AGYKV+VLEKG Y+AR+NLSL EG
Sbjct  257   PFSGDRRKKPLRTIHCDAVVVGSGSGGGVVAGVLAQAGYKVVVLEKGGYHARSNLSLHEG  316

Query  861   PSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFG  1040
             P+MD M+ GGGLL T D  +V+L+G+TVGGGSA+NW+A+++TP +V  EW   HGLELFG
Sbjct  317   PAMDLMYEGGGLLATTDTGVVVLSGATVGGGSAINWAAALRTPDHVAAEWRRDHGLELFG  376

Query  1041  SDVYXKAMDTVCGKMGVQRECE--DESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             SD Y +A+D VC +MGVQ + +  +E+  N  LR+GC EL YPV NI +NAP DH+CGWC
Sbjct  377   SDAYAEALDAVCERMGVQSDVDKMEENLNNAALRRGCLELGYPVANISRNAPPDHHCGWC  436

Query  1215  TF  1220
              F
Sbjct  437   CF  438


 Score =   115 bits (289),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  238
            L+  +M++L+A+ +TFLP+I+  LP   + S+  F+ TSA+  GTP  V   ++ R++H 
Sbjct  51   LTAREMDSLTAISDTFLPSID--LPGARNESIRAFYLTSASMIGTPEIVGGYMSGRLRHA  108

Query  239  KlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  418
             L  L L LW LST  GT + CG   +S +FPF  +F +I  K+RE+I+ SW++S +   
Sbjct  109  SLWLLRLSLWLLSTWYGTFIFCGTRCMSCRFPFFHKFSDIDPKRREQILSSWSSSPIYLY  168

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            R  F A+K L++L +FT V++K +NP+W A+      P
Sbjct  169  RQLFRALKFLIMLFYFTQVNEKNENPAWTALDYCGPEP  206



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score =   273 bits (698),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 199/275 (72%), Gaps = 15/275 (5%)
 Frame = +3

Query  441   KLWFSSYSSLRLMI-------RGITQVGKQ*GYCGPDPSISekqkkqkhhdheddie---  590
             KL F +   L L++       +G     K  GYCG DP   ++++++ +       E   
Sbjct  118   KLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEELSD  177

Query  591   ---eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgc  755
                E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG 
Sbjct  178   KRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGS  237

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ LLAG
Sbjct  238   GGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAG  297

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASI TP +VL+EWC+++ LELF S+ Y +A++T+  KMGVQ + ++E 
Sbjct  298   STVGGGSTINWSASIDTPSHVLKEWCDIYNLELFQSEFYKEALETIREKMGVQDKIDEEG  357

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             FQNM+LRKGC EL Y V NIP+NA S+HYCGWC+ 
Sbjct  358   FQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSM  392


 Score =   159 bits (402),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = +2

Query  74   METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  247
            M++L+A+C+TFLP+I  N    E  D S+  F  TSA+   TP  +AW++++R++HPKLN
Sbjct  1    MDSLTAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNETPQHLAWMVSERIQHPKLN  60

Query  248  slllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  427
               L LW LSTRIGT +LCGK SLS+QFP+L  F ++S  KRE IV SW+ S+ + I+  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSKVSPNKREEIVQSWSCSNFKLIKLL  120

Query  428  FTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            F A+K L LLVFFT VD+KG NPSWKA+G     P
Sbjct  121  FVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDP  155



>ref|XP_008805948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=793

 Score =   213 bits (543),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 168/242 (69%), Gaps = 15/242 (6%)
 Frame = +3

Query  516   YCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-K  692
             YCGPDP+ +++ K       EDD     FGPL++ ++ +  P       L++ G S+A +
Sbjct  201   YCGPDPAFADQVKASVDQCSEDDR----FGPLHRALVHMGSPGAA----LSRAGLSLATR  252

Query  693   PKPPG----PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEG  860
             P P G    P   I CDAVVVGSG GGGV++G LA AGYKV+VLEKG Y+AR+NLSL EG
Sbjct  253   PFPGGRRKKPLRTILCDAVVVGSGSGGGVVAGFLARAGYKVVVLEKGGYHARSNLSLCEG  312

Query  861   PSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFG  1040
             P++D M+ GGGLL T D  +V+L+G+TVGGGSA+NW+A+++TP +V  EW   HGL+LFG
Sbjct  313   PTLDLMYEGGGLLSTTDTGVVVLSGATVGGGSAINWAAALRTPDHVAAEWRRDHGLQLFG  372

Query  1041  SDVYXKAMDTVCGKMGVQRECED--ESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             SD Y +A+D VC +MGVQ +  +  ES  N  LR+GC EL YPV NI +NAP DH+CGWC
Sbjct  373   SDAYAEALDAVCERMGVQSDVHEMKESLNNAALRRGCHELGYPVSNISRNAPPDHHCGWC  432

Query  1215  TF  1220
              F
Sbjct  433   CF  434


 Score =   114 bits (284),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  238
            L+  +M++L+A+ +TFLP+I+  LP   + S+  F+  SA+  GTP  V   +++R++H 
Sbjct  51   LTAREMDSLTAISDTFLPSID--LPGARNESIRAFYLASASMIGTPEIVGGYVSRRLRHA  108

Query  239  KlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  418
             L  L L LW LST  GT + CG   +S +FPF  +F +I   +RE I+ SW++S +   
Sbjct  109  LLGLLRLSLWLLSTWYGTFIFCGTRCVSCRFPFFHKFSDIDPTRREEILSSWSSSPIYLY  168

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            R  F AMK L+   +FT V+DK +NP+W+A+
Sbjct  169  RKLFRAMKFLIPFFYFTQVNDKYENPTWRAL  199



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score =   272 bits (696),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 199/275 (72%), Gaps = 15/275 (5%)
 Frame = +3

Query  441   KLWFSSYSSLRLMI-------RGITQVGKQ*GYCGPDPSISekqkkqkhhdheddie---  590
             KL F +   L L++       +G     K  GYCG DP   ++++++ +       E   
Sbjct  118   KLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEEFSD  177

Query  591   ---eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgc  755
                E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG 
Sbjct  178   KRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGS  237

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ LLAG
Sbjct  238   GGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAG  297

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASI TP +VL+EWC+++ LELF S+ Y +A++T+  KMGVQ + ++E 
Sbjct  298   STVGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIRKKMGVQDKIDEEG  357

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             FQNM+LRKGC EL Y V NIP+NA S+HYCGWC+ 
Sbjct  358   FQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSM  392


 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = +2

Query  74   METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  247
            M++LSA+C+TFLP+I  N    E  D S+  F  TSA+  GTP  +AW++++R++HPKLN
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  248  slllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  427
               L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+ + I+  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  428  FTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            F A+K L LLVFFT VD+KG NPSWKA+G     P
Sbjct  121  FVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDP  155



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score =   272 bits (696),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 199/275 (72%), Gaps = 15/275 (5%)
 Frame = +3

Query  441   KLWFSSYSSLRLMI-------RGITQVGKQ*GYCGPDPSISekqkkqkhhdheddie---  590
             KL F +   L L++       +G     K  GYCG DP   ++++++ +       E   
Sbjct  118   KLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEELSD  177

Query  591   ---eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgc  755
                E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG 
Sbjct  178   KRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGS  237

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ LLAG
Sbjct  238   GGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAG  297

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASI TP +VL+EWC+++ LELF S+ Y +A++T+  KMGVQ + ++E 
Sbjct  298   STVGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEG  357

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             FQNM+LRKGC EL Y V NIP+NA S+HYCGWC+ 
Sbjct  358   FQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSM  392


 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = +2

Query  74   METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  247
            M++LSA+C+TFLP+I  N    E  D S+  F  TSA+  GTP  +AW++++R++HPKLN
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  248  slllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  427
               L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+ + I+  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  428  FTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            F A+K L LLVFFT VD+KG NPSWKA+G     P
Sbjct  121  FVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDP  155



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score =   272 bits (695),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 199/275 (72%), Gaps = 15/275 (5%)
 Frame = +3

Query  441   KLWFSSYSSLRLMI-------RGITQVGKQ*GYCGPDPSISekqkkqkhhdheddie---  590
             KL F +   L L++       +G     K  GYCG DP   ++++++ +       E   
Sbjct  118   KLLFVALKVLTLLVFFTQVNEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEEFSD  177

Query  591   ---eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgc  755
                E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG 
Sbjct  178   KRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGS  237

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ LLAG
Sbjct  238   GGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAG  297

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASI TP +VL+EWC+++ LELF S+ Y +A++T+  KMGVQ + ++E 
Sbjct  298   STVGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEG  357

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             FQNM+LRKGC EL Y V NIP+NA S+HYCGWC+ 
Sbjct  358   FQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSM  392


 Score =   164 bits (416),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 110/155 (71%), Gaps = 2/155 (1%)
 Frame = +2

Query  74   METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  247
            M++LSA+C+TFLP+I  N    E  D S+  F  TSA+  GTP  +AW++++R++HPKLN
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMLSERIQHPKLN  60

Query  248  slllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  427
               L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+L+FI+  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNLKFIKLL  120

Query  428  FTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            F A+K L LLVFFT V++KG NPSWKA+G     P
Sbjct  121  FVALKVLTLLVFFTQVNEKGQNPSWKALGYCGQDP  155



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score =   272 bits (696),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 199/275 (72%), Gaps = 15/275 (5%)
 Frame = +3

Query  441   KLWFSSYSSLRLMI-------RGITQVGKQ*GYCGPDPSISekqkkqkhhdheddie---  590
             KL F +   L L++       +G     K  GYCG DP   ++++++ +       E   
Sbjct  146   KLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEELSD  205

Query  591   ---eLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgc  755
                E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG 
Sbjct  206   KRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGS  265

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ LLAG
Sbjct  266   GGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAG  325

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASI TP +VL+EWC+++ LELF S+ Y +A++T+  KMGVQ + ++E 
Sbjct  326   STVGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEG  385

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             FQNM+LRKGC EL Y V NIP+NA S+HYCGWC+ 
Sbjct  386   FQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSM  420


 Score =   168 bits (426),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
            +LS SQM++LSA+C+TFLP+I  N    E  D S+  F  TSA+  GTP  +AW++++R+
Sbjct  23   SLSFSQMDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERI  82

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
            +HPKLN   L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+ 
Sbjct  83   QHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNF  142

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            + I+  F A+K L LLVFFT VD+KG NPSWKA+G     P
Sbjct  143  KLIKLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDP  183



>gb|EPS64229.1| hypothetical protein M569_10552, partial [Genlisea aurea]
Length=725

 Score =   224 bits (570),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 166/237 (70%), Gaps = 15/237 (6%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVA  689
             GYCGPDP+               +      GPL++GII+L+   E   +R L+  G  V+
Sbjct  153   GYCGPDPT--------------RNGGPFEVGPLHRGIINLDREREPPPSRALSLYGFPVS  198

Query  690   KPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSM  869
             K    G SF IECDAVVVGSG GGGV++GVLA +G+KVLV+EKG+Y AR++L+LLEG SM
Sbjct  199   KGGEGGVSFTIECDAVVVGSGSGGGVVAGVLAKSGHKVLVIEKGSYSARSDLTLLEGQSM  258

Query  870   DKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDV  1049
             ++M+L  GLL + D+ ++ +AGSTVGGGS +NWSASI+TPP+V REW +  GL LF S+ 
Sbjct  259   ERMYLEKGLLASDDMSVLFVAGSTVGGGSTINWSASIRTPPHVRREWSDECGLRLFQSED  318

Query  1050  YXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             Y  A+D V  +M VQ+E EDE   NMVLR+GC  L Y V NIP+NAPSDHYCGWC+F
Sbjct  319   YDDALDVVSERMSVQKEVEDEGLANMVLRRGCETLGYAVENIPRNAPSDHYCGWCSF  375


 Score =   100 bits (249),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 96/153 (63%), Gaps = 2/153 (1%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  253
            +ETLSA+C+ FLP+I++      D S  +F++TSA+ + TP  V  ++  + +HPK++  
Sbjct  9    LETLSAVCDAFLPSIDDGGGIDIDPSAADFYRTSASMSETPRGVMEML-AKARHPKISLA  67

Query  254  llllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  433
            +  LWFLSTRIG+++LCG+  +      + RF E+  ++RE I+  W+   L  +R F+ 
Sbjct  68   VPALWFLSTRIGSVVLCGRRCVGGG-KLVKRFSELPVEEREEILAYWSRHFLPHLRIFYH  126

Query  434  AMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            ++K   LL FFT VD+ G+N SWKAIG     P
Sbjct  127  SLKFFTLLRFFTHVDENGENVSWKAIGYCGPDP  159



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score =   266 bits (679),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 157/276 (57%), Positives = 193/276 (70%), Gaps = 22/276 (8%)
 Frame = +3

Query  441   KLWFSSYSSLRLMIRGITQVG--------KQ*GYCGPDPSISekqkkqkhhdheddieeL  596
             ++ FS+   L L++   TQV         K  GY GPDP   ++ +  +  + E      
Sbjct  152   RILFSAIKILVLLVF-FTQVNEKSQNPSWKALGYSGPDPDFKKQNQGVQDQEEEQ-----  205

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSFVIECDAvvvgsg  752
             LFGPLY+GII L   ++  F RL KLG SV+KP            P+F IECDAVVVGSG
Sbjct  206   LFGPLYQGIISLKQSQKKAFERLQKLGFSVSKPHNFNDTRRSTECPNFTIECDAVVVGSG  265

Query  753   cgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  932
              GGGVI+G+LA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+M+LG GLL +KD+D++LLA
Sbjct  266   SGGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGPSMDQMYLGNGLLTSKDMDIMLLA  325

Query  933   GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDE  1112
             GSTVGGGS +NWSASI+TP +VL+EW E + LELF S+ Y  A+  VC KMGVQ E EDE
Sbjct  326   GSTVGGGSTINWSASIQTPQHVLKEWSEKYKLELFQSEFYEGALKVVCEKMGVQSEIEDE  385

Query  1113  SFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
              FQNM+LRKGC+EL Y V  IP+NA SDHYCGWC+ 
Sbjct  386   GFQNMILRKGCQELGYQVETIPRNAQSDHYCGWCSM  421


 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINE---ALPETTDASVTNFFQTSAASTGTPHQV  205
            E      TLS +QM++L+ALC+T LP+I+       E  D   TNF QTSA+ TGTP  +
Sbjct  21   EKKVELGTLSSNQMDSLTALCDTILPSIDANSFYQNEAIDDPFTNFLQTSASMTGTPQHI  80

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
            AW+I+ R+ HPKLN   L LW LSTRIGTL+LCGK SLS+QFP+L  F  IS  +RE IV
Sbjct  81   AWMISNRLHHPKLNLCKLALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNQREEIV  140

Query  386  HSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             SW+TS  + +R  F+A+K LVLLVFFT V++K  NPSWKA+G
Sbjct  141  LSWSTSCFKLLRILFSAIKILVLLVFFTQVNEKSQNPSWKALG  183



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score =   264 bits (675),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 198/276 (72%), Gaps = 17/276 (6%)
 Frame = +3

Query  441   KLWFSSYSSLRLMIRGITQVG--------KQ*GYCGPDPSISe------kqkkqkhhdhe  578
             KL F +   L L++   TQV         K  GYCG DP   +        K+ KH +  
Sbjct  118   KLLFVALKVLTLLVF-FTQVDEKCQNPSWKALGYCGQDPDFKKPKQEKMNSKQSKHEEFS  176

Query  579   ddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsg  752
             D  +E L+GPLYKGII L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG
Sbjct  177   DKRDEHLYGPLYKGIITLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSG  236

Query  753   cgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  932
              GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPS+D+MFLG GL+MTKD+++ LLA
Sbjct  237   SGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSLDQMFLGNGLMMTKDMEVFLLA  296

Query  933   GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDE  1112
             GSTVGGGS +NWSASI TP +VL+EWC ++ LE+F S+ Y +A++ +  KMGVQ + ++E
Sbjct  297   GSTVGGGSTINWSASIDTPSHVLKEWCGIYELEMFQSESYKEALEAIREKMGVQDKIDEE  356

Query  1113  SFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
              FQNM+LRKGC EL Y V NIP+NAPS+H CGWC+ 
Sbjct  357   GFQNMILRKGCEELGYHVENIPRNAPSNHNCGWCSM  392


 Score =   161 bits (407),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 107/155 (69%), Gaps = 2/155 (1%)
 Frame = +2

Query  74   METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  247
            M++LSA+C+TFLP+I  N    E  D SV  F  TSA+  GTP  +AW++++R++HPKLN
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSVIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  248  slllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  427
               L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+ + I+  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  428  FTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            F A+K L LLVFFT VD+K  NPSWKA+G     P
Sbjct  121  FVALKVLTLLVFFTQVDEKCQNPSWKALGYCGQDP  155



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score =   263 bits (671),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 194/276 (70%), Gaps = 21/276 (8%)
 Frame = +3

Query  441   KLWFSSYSSLRLMIRGITQVG--------KQ*GYCGPDPSISekqkkqkhhdheddieeL  596
             ++ FS+   L L++   TQV         K  GY GPDP   ++ +  +  + E++    
Sbjct  152   RILFSAIKILVLLVF-FTQVNEKSQNPSWKALGYSGPDPDFKKQNQGPQDQEEEEE----  206

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSFVIECDAvvvgsg  752
             LFGPLY+GII L   ++  F RL K+G SV+KP            P F IECDAVVVGSG
Sbjct  207   LFGPLYQGIISLKQSQKKTFERLQKIGFSVSKPHNFNNTRRSTECPDFTIECDAVVVGSG  266

Query  753   cgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  932
              GGGVI+G+LA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+M+LG GLL +KD+D++LLA
Sbjct  267   SGGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGPSMDQMYLGNGLLTSKDMDVMLLA  326

Query  933   GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDE  1112
             GSTVGGGS +NWSASI+TP +VL+EW E + L+LF S+ Y  A+  VC KMGVQ E EDE
Sbjct  327   GSTVGGGSTINWSASIQTPQHVLKEWSERYKLDLFQSEFYKGALKVVCEKMGVQSEIEDE  386

Query  1113  SFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
              FQNM+LRKGC+EL Y V  IP+NA SDHYCGWC+ 
Sbjct  387   GFQNMILRKGCQELGYQVETIPRNAQSDHYCGWCSM  422


 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINE---ALPETTDASVTNFFQTSAASTGTPHQV  205
            E N    TLS +QM++L+A+C+T LP+I+       E  D   TNF QTSA+ TGTP  +
Sbjct  21   EKNVELGTLSSNQMDSLTAICDTILPSIDANSFYHQEAIDDPFTNFLQTSASMTGTPQHI  80

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
            AW+I+ R++HPKLN   + LW LSTRIGTL+LCGK SLS+QFP+L  F  IS  KRE IV
Sbjct  81   AWMISNRLQHPKLNLCKIALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNKREEIV  140

Query  386  HSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             SW+TS  + +R  F+A+K LVLLVFFT V++K  NPSWKA+G
Sbjct  141  LSWSTSCFKLLRILFSAIKILVLLVFFTQVNEKSQNPSWKALG  183



>ref|XP_011072475.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Sesamum 
indicum]
Length=671

 Score =   260 bits (664),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 182/254 (72%), Gaps = 18/254 (7%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdhe-----------ddieeLLFGPLYKGIIDLNLPEEHVFN  659
             GYCGPDP  ++ ++    +  +              +E LFG LYKGII+L+ P E   +
Sbjct  73    GYCGPDPGCTKTRRLNAENTQQPPEECEEKLADGASKEELFGSLYKGIINLSQPREDPLS  132

Query  660   RLTKLGCSVAKP-------KPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEK  818
             +L  LG SV+ P       K   PSF+++CDAVVVGSG GGGV++GVLA AG+KVLVLEK
Sbjct  133   KLQNLGFSVSIPHSRNRRMKSLNPSFIVKCDAVVVGSGSGGGVMAGVLANAGHKVLVLEK  192

Query  819   GNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYV  998
             G+Y+AR NLSLLEG +MD+M+LG G+  T +LD++LLAGSTVGGGS +NWSASI TPP+V
Sbjct  193   GSYFARANLSLLEGEAMDQMYLGKGMATTDNLDVLLLAGSTVGGGSTINWSASIHTPPHV  252

Query  999   LREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIP  1178
             +REW E H L+LF S VY +A+D VC KMGVQ E E E F NM+LRKGC +L YPV  +P
Sbjct  253   IREWSEKHKLKLFESKVYQQALDVVCQKMGVQSEVEHEGFNNMILRKGCEKLGYPVETVP  312

Query  1179  QNAPSDHYCGWCTF  1220
             +NAPSDHYCGWC F
Sbjct  313   RNAPSDHYCGWCCF  326



>ref|XP_010274420.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Nelumbo 
nucifera]
Length=728

 Score =   234 bits (598),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 160/249 (64%), Gaps = 13/249 (5%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdheddieeL-----LFGPLYKGIIDLNLPEEHVFNRLTKLG  677
             GYCGPDP    + +  K    +   EE      LFGPLY+ +I+   P + +   L + G
Sbjct  124   GYCGPDPDFKHQTQASKTDQDDLTSEEEEKKEELFGPLYRRLINPRHPRQSIAEYLEQSG  183

Query  678   CSVA--------KPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYA  833
               V          P    PS  I CDAVVVGSG GG V + VLA AGYKVLVLEKG Y+A
Sbjct  184   FPVTINHFHGNKTPSISSPSLTIRCDAVVVGSGSGGSVAAAVLAKAGYKVLVLEKGKYFA  243

Query  834   RTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWC  1013
             R NLSLLEGPS+++M+L GGL  T DL + L AG+TVGGGS VNWSASI+TP +V+ EWC
Sbjct  244   RNNLSLLEGPSLEQMYLDGGLTATDDLGVFLFAGATVGGGSTVNWSASIRTPGHVMEEWC  303

Query  1014  EVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPS  1193
               H LELF    Y +AMD VC +MGVQ +  +ESF N VLR+GC EL YPV  + QNAP 
Sbjct  304   YSHKLELFDRKPYNRAMDVVCNRMGVQVDTREESFNNAVLRRGCLELGYPVSRVSQNAPM  363

Query  1194  DHYCGWCTF  1220
             DHYCGWC F
Sbjct  364   DHYCGWCGF  372


 Score = 76.6 bits (187),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 78/166 (47%), Gaps = 48/166 (29%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWV  214
            E  T   +LS  +M +L  LC+T LP+IN +  +  D S++NF+  SA++T TP      
Sbjct  13   EKTTTVNSLSSREMHSLCTLCDTLLPSINHSATDEDD-SLSNFYWASASTTATPQ-----  66

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  394
                                                      L+F ++SQKKRE I+ SW
Sbjct  67   ------------------------------------------LKFSQVSQKKREEILLSW  84

Query  395  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +TSS   +R  F   K L+L VFFT VD+K +NPSWKA+G     P
Sbjct  85   STSSFSLLRMLFKIFKLLLLFVFFTQVDEKNENPSWKALGYCGPDP  130



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score =   257 bits (656),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 164/323 (51%), Positives = 208/323 (64%), Gaps = 38/323 (12%)
 Frame = +3

Query  330   FPF--CYASLRFLRRRENV*FIHGPPAVCNSSEIFSRP*KLWFSSYSSLRLMIRGITQVG  503
             FPF   Y  +  L+R+           + + S  + RP +++F +   L L+    TQV 
Sbjct  154   FPFFHSYPEMSLLKRQR---------VMQSWSLSYLRPLRMFFRTIKLLTLLTF-FTQVD  203

Query  504   --------KQ*GYCGPDPSI-----------SekqkkqkhhdheddieeLLFGPLYKGII  626
                     K  GYCGPDP             + K+++ +  D +DD EE   GPL+KG++
Sbjct  204   EAEENPSWKAIGYCGPDPEFKAQLKNNFLHRTSKEEQHQKKDDDDDEEEEFRGPLHKGLV  263

Query  627   DLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgcgggvisgvLA  785
              LN P + + N L + G SV+             PS VI+CDAVVVGSG GGGV +GVLA
Sbjct  264   HLNYPRDMIKNSLRRFGFSVSTISKKHEASNLSSPSLVIQCDAVVVGSGSGGGVAAGVLA  323

Query  786   TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVN  965
              AGYKVLVLEKG+Y AR NLSLLEGPSMD+M+L  GL+ TKD+ +++LAGSTVGGGSAVN
Sbjct  324   NAGYKVLVLEKGSYCARNNLSLLEGPSMDQMYLSNGLVATKDMSVLILAGSTVGGGSAVN  383

Query  966   WSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGC  1145
             WSASIKTP +V +EWC++H LELF S +Y +AMD VCGKMGVQ E E+E F N VLR+GC
Sbjct  384   WSASIKTPQHVCKEWCDLHELELFESKLYREAMDAVCGKMGVQSEVEEEGFNNEVLRRGC  443

Query  1146  RELCYPVVNIPQNAPSDHYCGWC  1214
              E+ Y V NIP+NA SDHYCGWC
Sbjct  444   LEMGYHVCNIPRNASSDHYCGWC  466


 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 112/170 (66%), Gaps = 1/170 (1%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAI-NEALPETTDASVTNFFQTSAASTGTPHQ  202
            R       T +LSP QM++L ALC+T +P+I N  +  + D SV NF++TSA+  GTP  
Sbjct  52   RDKHQKPLTNSLSPRQMKSLVALCDTIIPSIDNNVVRSSDDESVANFYKTSASMAGTPQH  111

Query  203  VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  382
            +  +I++++KHP    LLL LW LST  GTL+LCG  S+S++FPF   +PE+S  KR+R+
Sbjct  112  LGKLISEKVKHPSTWLLLLTLWLLSTWFGTLILCGMASVSSRFPFFHSYPEMSLLKRQRV  171

Query  383  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            + SW+ S L+ +R FF  +K L LL FFT VD+  +NPSWKAIG     P
Sbjct  172  MQSWSLSYLRPLRMFFRTIKLLTLLTFFTQVDEAEENPSWKAIGYCGPDP  221



>gb|KHN27504.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=638

 Score =   251 bits (641),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 192/284 (68%), Gaps = 22/284 (8%)
 Frame = +3

Query  426   FSRP*KLWFSSYSSLRLMIRGITQVG--------KQ*GYCGPDPSISekqkkqkhhdhed  581
             + RP +++F +   L L++   TQ+         K  GYCGPDP    + K         
Sbjct  8     YLRPLRMFFRTIKLLTLLVF-FTQLDEAEDNPSWKAIGYCGPDPEFKSQLKNHFFTKQRG  66

Query  582   dieeL------LFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-AKPKP------PGPSFVI  722
               E+       + GPLYKG+I +N P + + + L ++G SV A PK         PS VI
Sbjct  67    QEEKEDDGTEDVRGPLYKGLIRINNPRDIITDSLRRVGFSVSATPKKTKASTLSSPSLVI  126

Query  723   ECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  902
             +CDAVVVGSG GGGV++GVLA AGYKVLVLEKG+Y AR NLSLLEGPSMD+M+L  GL+ 
Sbjct  127   KCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPSMDQMYLSNGLVA  186

Query  903   TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGK  1082
             T D+ +++LAGSTVGGGSA+NWSASI+TP +V +EWC+ H LELF S +Y +A+D VC K
Sbjct  187   TNDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDRHELELFESMLYKEALDVVCEK  246

Query  1083  MGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             MGVQ E +DE F N VLR+GC E+ YPV NIP+NA SDHYCGWC
Sbjct  247   MGVQSEIDDEGFNNAVLRRGCVEMGYPVCNIPRNATSDHYCGWC  290


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  383  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            + SW+ S L+ +R FF  +K L LLVFFT +D+  DNPSWKAIG     P
Sbjct  1    MQSWSLSYLRPLRMFFRTIKLLTLLVFFTQLDEAEDNPSWKAIGYCGPDP  50



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score =   254 bits (649),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/289 (52%), Positives = 196/289 (68%), Gaps = 27/289 (9%)
 Frame = +3

Query  426   FSRP*KLWFSSYSSLRLMIRGITQVG--------KQ*GYCGPDPSISekqkk--------  557
             F R  +++F +   L L++   TQ+         K  GYCGPDP    + +         
Sbjct  175   FFRHLRMFFKTIKLLTLLVF-FTQIDESEDNCSWKAIGYCGPDPEFKAQLRNHFLHRTCK  233

Query  558   --qkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG------  707
               Q+  + ++D  E + GPLYKG++ LN P +   + L + G   SV + KP        
Sbjct  234   GGQESEEGDEDDAEQVIGPLYKGLVHLNCPRDITADALRRFGFPVSVTRRKPKAAANLSS  293

Query  708   PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLG  887
             PS VI+CDAVVVGSG GGG+++G+LA AGYKVLVLEKG Y AR+NLSLLEGP++D+M+  
Sbjct  294   PSLVIQCDAVVVGSGSGGGLVAGILAKAGYKVLVLEKGGYSARSNLSLLEGPTLDQMYQS  353

Query  888   GGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMD  1067
             GG+L T D+ + +L+GSTVGGGSA+NWSASIKTP +V +EWCE HGLELF S++Y +AMD
Sbjct  354   GGMLATDDMSVFVLSGSTVGGGSAINWSASIKTPQHVCKEWCEKHGLELFESELYREAMD  413

Query  1068  TVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
              VC KMGVQ E E+E F N +LR+GC+EL YPV  IP+N+PSDHYCGWC
Sbjct  414   VVCEKMGVQSEIEEEGFNNTILRRGCQELGYPVSTIPRNSPSDHYCGWC  462


 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 99/162 (61%), Gaps = 1/162 (1%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
            T +L   QM++LS L +T LP+IN+ +    D S   F+  SA+  GTP  V  VI++R+
Sbjct  56   TNSLCRRQMKSLSVLADTILPSINDFVAIKDDESAATFYHISASMAGTPELVGGVISERL  115

Query  230  K-HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
              HP    L  +LW LST +GT++LCG    ST+FPF+  FP +   KR+RI+ SW+ S 
Sbjct  116  NYHPMTWLLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQRIMQSWSLSF  175

Query  407  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
             + +R FF  +K L LLVFFT +D+  DN SWKAIG     P
Sbjct  176  FRHLRMFFKTIKLLTLLVFFTQIDESEDNCSWKAIGYCGPDP  217



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score =   196 bits (498),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 149/209 (71%), Gaps = 4/209 (2%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTK-LGCSVAKPKP---PGPSFVIECDAvvvgsgcgggvis  773
             PL KG+IDL+   E    +L +  G +V + +       ++ +ECDAVVVGSG GGGV +
Sbjct  192   PLEKGVIDLSSASEQDLPKLFQDRGFTVTEEENLSGKEKAWKVECDAVVVGSGSGGGVAA  251

Query  774   gvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  953
             GVLA AGY+V+VLEKG YYAR +L+LLEGPS D+M+  GG+L T D  ++++AG+TVGGG
Sbjct  252   GVLAKAGYRVIVLEKGKYYARDDLTLLEGPSFDQMYESGGILPTNDGKVLVMAGATVGGG  311

Query  954   SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVL  1133
             SA+NWSASI+TPP+VL+EW + HGL LF S  Y  AM+ VCG++GVQ  C  ESFQN VL
Sbjct  312   SAINWSASIRTPPHVLKEWSKQHGLPLFESHDYQDAMNAVCGRLGVQDGCSKESFQNSVL  371

Query  1134  RKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
               GC +L +    +P+N+  DH+CG C F
Sbjct  372   STGCAKLGFRFEKVPRNSTEDHFCGSCCF  400


 Score =   105 bits (262),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 98/177 (55%), Gaps = 8/177 (5%)
 Frame = +2

Query  14   YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTD---ASVTNFFQTSAAS  184
            + L R     + +  LS SQ+++L+A+C+ F+P+I    P T D     V +F++ S + 
Sbjct  10   HPLLRGGRRTSHSHGLSASQIKSLAAICDAFIPSI----PPTNDLQDPEVESFYRLSGSQ  65

Query  185  TGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  364
             G P QVA +I +R+K         LLW LSTR+GT LLCG  SL  +FP+L  F ++ Q
Sbjct  66   NGIPEQVAELIARRVKPIAFLMARWLLWLLSTRLGTWLLCGSASLKKEFPYLQPFSDVQQ  125

Query  365  KKRERIVHSWATS-SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
              RE+I+  W+    + F++  F   K   L  F+T  D+  +NP+WK IG    +P
Sbjct  126  VSREQILLDWSRGRRITFLKFAFKLFKICCLFTFYTVADENAENPAWKGIGYSPPKP  182



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score =   253 bits (645),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 162/318 (51%), Positives = 210/318 (66%), Gaps = 33/318 (10%)
 Frame = +3

Query  330   FPF--CYASLRFLRRRENV*FIHGPPAVCNSSEIFSRP*KLWFSSYSSLRLMIRGITQVG  503
             FPF   Y  L  L+R++          + + S  + RP +++F +   L L++   TQ+ 
Sbjct  170   FPFFHSYPELSLLKRQK---------VMQSWSLSYLRPLRMFFRTIKLLTLLVF-FTQLD  219

Query  504   --------KQ*GYCGPDPSISek------qkkqkhhdheddieeLLFGPLYKGIIDLNLP  641
                     K  GYCGPDP    +       K++   + EDD  E + GPLYKG+I +N P
Sbjct  220   EAEDNPSWKAIGYCGPDPEFKSQLKNHFFTKQRGQEEKEDDGTEDVRGPLYKGLIRINNP  279

Query  642   EEHVFNRLTKLGCSV-AKPKP------PGPSFVIECDAvvvgsgcgggvisgvLATAGYK  800
              + + + L ++G SV A PK         PS VI+CDAVVVGSG GGGV++GVLA AGYK
Sbjct  280   RDIITDSLRRVGFSVSATPKKTKASTLSSPSLVIKCDAVVVGSGSGGGVVAGVLANAGYK  339

Query  801   VLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASI  980
             VLVLEKG+Y AR NLSLLEGPSMD+M+L  GL+ T D+ +++LAGSTVGGGSA+NWSASI
Sbjct  340   VLVLEKGSYSARNNLSLLEGPSMDQMYLSNGLVATNDMSVLILAGSTVGGGSAINWSASI  399

Query  981   KTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCY  1160
             +TP +V +EWC+ H LELF S +Y +A+D VC KMGVQ E +DE F N VLR+GC E+ Y
Sbjct  400   RTPQHVCKEWCDRHELELFESMLYKEALDVVCEKMGVQSEIDDEGFNNAVLRRGCVEMGY  459

Query  1161  PVVNIPQNAPSDHYCGWC  1214
             PV NIP+NA SDHYCGWC
Sbjct  460   PVCNIPRNATSDHYCGWC  477


 Score =   149 bits (376),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAINE--ALPETTDASVTNFFQTSAASTGTPH  199
             K +    T +LSP QM++L ALC+T LP+IN    +  + D SV NF++TSA+  GTP 
Sbjct  67   EKEQRKPLTNSLSPRQMKSLVALCDTLLPSINNNNVVWGSDDESVANFYKTSASMAGTPE  126

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
             +  +I++++KHP    LLL LW LST  GT +LCG  SLST+FPF   +PE+S  KR++
Sbjct  127  HLGILISEKLKHPSTWLLLLTLWLLSTWFGTFILCGTLSLSTKFPFFHSYPELSLLKRQK  186

Query  380  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            ++ SW+ S L+ +R FF  +K L LLVFFT +D+  DNPSWKAIG     P
Sbjct  187  VMQSWSLSYLRPLRMFFRTIKLLTLLVFFTQLDEAEDNPSWKAIGYCGPDP  237



>gb|KHN11789.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=622

 Score =   249 bits (635),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 180/253 (71%), Gaps = 19/253 (8%)
 Frame = +3

Query  513   GYCGPDPSISekqkkq----------khhdheddieeLLFGPLYKGIIDLNLPEEHVFNR  662
             GYCGPDP    + K            +    ED+  E + GPLYKG++ LN P++   + 
Sbjct  21    GYCGPDPEFKAQLKNHFLDGTSKGGGQEDKEEDEDAEEMIGPLYKGLVHLNYPQDITADA  80

Query  663   LTKLG--CSVAKPKPPG-------PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLE  815
             L + G   SV + K          PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLE
Sbjct  81    LRRFGFPVSVIRRKHKAAAANLSCPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLE  140

Query  816   KGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPY  995
             KG Y A+ NLSLLEGP+MD+M+L GGL+ + D+ + +L+GSTVGGGSA+NWSA IKTP +
Sbjct  141   KGGYSAKNNLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIKTPQH  200

Query  996   VLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNI  1175
             V +EWC+ HGLELF S++Y +A+D VCGKMGVQ E EDE F N +LRKGC+E+ YPV NI
Sbjct  201   VCKEWCDKHGLELFESELYREALDAVCGKMGVQSEIEDEGFNNAILRKGCQEMGYPVNNI  260

Query  1176  PQNAPSDHYCGWC  1214
             P+N+PS+HYCGWC
Sbjct  261   PRNSPSNHYCGWC  273



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score =   253 bits (645),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 149/288 (52%), Positives = 193/288 (67%), Gaps = 26/288 (9%)
 Frame = +3

Query  426   FSRP*KLWFSSYSSLRLMIRGITQVG--------KQ*GYCGPDPSISekqk---------  554
             F R  +++F +   L L+I   TQV         K  GYCGPDP    + K         
Sbjct  191   FFRHLRMFFRTIKLLTLLIF-FTQVDESEDNCSWKAIGYCGPDPEFKAQLKNHFLHGACK  249

Query  555   kqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA--------KPKPPGP  710
             +++  +  D+  EL  GPLYKG++ LN P + + + L + G  V+         P    P
Sbjct  250   EKQDSEEGDNDAELAIGPLYKGLVHLNYPRDIIVDTLRRFGFPVSVSRRKQKTAPSLSSP  309

Query  711   SFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGG  890
             S V++CDAVVVGSG GGGV++G+LA AGYKVLVLEKG Y AR NLSLLEGP+MD+M+  G
Sbjct  310   SLVVQCDAVVVGSGSGGGVVAGILANAGYKVLVLEKGGYSARNNLSLLEGPTMDQMYQAG  369

Query  891   GLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDT  1070
             GL+ T D+++ +L+GSTVGGGSA+NWSA IKTP +V +EWCE HGLELF S++Y +AM+ 
Sbjct  370   GLVATDDMNIFILSGSTVGGGSAINWSACIKTPQHVCKEWCEKHGLELFESELYQEAMEA  429

Query  1071  VCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             VC KMGVQ E E+E F N +LRKGC+E+ YPV NIP+NA  DHYCGWC
Sbjct  430   VCEKMGVQSEIEEEGFNNAILRKGCQEMGYPVNNIPRNASPDHYCGWC  477


 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 112/169 (66%), Gaps = 1/169 (1%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAINEALP-ETTDASVTNFFQTSAASTGTPHQV  205
            + +  T   +LS  QM++L+ALC+T LP+IN+ +P    D S   F++ SA+  GTP ++
Sbjct  65   REKQKTLKNSLSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERL  124

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
              +I++R+ HP    L L+LWFLST +GT++LCG G LST+FPF+  FP++   KR++I+
Sbjct  125  GGIISERLIHPMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQIM  184

Query  386  HSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
             SW+ S  + +R FF  +K L LL+FFT VD+  DN SWKAIG     P
Sbjct  185  QSWSLSFFRHLRMFFRTIKLLTLLIFFTQVDESEDNCSWKAIGYCGPDP  233



>ref|XP_002519938.1| electron carrier, putative [Ricinus communis]
 gb|EEF42542.1| electron carrier, putative [Ricinus communis]
Length=710

 Score =   250 bits (639),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 161/208 (77%), Gaps = 2/208 (1%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSV--AKPKPPGPSFVIECDAvvvgsgcgggvi  770
             LFGPL++GI+D+NLP + V N L +LG S+   +PK      VI CDAVVVGSG GG V+
Sbjct  162   LFGPLHRGIVDMNLPRDAVANSLQRLGFSILANRPKKYYSPLVIRCDAVVVGSGSGGSVV  221

Query  771   sgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGG  950
             +G LA AGYKVLVLEKGNY+AR+NLSLLEGP+MD+M+L GGL+ T D+ +VLLAGSTVGG
Sbjct  222   AGALAKAGYKVLVLEKGNYFARSNLSLLEGPTMDQMYLSGGLMATDDMGVVLLAGSTVGG  281

Query  951   GSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMV  1130
             GS +NWSASIKTP +V+ EW   + LE+FGS +Y +A+D VC KMGVQ E   E F N +
Sbjct  282   GSTINWSASIKTPQHVISEWTNCYDLEIFGSKLYKEALDVVCEKMGVQSEIHVEGFNNEI  341

Query  1131  LRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             LRKGC EL YPV NIP+N+  DHYCGWC
Sbjct  342   LRKGCEELGYPVSNIPRNSAPDHYCGWC  369


 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +2

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            Q+  +I++R+KHPK   + L LW LST IGT +LCG  S+ST FP+   F +++  KRE+
Sbjct  7    QLGGLISERLKHPKKWLIRLALWMLSTWIGTFILCGVASISTHFPYFQSFSQLTLHKREK  66

Query  380  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            I+HSW+ S L  +R  F AMK L+LLVFF+ VD+K +N +WKAIG
Sbjct  67   ILHSWSLSFLYPLRMLFKAMKLLILLVFFSQVDEKNENLTWKAIG  111



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score =   249 bits (637),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 158/324 (49%), Positives = 208/324 (64%), Gaps = 37/324 (11%)
 Frame = +3

Query  327   SFPFCYASLRF-LRRRENV*FIHGPPAVCNSSEIFSRP*KLWFSSYSSLRLMIRGITQVG  503
              FPF +A     L++R+ +        + + S  + R  ++ F +   L L+I   TQ+ 
Sbjct  144   QFPFIHAYPHLSLQKRQKI--------MRSWSLSYLRHFRMLFRTIKLLTLLIF-FTQID  194

Query  504   --------KQ*GYCGPDPSISekqkkq----------khhdheddieeLLFGPLYKGIID  629
                     K  GYCGPDP    + K            +    ED+  E + GPLYKG++ 
Sbjct  195   ESEDNVAWKAIGYCGPDPEFKAQLKNHFLDGTSKGGGQEDKEEDEDAEEMIGPLYKGLVH  254

Query  630   LNLPEEHVFNRLTKLG--CSVAKPKPPG-------PSFVIECDAvvvgsgcgggvisgvL  782
             LN P++   + L + G   SV + K          PS VI+CDAVVVGSG GGGVI+GVL
Sbjct  255   LNYPQDITADALRRFGFPVSVIRRKHKAAAANLSCPSLVIQCDAVVVGSGSGGGVIAGVL  314

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AGYKVLVLEKG Y A+ NLSLLEGP+MD+M+L GGL+ + D+ + +L+GSTVGGGSA+
Sbjct  315   AKAGYKVLVLEKGGYSAKNNLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAI  374

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP +V +EWC+ HGLELF S++Y +A+D VCGKMGVQ E EDE F N +LRKG
Sbjct  375   NWSACIKTPQHVCKEWCDKHGLELFESELYREALDAVCGKMGVQSEIEDEGFNNAILRKG  434

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C+E+ YPV NIP+N+PS+HYCGWC
Sbjct  435   CQEMGYPVNNIPRNSPSNHYCGWC  458


 Score =   154 bits (389),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 110/161 (68%), Gaps = 0/161 (0%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
            T +LSP QM++L+ALC+T LP++ +   +++D SVT F+Q SA+ TGTP +   +I++R+
Sbjct  52   TNSLSPRQMKSLTALCDTILPSVADHFVDSSDESVTKFYQISASMTGTPERFGGMISERL  111

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
            KHP    L  +LW LST  GTL+ CG G LSTQFPF+  +P +S +KR++I+ SW+ S L
Sbjct  112  KHPLTGLLKFVLWLLSTWYGTLIFCGIGCLSTQFPFIHAYPHLSLQKRQKIMRSWSLSYL  171

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +  R  F  +K L LL+FFT +D+  DN +WKAIG     P
Sbjct  172  RHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDP  212



>gb|KDP37817.1| hypothetical protein JCGZ_06719 [Jatropha curcas]
Length=608

 Score =   245 bits (625),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 173/236 (73%), Gaps = 3/236 (1%)
 Frame = +3

Query  516   YCGPDPSISekqkkqkh-hdheddieeLLFGPLYKGIIDLNLPEEHVFN--RLTKLGCSV  686
             Y GPDP   ++Q+       + ++ +E LFGPLYKG+ID+NLP +   N  RL+      
Sbjct  32    YPGPDPEFKKEQEAALKLVKNNEEEKEKLFGPLYKGLIDMNLPRDITANSLRLSGFPVFT  91

Query  687   AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPS  866
              +PK   PS VI+CDAVVVGSG GG V++GVLA AGYKV+V+EKGNY+AR+NLSLLEGPS
Sbjct  92    YRPKINNPSLVIKCDAVVVGSGSGGSVVAGVLAKAGYKVVVIEKGNYFARSNLSLLEGPS  151

Query  867   MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1046
             MD+M+L  GL+ T D+ +V+LAGSTVGGGS +NWSASI+TP +V  EW   +GLE+F S 
Sbjct  152   MDQMYLSAGLMATDDMGVVVLAGSTVGGGSTINWSASIRTPQHVTDEWSNAYGLEIFDSK  211

Query  1047  VYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             +Y +A+D VC KMGVQ E  +E F N +LRKGC EL Y V  IP+N+ SDHYCGWC
Sbjct  212   LYKEALDVVCEKMGVQSEINEEGFNNAILRKGCEELGYNVNTIPRNSSSDHYCGWC  267



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score =   249 bits (635),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 201/311 (65%), Gaps = 36/311 (12%)
 Frame = +3

Query  384   FIHGPPAVCNSSEIFSRP*KLWFSSY-SSLRLMIRGI---------TQVG--------KQ  509
             FIH  P +  S E   +  + W  SY   LR + R I         TQ+         K 
Sbjct  151   FIHSYPDL--SVEKRQQIMRSWSLSYIRHLRQLFRTIKLLTLLIFFTQLDESEDNLSWKA  208

Query  510   *GYCGPDPSISek--------qkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRL  665
              GYCGPDP    +        + K+   D ED+  E + GPLYKG++ LN P +   + L
Sbjct  209   IGYCGPDPEFKAQLKNHFLEGKSKRGEEDKEDEDVEEVIGPLYKGLVHLNNPRDITADAL  268

Query  666   TKLG--CSVAKPKPPG------PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKG  821
              ++G   SV + K         PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG
Sbjct  269   RRIGFPVSVIRRKHKAAANLSSPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKG  328

Query  822   NYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVL  1001
              Y+AR NLSLLEG +MD+M+L GGL+ + D+ M +L+GSTVGGGSA+NWSASIKTP +V 
Sbjct  329   GYFARNNLSLLEGQTMDQMYLNGGLVASDDMGMFILSGSTVGGGSAINWSASIKTPQHVR  388

Query  1002  REWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQ  1181
             +EWCE HGLELFGS++Y +A+D VC KMGVQ E  DE F N VLRKGC+E+ YPV  IP+
Sbjct  389   KEWCEKHGLELFGSELYREALDAVCEKMGVQSEIGDEGFNNAVLRKGCQEMGYPVNTIPR  448

Query  1182  NAPSDHYCGWC  1214
             N+ SDHYCGWC
Sbjct  449   NSSSDHYCGWC  459


 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 109/161 (68%), Gaps = 1/161 (1%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
            T +LS  QM++LSALC+T LP+++   P ++D SV  F++ SA+  GTP     +I +++
Sbjct  57   TNSLSSRQMKSLSALCDTILPSLDH-FPHSSDESVNRFYRISASMAGTPQLFGGMICEKL  115

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
            KHP    L L+LW LST  GTL+LCG G +ST+FPF+  +P++S +KR++I+ SW+ S +
Sbjct  116  KHPMTGLLKLVLWALSTWFGTLILCGMGCVSTKFPFIHSYPDLSVEKRQQIMRSWSLSYI  175

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            + +R  F  +K L LL+FFT +D+  DN SWKAIG     P
Sbjct  176  RHLRQLFRTIKLLTLLIFFTQLDESEDNLSWKAIGYCGPDP  216



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score =   248 bits (633),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 171/242 (71%), Gaps = 8/242 (3%)
 Frame = +3

Query  516   YCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA--  689
             YCGPDP     + ++       + EEL F PLY+GI+++  P E +   L + G  V   
Sbjct  214   YCGPDPDFINNRTRETKTPQGHEHEEL-FEPLYRGIVNMRQPREALAETLRQSGFHVRLH  272

Query  690   -----KPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLL  854
                   P P  PS  I CDAVVVGSG GGGV +G+LA AGYKV VLEKGNY+ R NLSLL
Sbjct  273   PHRRYNPSPSHPSLTIRCDAVVVGSGSGGGVAAGILAKAGYKVAVLEKGNYFGRKNLSLL  332

Query  855   EGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLEL  1034
             EGPSMD+M+L GGL++T D+ +++LAGSTVGGGS +NWSASI+TP +V+REWC  + LEL
Sbjct  333   EGPSMDEMYLSGGLMVTDDMGVIMLAGSTVGGGSTINWSASIRTPQHVIREWCNEYELEL  392

Query  1035  FGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             FGS +Y +AMD VC +MGVQ + E+ES  N VLRKGC EL YPV+  P+N+P +HYCGWC
Sbjct  393   FGSKLYKEAMDVVCKRMGVQPDVEEESLSNTVLRKGCSELGYPVITAPRNSPPNHYCGWC  452

Query  1215  TF  1220
              F
Sbjct  453   CF  454


 Score =   129 bits (325),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 110/182 (60%), Gaps = 9/182 (5%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINEALPETT-----DASVTNFFQTSAASTGTPH  199
            E      +LSP QME L+A  +T LP++    P+       + S+  F++TSA+  GTP 
Sbjct  52   ERKPYVNSLSPRQMEVLTAFSDTLLPSV---FPDINCSGQLEDSLFKFYRTSASMAGTPE  108

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
             V   ++ +++HP L  LLL LW LST  GT +LCG  SLSTQFP+  RF ++SQKKRE+
Sbjct  109  LVGGFLSGKIEHPMLGVLLLALWLLSTWFGTFILCGIPSLSTQFPYFQRFSQVSQKKREK  168

Query  380  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP-FHF*KTKE  556
            I+ SW++SS    R  F  +K LV  +FFT VD+  +NP+W+ I      P F   +T+E
Sbjct  169  ILLSWSSSSFNIYRMLFKTLKYLVFFIFFTQVDENNENPTWRGIDYCGPDPDFINNRTRE  228

Query  557  TE  562
            T+
Sbjct  229  TK  230



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score =   248 bits (632),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 191/288 (66%), Gaps = 26/288 (9%)
 Frame = +3

Query  426   FSRP*KLWFSSYSSLRLMIRGITQVG--------KQ*GYCGPDPSISekqkkqkhhdhed  581
             + RP ++ F +   L L++   TQ+         K   YCGPDP    + K         
Sbjct  194   YLRPLRMLFRTIKLLTLLVF-FTQLDEAEDNPSWKAINYCGPDPEFKSQLKNHFFTKERG  252

Query  582   dieeL----------LFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-AKPKP------PGP  710
               E+           + GPLYKG+I +N P + + + L ++G SV A PK         P
Sbjct  253   QEEKEDEDYDDGTEDVRGPLYKGLIYINYPRDIITDSLRRVGFSVSATPKKTKASSLSSP  312

Query  711   SFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGG  890
             S VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKG+Y AR NLSLLEGPSMD+M+L  
Sbjct  313   SLVIQCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPSMDQMYLSN  372

Query  891   GLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDT  1070
             GL+ TKD+ +++LAGSTVGGGSA+NWSASI+TP +V +EWC+ H LELF S +Y +A+D 
Sbjct  373   GLVATKDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDGHELELFESKLYKEALDV  432

Query  1071  VCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             VC KMGVQ E +DE F N VLR+GC E+ YPV +IP+NA SDHYCGWC
Sbjct  433   VCEKMGVQSEIDDEGFNNAVLRRGCLEMGYPVCDIPRNASSDHYCGWC  480


 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 109/172 (63%), Gaps = 4/172 (2%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAINE----ALPETTDASVTNFFQTSAASTGTP  196
            K +    T +LSP QM++L ALC+T LP+IN           D SV NF++TSA+  GTP
Sbjct  65   KEQKKPLTNSLSPRQMKSLVALCDTLLPSINNNSNNVCGSDDDESVANFYKTSASMAGTP  124

Query  197  HQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRE  376
              +  +I+++++HP    LLL LW LST  GT +LCG  SLST+FPF   +PE+S  K++
Sbjct  125  EHLGILISEKLRHPSTWLLLLSLWLLSTWFGTFILCGMLSLSTKFPFFHSYPELSLLKQQ  184

Query  377  RIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +++ SW+ S L+ +R  F  +K L LLVFFT +D+  DNPSWKAI      P
Sbjct  185  KVMQSWSLSYLRPLRMLFRTIKLLTLLVFFTQLDEAEDNPSWKAINYCGPDP  236



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   190 bits (482),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 143/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ ++  +  +   L + G +V    P   ++ I CD V+ GSGCGGGV + VL
Sbjct  201   PLEKGIIETMDKTDSSLRQSLIEKGLAVTD-NPREHTYTINCDVVIAGSGCGGGVAAAVL  259

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G+KV+V+EKGNY+   + + LE PSMD+++  GG+L + D+ M+L+AGSTVGGGSAV
Sbjct  260   ASSGHKVVVVEKGNYFTAEDYTALEAPSMDQLYEAGGILSSLDVKMMLMAGSTVGGGSAV  319

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NW+A ++TP +VLREW E H L LF S  Y  AMD+VC ++GV  +C  E FQN VLR+G
Sbjct  320   NWAACVRTPDFVLREWAEEHHLRLFDSPTYTSAMDSVCARLGVTEKCTKEGFQNQVLRRG  379

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V ++P+N+  DHYCG C +
Sbjct  380   CQNLGLEVESVPRNSSEDHYCGTCCY  405


 Score =   104 bits (260),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 97/171 (57%), Gaps = 8/171 (5%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAAS  184
            R+ E       LS +QM TLSA+C TF+P +            E  D +V  FF  S + 
Sbjct  14   RRAEKGGYRHGLSAAQMRTLSAMCGTFVPTVPIEAACLGGGKDEAPDEAVEAFFLASGSD  73

Query  185  TGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  364
            +  P +VA ++ +R +   +  + L+LW L+TR+GTL+LCG  SLS +FPF+ +F ++  
Sbjct  74   SPVPDEVAELLVRRGQKEAVALVKLVLWVLATRLGTLVLCGSLSLSWRFPFINKFSDMPV  133

Query  365  KKRERIVHSW-ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +KRE I+  W    S  F+R  F  +K   L VF++  +++ +N +WKAIG
Sbjct  134  EKREHILMKWNREKSFIFLRLVFVIVKVFCLYVFYSMTNEEEENRAWKAIG  184



>gb|KDO72345.1| hypothetical protein CISIN_1g0039902mg, partial [Citrus sinensis]
Length=707

 Score =   243 bits (619),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 164/214 (77%), Gaps = 8/214 (4%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSV--------AKPKPPGPSFVIECDAvvvgsg  752
             L+GPLYKG+I++ LP   V + L ++G  V        A      PS VI+CDAVVVGSG
Sbjct  147   LYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNAAPSSIASPSLVIKCDAVVVGSG  206

Query  753   cgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  932
              GGG+I+GVLA AGYKVLVLEKG+Y AR+NLSLLEG +MD+M+L GG+L T D+ ++LLA
Sbjct  207   SGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLA  266

Query  933   GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDE  1112
             GSTVGGGS +NWSASIKTP +V  EWC+ + L+LF SD+Y +AM+ VC +MGVQ E E+E
Sbjct  267   GSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEEE  326

Query  1113  SFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
              F N VLR+GC+EL YPV NIP+N+P DHYCGWC
Sbjct  327   GFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWC  360


 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +2

Query  212  VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  391
            ++++R+KHPK   + L LW LST IG+L+LCG+   S++FP++  F ++ QKKR+ ++ S
Sbjct  4    LMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVS  63

Query  392  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            W+ S    +R  + AMK L+LLVFFT V++K +N SWKAIG
Sbjct  64   WSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIG  104



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score =   243 bits (621),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 148/281 (53%), Positives = 185/281 (66%), Gaps = 25/281 (9%)
 Frame = +3

Query  447   WFSSYSSL-RLMIRGI---------TQVG--------KQ*GYCGPDPSISekqkkqkhhd  572
             W SSY  L R+  R I         TQV         K  GY GP    S+ +++     
Sbjct  150   WASSYFILLRMFFRSIKLITAFVFFTQVDEKGNNVAWKAIGYNGPSSDHSDHEEEINEKT  209

Query  573   heddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECD  731
              + +  + +FGPLY GIIDL  P E V  +LT  G +V+  K          P   I+CD
Sbjct  210   TKKNKHDEIFGPLYNGIIDLKNPREAVTKKLTGHGFTVSTHKRTKNGSSISDPVMTIQCD  269

Query  732   AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  911
             AVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLSL EG ++D+M+L GGLL T D
Sbjct  270   AVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQALDEMYLSGGLLATTD  329

Query  912   LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGV  1091
             +D+V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGS +Y +AMD VC +MGV
Sbjct  330   MDVVILAGSTVGGGSTINWSASIKTPEHVMKEWSEKSELEMFGSHLYREAMDVVCERMGV  389

Query  1092  QRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             Q E  +E F N +LRKGC  L  PV NIP+NAPSDHYCG+C
Sbjct  390   QCEFLEEGFNNEILRKGCENLGLPVKNIPRNAPSDHYCGFC  430


 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 107/165 (65%), Gaps = 3/165 (2%)
 Frame = +2

Query  29   KMENNTAT---KTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPH  199
            + E+ T T    +++  +ME+L A+C+T +P+ + +     D  V  ++  SA+ TGTP 
Sbjct  26   RQEDETKTVYANSMTAREMESLVAICDTLIPSRDASEVGHLDDGVAGYYSASASHTGTPD  85

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            +VA ++++R+ HPK   L + LW LST IG+L++CG+ S + ++P+  RF  + + +RE 
Sbjct  86   RVARLMSERLHHPKKWILRVGLWSLSTWIGSLVMCGRRSFTGEYPYFRRFCWLPETQREE  145

Query  380  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            I+ +WA+S    +R FF ++K +   VFFT VD+KG+N +WKAIG
Sbjct  146  ILLNWASSYFILLRMFFRSIKLITAFVFFTQVDEKGNNVAWKAIG  190



>ref|XP_006482469.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Citrus sinensis]
Length=788

 Score =   243 bits (620),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 164/214 (77%), Gaps = 8/214 (4%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSV--------AKPKPPGPSFVIECDAvvvgsg  752
             L+GPLYKG+I++ LP   V + L ++G  V        A      PS VI+CDAVVVGSG
Sbjct  228   LYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNAAPSSIASPSLVIKCDAVVVGSG  287

Query  753   cgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  932
              GGG+I+GVLA AGYKVLVLEKG+Y AR+NLSLLEG +MD+M+L GG+L T D+ ++LLA
Sbjct  288   SGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGVLATDDMGVILLA  347

Query  933   GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDE  1112
             GSTVGGGS +NWSASIKTP +V  EWC+ + L+LF SD+Y +AM+ VC +MGVQ E E+E
Sbjct  348   GSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEEE  407

Query  1113  SFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
              F N VLR+GC+EL YPV NIP+N+P DHYCGWC
Sbjct  408   GFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWC  441


 Score =   150 bits (379),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 112/160 (70%), Gaps = 0/160 (0%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWV  214
            EN+    +LS  +ME+LSALC+TFLPA++     + D  + +FF+ SA++ GTP ++  +
Sbjct  26   ENHCYVNSLSSQEMESLSALCDTFLPAVDVKTAASIDKDIADFFRASASAAGTPERLGGL  85

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  394
            +++R+KHPK   + L LW LST IG+L+LCG+   S++FP++  F ++ QKKR+ ++ SW
Sbjct  86   MSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSW  145

Query  395  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            + S    +R  + AMK L+LLVFFT V++K +N SWKAIG
Sbjct  146  SLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIG  185



>ref|XP_006283178.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16076.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=598

 Score =   238 bits (606),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 158/213 (74%), Gaps = 7/213 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgc  755
             +FGPLY GI+DLN P E V  +LT  G +V+  K          P   I CDAVVVGSG 
Sbjct  44    IFGPLYNGIVDLNCPREAVTKKLTGRGFTVSSQKNKSKGSSLSNPVMTIRCDAVVVGSGS  103

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLA AGYKVLV+E GNYYAR+NLSLLEG +M+ M+L GGLL T D ++V+LAG
Sbjct  104   GGGVVAGVLAKAGYKVLVVESGNYYARSNLSLLEGQAMEDMYLSGGLLATSDTNVVILAG  163

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASIKTP +V++EW E   LE+FGSD+Y +AMD VC +MGVQ    +E 
Sbjct  164   STVGGGSTINWSASIKTPEHVMKEWTEKSKLEMFGSDLYREAMDVVCERMGVQCGFVEEG  223

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             F N +LRKGC EL  PV NIP+NAPSDHYCG C
Sbjct  224   FNNEILRKGCEELGLPVKNIPRNAPSDHYCGHC  256



>ref|XP_006430998.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
 gb|ESR44238.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
Length=780

 Score =   241 bits (615),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 166/214 (78%), Gaps = 8/214 (4%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA----KPKPP----GPSFVIECDAvvvgsg  752
             L+GPLYKG+I++ LP   V + L ++G  V+    +   P     PS VI+CDAVVVGSG
Sbjct  220   LYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNAAPISIASPSLVIKCDAVVVGSG  279

Query  753   cgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  932
              GGGVI+GVLA AGYKVLVLEKG+Y AR+NLSLLEG +MD+M+L GG+L T D+ ++LLA
Sbjct  280   SGGGVIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLA  339

Query  933   GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDE  1112
             GSTVGGGS +NWSASIKTP +V  EWC+ + L+LF SD+Y +AM+ VC ++GVQ E EDE
Sbjct  340   GSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERIGVQSEVEDE  399

Query  1113  SFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
              F N VLR+GC+EL YPV NIP+N+P DHYCGWC
Sbjct  400   GFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWC  433


 Score =   147 bits (372),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 109/160 (68%), Gaps = 0/160 (0%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWV  214
            EN+    +LS  +ME+LSALC+TFLPA++       D  + +FF+ SA++ GTP ++  +
Sbjct  19   ENHCYVNSLSSQEMESLSALCDTFLPAVDVKQAAAIDTDIADFFRASASAAGTPERLGGL  78

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  394
            +++R+KHPK   + L LW LST IG+L+LCG+   S++FP++  F ++ Q KRE ++ SW
Sbjct  79   MSERLKHPKKWLVRLCLWLLSTCIGSLILCGRYCFSSKFPYMHSFTQLPQNKREAVLVSW  138

Query  395  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            + S    +R  + AMK L+ LVFFT V++K +N SWKAIG
Sbjct  139  SLSYFYHLRMLYKAMKLLIFLVFFTQVNEKNENLSWKAIG  178



>ref|XP_008438494.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis melo]
Length=737

 Score =   193 bits (491),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 143/206 (69%), Gaps = 3/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ N   E  F + L + G  +A     G +  +ECD VVVGSGCGGGV + +L
Sbjct  191   PLQKGIIEPNNETESSFKKSLLQKGIRIAGDD--GHTLSVECDVVVVGSGCGGGVAAAIL  248

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKGNY+  ++ S LEGPS+++++  GG+  T D  M++LAGSTVGGGSAV
Sbjct  249   ASSGQKVMVLEKGNYFTASDYSSLEGPSLEQLYEAGGIFATDDGKMLILAGSTVGGGSAV  308

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E H +  FG+  Y  AMD VC ++GV  +CE+E FQN VLRKG
Sbjct  309   NWSASIRTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSEDCEEEGFQNQVLRKG  368

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  + +N+P+ HYCG C +
Sbjct  369   CENLGLKVEKVARNSPTGHYCGSCGY  394


 Score = 92.4 bits (228),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 92/167 (55%), Gaps = 1/167 (1%)
 Frame = +2

Query  14   YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGT  193
            + L R       T   S ++ME+L+++C+T LP +    P T+ A+   F+  S A +  
Sbjct  7    HPLLRGTRTGKFTHEFSTAEMESLTSICDTVLPPLPFNSPTTSTAAERAFYAVSGAQSPI  66

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
            P +VA +  +R     +  + ++LW L+TR+GTLLLCG      ++PF+ +F E+  K R
Sbjct  67   PDEVAEMARKRGLVEIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVWKFSEMPLKNR  126

Query  374  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            E  +  W  + +   IR     +K + L +FF+ VD  GDNPSW+AI
Sbjct  127  EEALRRWFKNKVFTPIRAALALIKLVSLYIFFSRVDVNGDNPSWEAI  173



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score =   240 bits (613),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 163/213 (77%), Gaps = 7/213 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLT--KLGCSVAKP--KPP---GPSFVIECDAvvvgsgc  755
             + GPLY+G++ LN P + + + L   K   SV  P  KP     PS VI+CD VVVGSG 
Sbjct  264   ILGPLYRGLVHLNHPCDIIADSLRRFKFHVSVTPPNNKPSTISSPSLVIQCDVVVVGSGS  323

Query  756   gggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  935
             GGGV++GVLA +GYKVLVLEKG+Y+AR N+SLLEGP+MD+M+L  GL+ T D+ +++LAG
Sbjct  324   GGGVVAGVLAKSGYKVLVLEKGSYFARNNVSLLEGPTMDQMYLSNGLIATTDMSVLILAG  383

Query  936   STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDES  1115
             STVGGGS +NWSASIKTP +V +EWC++H LELF S +Y +AMD VC KMGVQ + E+E 
Sbjct  384   STVGGGSTINWSASIKTPHHVCKEWCDIHELELFESTLYKEAMDVVCKKMGVQSDFEEEG  443

Query  1116  FQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             F N VLRKGC E+ YPV NIP+NAP +HYCGWC
Sbjct  444   FNNAVLRKGCHEMGYPVNNIPRNAPPNHYCGWC  476


 Score =   142 bits (358),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAI-NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  226
            T TLSP QM++L ALC+T +P+I    +  ++  SV NF++TSA+  GTP ++  +I ++
Sbjct  66   TNTLSPRQMKSLVALCDTIIPSIEGNNVVHSSHESVNNFYRTSASMAGTPQRLGILI-EK  124

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
            +KHP    L++ LW LST  GTL+LCGK SLST FPF   FP++S + R+ ++  W+ S 
Sbjct  125  LKHPSTRLLMVTLWLLSTWFGTLILCGKASLSTNFPFFRSFPDLSSETRQNVMKCWSQSY  184

Query  407  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
               +R FF  +K L LLVFFT +D++ +NPSWKAIG
Sbjct  185  FHHLRMFFRTIKLLTLLVFFTQLDEEENNPSWKAIG  220



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score =   238 bits (608),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 181/281 (64%), Gaps = 25/281 (9%)
 Frame = +3

Query  447   WFSSYSSL-RLMIRGI---------TQVG--------KQ*GYCGPDPSISekqkkqkhhd  572
             W SSY  L R++ R I         TQV         K  GY GP    S+  ++     
Sbjct  107   WASSYFLLLRMLFRSIKLITSLVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHDEELNEKK  166

Query  573   heddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECD  731
              +    E +FGPLY GIIDL  P E V  +LT  G  V   K          P   I+CD
Sbjct  167   TKKKKPEEIFGPLYNGIIDLKNPREAVVKKLTGHGFRVLTQKRNKNGSSISDPVMTIQCD  226

Query  732   AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  911
             AVVVGSG GGGV++GVLA AGYKVLV+EKGNYYAR  LSLLEG +MD+M+L GGLL T D
Sbjct  227   AVVVGSGSGGGVVAGVLAKAGYKVLVVEKGNYYARNKLSLLEGQAMDEMYLSGGLLATSD  286

Query  912   LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGV  1091
             +++V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGSD+Y KAMD VC +MGV
Sbjct  287   MNVVILAGSTVGGGSTINWSASIKTPEHVMKEWSENSELEMFGSDLYRKAMDVVCERMGV  346

Query  1092  QRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             Q    +E F N +LRKGC EL   V NIP+N+PSDHYCG+C
Sbjct  347   QCGFVEEGFNNEILRKGCEELGLTVKNIPRNSPSDHYCGFC  387


 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 98/147 (67%), Gaps = 0/147 (0%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  253
            ME+L A+C+T +P+I+ +     D  V  ++  SA+ TG P +VA +I++R+ HPK   L
Sbjct  1    MESLVAICDTLIPSIDGSEVGHVDDGVAGYYSASASQTGAPDRVARLISERLDHPKKWIL  60

Query  254  llllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  433
               +W LST IG+L+LCG+ S +++FP+  RF  + +K+RE I+ +WA+S    +R  F 
Sbjct  61   RAAMWSLSTWIGSLVLCGRRSFTSEFPYFQRFCRLPEKQREEILLNWASSYFLLLRMLFR  120

Query  434  AMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++K +  LVFFT VD+KG N +WKAIG
Sbjct  121  SIKLITSLVFFTQVDEKGKNLAWKAIG  147



>ref|XP_010023906.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Eucalyptus grandis]
 gb|KCW60304.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=776

 Score =   187 bits (475),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 143/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ N   +  +   L + G  V +       + I+CDAV+VGSGCGGGV + VL
Sbjct  208   PLEKGIIETNYSTDLGLLQSLKQKGLEVTQ-DSKNKIYRIKCDAVIVGSGCGGGVAAAVL  266

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A  GYKV+VLEKGNYY   + S LEGPSMD+++  GG+L +   ++++LAGSTVGGGSAV
Sbjct  267   AGCGYKVVVLEKGNYYTHKDYSSLEGPSMDQLYESGGILPSCTANVLILAGSTVGGGSAV  326

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL++W E HG+ELFGS  Y  AMD VC ++GV   C ++SFQN VL++G
Sbjct  327   NWSASIRTPHAVLQDWAEKHGMELFGSKEYASAMDIVCKRIGVTDRCVEQSFQNKVLQEG  386

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   +  +P+N+  DHYCG C +
Sbjct  387   CEKLGLEINAVPRNSSEDHYCGSCGY  412


 Score = 95.9 bits (237),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 90/166 (54%), Gaps = 13/166 (8%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAIN------------EALPETTDASVTNFFQTSAASTGTPH  199
            + S  +ME L+A+C T  P ++            E   +  D +V  F+++S +    P 
Sbjct  26   SFSSREMEALAAICETVFPPLSGAAAAGAAGGEFEGRIDREDEAVRFFYESSGSQAPVPQ  85

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            +VA ++ +R     +  + ++L  LSTR+GTLLLCG   +  ++P++  F  +   +RE+
Sbjct  86   EVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGSLCVGGRWPYVNTFSSMGSDQREK  145

Query  380  IVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++  W     L  IR+ F  +K + L V F+ VD+KG+NP WKAIG
Sbjct  146  VLRGWLKHRFLTPIRSAFVYLKVMCLYVLFSRVDEKGENPLWKAIG  191



>gb|KCW60303.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=781

 Score =   187 bits (475),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 143/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ N   +  +   L + G  V +       + I+CDAV+VGSGCGGGV + VL
Sbjct  208   PLEKGIIETNYSTDLGLLQSLKQKGLEVTQ-DSKNKIYRIKCDAVIVGSGCGGGVAAAVL  266

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A  GYKV+VLEKGNYY   + S LEGPSMD+++  GG+L +   ++++LAGSTVGGGSAV
Sbjct  267   AGCGYKVVVLEKGNYYTHKDYSSLEGPSMDQLYESGGILPSCTANVLILAGSTVGGGSAV  326

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL++W E HG+ELFGS  Y  AMD VC ++GV   C ++SFQN VL++G
Sbjct  327   NWSASIRTPHAVLQDWAEKHGMELFGSKEYASAMDIVCKRIGVTDRCVEQSFQNKVLQEG  386

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   +  +P+N+  DHYCG C +
Sbjct  387   CEKLGLEINAVPRNSSEDHYCGSCGY  412


 Score = 95.9 bits (237),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 90/166 (54%), Gaps = 13/166 (8%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAIN------------EALPETTDASVTNFFQTSAASTGTPH  199
            + S  +ME L+A+C T  P ++            E   +  D +V  F+++S +    P 
Sbjct  26   SFSSREMEALAAICETVFPPLSGAAAAGAAGGEFEGRIDREDEAVRFFYESSGSQAPVPQ  85

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            +VA ++ +R     +  + ++L  LSTR+GTLLLCG   +  ++P++  F  +   +RE+
Sbjct  86   EVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGSLCVGGRWPYVNTFSSMGSDQREK  145

Query  380  IVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++  W     L  IR+ F  +K + L V F+ VD+KG+NP WKAIG
Sbjct  146  VLRGWLKHRFLTPIRSAFVYLKVMCLYVLFSRVDEKGENPLWKAIG  191



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 182/281 (65%), Gaps = 26/281 (9%)
 Frame = +3

Query  447   WFSSYSSL-RLMIRGI---------TQVG--------KQ*GYCGPDPSISekqkkqkhhd  572
             W SSY SL R++ R I         TQV         K  GY GP P  S+ + +     
Sbjct  107   WSSSYFSLLRMLFRTIKLISALVFFTQVDEKGRNLAWKAIGYNGPSPDHSDHEVELNEEK  166

Query  573   heddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECD  731
              +   E  +FGPLY GI+DL  P E V  +L   G +V+  K          P   I+CD
Sbjct  167   KKKKPE-EIFGPLYNGIVDLKSPREAVEKKLAGRGFAVSNQKRNTNGSSISDPVMKIQCD  225

Query  732   AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  911
             AVVVGSG GGGV +GVLA AGYKVLV+E GNYYAR+ LSLLEG +MD M+L GGLL T D
Sbjct  226   AVVVGSGSGGGVAAGVLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMYLSGGLLATSD  285

Query  912   LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGV  1091
              ++V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGSD+Y +AMD VC +MGV
Sbjct  286   TNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSKLEMFGSDLYREAMDVVCKRMGV  345

Query  1092  QRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             Q    +E F N VLRKGC +L  PV NIP+NAPSDHYCG+C
Sbjct  346   QCGFVEEGFNNEVLRKGCEKLGLPVKNIPRNAPSDHYCGFC  386


 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 99/155 (64%), Gaps = 0/155 (0%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  253
            ME+L A+C+TF+ +I+++     D  V  +F  SA+ TGTP +VA ++++R+ HPK   L
Sbjct  1    MESLVAICDTFISSIDDSGVGHVDDCVAGYFSASASQTGTPDRVARLMSERLHHPKKWIL  60

Query  254  llllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  433
               LW LST IG+L+LCG  S + +FP+  RF  + +K+RE I+ +W++S    +R  F 
Sbjct  61   RAGLWLLSTWIGSLVLCGWRSFTGEFPYFRRFCRLPEKRREEILLNWSSSYFSLLRMLFR  120

Query  434  AMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRPFH  538
             +K +  LVFFT VD+KG N +WKAIG     P H
Sbjct  121  TIKLISALVFFTQVDEKGRNLAWKAIGYNGPSPDH  155



>ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis sativus]
Length=738

 Score =   189 bits (479),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 142/206 (69%), Gaps = 3/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ N   E  F + L + G  +A     G +  +ECD VVVGSGCGGGV + +L
Sbjct  192   PLEKGIIEPNNETESSFKKSLLQKGIRIAGDD--GHTLSVECDVVVVGSGCGGGVAAAIL  249

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV++LEKGNY+  ++ S LEGPS+++++  G +  T D  +++LAGSTVGGGSAV
Sbjct  250   ASSGQKVMILEKGNYFIASDYSSLEGPSLEQLYEAGAIFATDDGKVLILAGSTVGGGSAV  309

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP +VL+EW E H +  FG+  Y  AMD VC ++GV  +CE+E FQN VLRKG
Sbjct  310   NWSASIKTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSEDCEEEGFQNQVLRKG  369

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+ + HYCG C +
Sbjct  370   CENLGLKVEKVPRNSTTGHYCGSCGY  395


 Score = 94.0 bits (232),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
            T   S ++M+TL+++C+T LP +    P TT  +   F+Q S A +  P +VA    +R 
Sbjct  20   THGFSTAEMDTLTSICDTLLPPLPFNSPTTTTPAEKAFYQVSGAQSPIPEEVAETARKRG  79

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
                +  + ++LW L+TR+GTLLLCG      ++PF+ +F E+  +KRE  +  W  + +
Sbjct  80   LIEIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRWFKNKV  139

Query  410  -QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
               +R     +K + L VFF+ VD  GDNPSW+AI
Sbjct  140  FTPVRAALALIKLVFLYVFFSRVDVNGDNPSWEAI  174



>emb|CDX98615.1| BnaA03g44000D [Brassica napus]
Length=663

 Score =   234 bits (597),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 146/283 (52%), Positives = 181/283 (64%), Gaps = 25/283 (9%)
 Frame = +3

Query  447   WFSSYSSL-RLMIRGI---------TQVG--------KQ*GYCGPDPSISekqkkqkhhd  572
             W SSY  L R+  R I         TQV         K  GY GP    S+ +++     
Sbjct  150   WASSYFLLLRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHEEELNETK  209

Query  573   heddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG-------PSFVIECD  731
                 + + +FGPLY GII+L  P E V  +LT  G +V+  K          P   I CD
Sbjct  210   TNKKMPKEIFGPLYNGIINLKKPREAVTKKLTDHGFTVSTQKSNNNRSSISNPVMTIRCD  269

Query  732   AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  911
             AVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLS LEG +MD+M+L GGLL T D
Sbjct  270   AVVVGSGSGGGVVAGLLAKAGYKVLVVEKGNYYARSNLSQLEGQAMDEMYLSGGLLATSD  329

Query  912   LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGV  1091
             +++V+LAGSTVGGGS +NWSASIKTP +V++EW E   LELF SD+Y +AMD VC +MGV
Sbjct  330   MNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSELELFESDLYREAMDVVCERMGV  389

Query  1092  QRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             Q    +E F N VLRKGC EL   V NIP+NA  DHYCG+C+ 
Sbjct  390   QCGFVEEGFNNEVLRKGCEELGLKVKNIPRNASKDHYCGFCSL  432


 Score =   132 bits (331),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 101/153 (66%), Gaps = 0/153 (0%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            +L+  +ME+L A+C+T +P+++ A     D  V  ++  SA+ TGTP +VA +++QR+ H
Sbjct  38   SLTAREMESLVAICDTLIPSLDGAEVGHLDDGVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
            PK   L + LW LST IG+L+LCG+ S    FPF  RF  + +K+RE  + +WA+S    
Sbjct  98   PKKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREETLLNWASSYFLL  157

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +R FF ++K +  LVFFT VD+KG N +WKAIG
Sbjct  158  LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIG  190



>emb|CAA18625.1| putative protein [Arabidopsis thaliana]
 emb|CAB78940.1| putative protein [Arabidopsis thaliana]
Length=678

 Score =   234 bits (597),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 178/268 (66%), Gaps = 13/268 (5%)
 Frame = +3

Query  447   WFSSYSSL-----RLMIRGITQVGKQ*GYCGPDPSISekqkkqkhhdheddieeLLFGPL  611
             +FS+ +S      R+  +G     K  GY GP P  S+ + +      +   E  +FGPL
Sbjct  72    YFSASASQTGTPDRVDEKGRNLAWKAIGYNGPSPDHSDHEVELNEEKKKKKPE-EIFGPL  130

Query  612   YKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgcgggvi  770
             Y GI+DL  P E V  +L   G +V+  K          P   I+CDAVVVGSG GGGV 
Sbjct  131   YNGIVDLKSPREAVEKKLAGRGFAVSNQKRNTNGSSISDPVMKIQCDAVVVGSGSGGGVA  190

Query  771   sgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGG  950
             +GVLA AGYKVLV+E GNYYAR+ LSLLEG +MD M+L GGLL T D ++V+LAGSTVGG
Sbjct  191   AGVLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMYLSGGLLATSDTNVVILAGSTVGG  250

Query  951   GSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMV  1130
             GS +NWSASIKTP +V++EW E   LE+FGSD+Y +AMD VC +MGVQ    +E F N V
Sbjct  251   GSTINWSASIKTPEHVMKEWAEKSKLEMFGSDLYREAMDVVCKRMGVQCGFVEEGFNNEV  310

Query  1131  LRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             LRKGC +L  PV NIP+NAPSDHYCG+C
Sbjct  311   LRKGCEKLGLPVKNIPRNAPSDHYCGFC  338



>gb|KEH15695.1| long-chain-alcohol oxidase FAO1, partial [Medicago truncatula]
Length=653

 Score =   181 bits (459),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 138/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII++    +    + L+  G +V           I+CDAVVVGSGCGGGV + VL
Sbjct  196   PLEKGIIEIMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAVVVGSGCGGGVAASVL  254

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             + AGYKV+VLEKGNY+   + S LEGPSMD+ +  GG+L + D  +++LAGSTVGGGSAV
Sbjct  255   SKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYENGGILASIDSRILILAGSTVGGGSAV  314

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E H L LF S  Y  AM+TVC ++GV   C  E FQN VLRKG
Sbjct  315   NWSACIKTPEKVLKEWSEKHKLSLFDSIEYLSAMETVCERIGVNENCTQEGFQNQVLRKG  374

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V  +P+N+P +HYCG C +
Sbjct  375   CQNLGLKVDYVPRNSPGNHYCGSCGY  400


 Score = 97.8 bits (242),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 101/167 (60%), Gaps = 9/167 (5%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAI--NEALPETTDAS--VTNFFQTSAASTGTPHQ  202
            EN+      S ++ME+L+++C   LP++  ++AL +  ++S  V +FF  SA+    P +
Sbjct  14   ENSKYKHGFSVAEMESLTSICEVVLPSLPMDDALTKDDESSKDVQSFFNISASMYPIPDE  73

Query  203  VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  382
            VA ++ +      +  + ++LW L+TR+GTLL+CG   LS ++PF+  F  +S  KRE+I
Sbjct  74   VAEMLVKSGVTEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKI  133

Query  383  VHSWATSSLQFIRNF---FTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            V       L+F+  F   F  +K L L VFF+ VD+ GDNP+WKAIG
Sbjct  134  VQR--ALKLRFLTPFRLAFAYIKVLCLFVFFSWVDENGDNPAWKAIG  178



>gb|AES89853.2| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=754

 Score =   181 bits (459),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 138/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII++    +    + L+  G +V           I+CDAVVVGSGCGGGV + VL
Sbjct  196   PLEKGIIEIMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAVVVGSGCGGGVAASVL  254

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             + AGYKV+VLEKGNY+   + S LEGPSMD+ +  GG+L + D  +++LAGSTVGGGSAV
Sbjct  255   SKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYENGGILASIDSRILILAGSTVGGGSAV  314

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E H L LF S  Y  AM+TVC ++GV   C  E FQN VLRKG
Sbjct  315   NWSACIKTPEKVLKEWSEKHKLSLFDSIEYLSAMETVCERIGVNENCTQEGFQNQVLRKG  374

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V  +P+N+P +HYCG C +
Sbjct  375   CQNLGLKVDYVPRNSPGNHYCGSCGY  400


 Score = 97.8 bits (242),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 96/165 (58%), Gaps = 5/165 (3%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAI--NEALPETTDAS--VTNFFQTSAASTGTPHQ  202
            EN       S ++ME+L+++C    P++  ++AL +  ++S  V +FF  SA+    P +
Sbjct  14   ENRKYKHGFSVAEMESLTSICEVMFPSLPMDDALTKDDESSKDVQSFFNISASKYPIPDE  73

Query  203  VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  382
            VA +  +R     +  + ++LW L+TR+GTLL+CG   LS ++PF+  F  +S  KRE+I
Sbjct  74   VAEMFEKRAVIEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKI  133

Query  383  VHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            V        L   R  F  +K L L VFF+ VD+ GDNP+WKAIG
Sbjct  134  VQRGLKHKFLTPFRLAFVYIKILCLFVFFSWVDENGDNPAWKAIG  178



>emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
Length=741

 Score =   192 bits (487),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 142/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +   E  +   L + G  V K  P    + I+CD VVVGSGCGGGV + VL
Sbjct  192   PLQKGMVETMQETESTLVQSLNQKGLKVVK-DPEQKLYKIKCDVVVVGSGCGGGVAAAVL  250

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G+KV+VLEKGNY+  T+ S LEGPSM+++F  GG+L T D  M++LAGSTVGGGSA+
Sbjct  251   ASSGHKVVVLEKGNYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGSTVGGGSAI  310

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VL+EW E H L LFGS  Y  AMD VC ++GV   C +E FQN VLRKG
Sbjct  311   NWSASIKTPKSVLQEWAEDHKLPLFGSSQYFSAMDAVCERIGVTETCAEEGFQNQVLRKG  370

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+   HYCG C++
Sbjct  371   CENLGLKVDLVPRNSSEKHYCGSCSY  396


 Score = 85.9 bits (211),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 86/157 (55%), Gaps = 2/157 (1%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  226
            T   S ++M++L+++C   LP +   ++       V +F+Q S +    P + A +  +R
Sbjct  19   THGFSSAEMQSLASICEVLLPPLPLNSIEGQPSKGVQSFYQASGSQHPIPDEGAELFVKR  78

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
                 +  + ++L  LSTR+GTLLLCG  S S ++PF+  F  IS +KRE+I+  W    
Sbjct  79   ALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNFSSISLEKREKILQRWFRHR  138

Query  407  LQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            L   IR  F  +K L L  FFT  D+  +N +W+AIG
Sbjct  139  LLTPIRLAFVYIKFLCLYAFFTLADENSENAAWEAIG  175



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score =   233 bits (594),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 144/283 (51%), Positives = 182/283 (64%), Gaps = 25/283 (9%)
 Frame = +3

Query  447   WFSSYSSL-RLMIRGI---------TQVG--------KQ*GYCGPDPSISekqkkqkhhd  572
             W SSY  L R+  R I         TQV         K  GY GP    S+ +++     
Sbjct  150   WASSYFLLLRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHEEELNETK  209

Query  573   heddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECD  731
                ++ + +FGPLY GII+L  P E V  +LT  G +++  K          P   I CD
Sbjct  210   TNKNMPKEIFGPLYNGIINLKKPREAVTKKLTGHGFTISTQKSNKKRSSISNPVMTIRCD  269

Query  732   AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  911
             AVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLS LEG +MD+M+L GGLL T D
Sbjct  270   AVVVGSGSGGGVVAGLLAKAGYKVLVVEKGNYYARSNLSQLEGQAMDEMYLSGGLLATSD  329

Query  912   LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGV  1091
             +++V+LAGSTVGGGS +NWSASIKTP +V++EW E   LELF S++Y +AMD VC +MGV
Sbjct  330   MNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSELELFESNLYREAMDVVCERMGV  389

Query  1092  QRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             Q    +E F N VLRKGC EL   V NIP+NA  DHYCG+C+ 
Sbjct  390   QCGFVEEGFNNEVLRKGCEELGLQVKNIPRNASKDHYCGFCSL  432


 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 101/153 (66%), Gaps = 0/153 (0%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            +L+  +ME+L A+C+T +P+++ A     D  V  ++  SA+ TGTP +VA +++QR+ H
Sbjct  38   SLTAREMESLVAICDTLIPSLDGAEVGHLDDGVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
            PK   L + LW LST IG+L+LCG+ S    FP+  RF  + +K+RE  + +WA+S    
Sbjct  98   PKKWILRVGLWSLSTWIGSLVLCGQRSFIGGFPYFQRFCRLPKKQREETLLNWASSYFLL  157

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +R FF ++K +  LVFFT VD+KG N +WKAIG
Sbjct  158  LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIG  190



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score =   233 bits (594),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 145/283 (51%), Positives = 182/283 (64%), Gaps = 25/283 (9%)
 Frame = +3

Query  447   WFSSYSSL-RLMIRGI---------TQVG--------KQ*GYCGPDPSISekqkkqkhhd  572
             W SSY  L R+  R I         TQV         K  GY GP    S+ +++     
Sbjct  150   WASSYFLLLRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHEEELNETK  209

Query  573   heddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG-------PSFVIECD  731
                ++ + +FGPLY GII+L  P E V  +LT  G +V+  K          P   I CD
Sbjct  210   TNKEMPKEIFGPLYNGIINLKKPREAVTKKLTDHGFTVSTQKSNNNRSSISNPVMTIRCD  269

Query  732   AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  911
             AVVVGSG GGGV++G+LA AG+KVLV+EKGNYYAR+NLS LEG +MD+M+L GGLL T D
Sbjct  270   AVVVGSGSGGGVVAGLLAKAGFKVLVVEKGNYYARSNLSQLEGQAMDEMYLSGGLLATSD  329

Query  912   LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGV  1091
             +++V+LAGSTVGGGS +NWSASIKTP +V++EW E   LELF SD+Y +AMD VC +MGV
Sbjct  330   MNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSELELFESDLYREAMDVVCERMGV  389

Query  1092  QRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             Q    +E F N VLRKGC EL   V NIP+NA  DHYCG+C+ 
Sbjct  390   QCGFVEEGFNNEVLRKGCEELGLKVKNIPRNASKDHYCGFCSL  432


 Score =   132 bits (332),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 101/153 (66%), Gaps = 0/153 (0%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            +L+  +ME+L A+C+T +P+I+ A     D  V  ++  SA+ TGTP +VA +++QR+ H
Sbjct  38   SLTAREMESLVAICDTLIPSIDGAEVGHLDDGVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
            P+   L + LW LST IG+L+LCG+ S    FPF  RF  + +K+RE  + +WA+S    
Sbjct  98   PRKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREETLLNWASSYFLL  157

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +R FF ++K +  LVFFT VD+KG N +WKAIG
Sbjct  158  LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIG  190



>ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=743

 Score =   179 bits (453),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+ID N   +  + + L + G  V +  P    + I+CD V+VGSGCGGGV + VL
Sbjct  197   PLQKGLIDTNQETDSTLLHSLKEKGLRVTQ-DPRKNLYKIKCDVVIVGSGCGGGVAAAVL  255

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV VLEKGNY+  T+ S LEGPSMD+++  GG L T D +M+++AGS VGGGSAV
Sbjct  256   AASGQKVFVLEKGNYFTATDYSGLEGPSMDQLYESGGKLATTDAEMLIMAGSAVGGGSAV  315

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VL+EW     + LFGS  Y  AMD VC ++GV   C +E FQN VLRKG
Sbjct  316   NWSASIKTPNSVLQEWTGTQKIPLFGSSEYFSAMDAVCTRIGVTESCGEEGFQNQVLRKG  375

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L  PV  +P+N+   HYCG C +
Sbjct  376   CESLGIPVKTVPRNSSERHYCGSCGY  401


 Score = 98.6 bits (244),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 91/157 (58%), Gaps = 6/157 (4%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAIN-----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  223
            LS ++ME+LS+LC T LP+++     +        +V  F++ SA+ T  P ++A ++ +
Sbjct  23   LSSAEMESLSSLCETILPSLSPIPKFDGKQNQPTKAVQAFYRASASQTPMPDEMAELLTK  82

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R     +  + L+LW LSTR+GT LLCG      ++P+   F  I   KRER++  W   
Sbjct  83   RGLPEAVFMVRLVLWLLSTRLGTFLLCGSLCFGEKWPYFKNFSSIPLDKRERVLQKWFKH  142

Query  404  SL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
                 IR  F  +K LVL VFF+ VD+KGDNP+W+AI
Sbjct  143  RFFTPIRTAFVYVKILVLYVFFSRVDEKGDNPAWEAI  179



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score =   233 bits (594),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 180/295 (61%), Gaps = 37/295 (13%)
 Frame = +3

Query  447   WFSSYSSL-RLMIRGI---------TQVG--------KQ*GYCGPDPSISekqkkqkhhd  572
             W  SY SL R++ R +         TQV         K  GYCGPDP      +  K   
Sbjct  145   WSLSYFSLIRMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDPDFKTLYRANKTAQ  204

Query  573   heddieeL-------------LFGPLYKGIIDLNLPEEHVFN--RLTKLGCSVAKPKPPG  707
                    +               GPLY+G+I++  P E V    RL+    S+   K   
Sbjct  205   PNGYGRSIYQREQEEEDDREDFNGPLYRGLINVKRPREVVAEALRLSGFSISIHSRKHET  264

Query  708   PS----FVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDK  875
             P+     +I CDAVV+GSG GGGV +GVLA AGYKVLVLEKGNY AR+NLSLLEGP++D+
Sbjct  265   PNSSSPLIIRCDAVVIGSGSGGGVAAGVLAKAGYKVLVLEKGNYCARSNLSLLEGPTLDQ  324

Query  876   MFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYX  1055
             M+L GG+L T D  +++LAGSTVGGGS +NWSASI+TP +V +EWC+ H LELF S +Y 
Sbjct  325   MYLYGGMLATDDTGVIILAGSTVGGGSTINWSASIRTPQHVRKEWCDQHELELFDSQLYK  384

Query  1056  KAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             +AMD VC KMGVQ E  +E   N VLR+GC+EL YPV +IP+N+   HYCGWC F
Sbjct  385   EAMDVVCEKMGVQSEIYEEGLNNAVLRRGCQELGYPVTDIPRNSQPKHYCGWCCF  439


 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 102/158 (65%), Gaps = 1/158 (1%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  238
            LS  +ME+L A+ +TFLP++ EA      A V  F++TSA+  GTPH V  +I++R++HP
Sbjct  35   LSSREMESLIAISDTFLPSV-EAPHNAAHAYVDKFYRTSASMAGTPHIVGGLISERLEHP  93

Query  239  KlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  418
            KL    ++LW LST  GT ++CG  S+S+ FP+   FP++S  KR  IV SW+ S    I
Sbjct  94   KLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEIVLSWSLSYFSLI  153

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            R  F ++K + LLVFFT VD+K +N +WKAIG     P
Sbjct  154  RMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDP  191



>ref|XP_010920358.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=756

 Score =   194 bits (493),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 146/206 (71%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ ++  +  +   L+K G +V++  P    + I+CD  +VGSGCGGGV + VL
Sbjct  205   PLEKGVIETMDQTDSSLLQSLSKKGLAVSQ-DPIQNLYDIKCDVAIVGSGCGGGVAAAVL  263

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG+KV+V+EKGNY+   + + +E PSM++M+  GG+L T D  M+L+AGSTVGGGSAV
Sbjct  264   ASAGHKVVVIEKGNYFTSEDYTSIEAPSMNEMYECGGILSTTDGKMLLMAGSTVGGGSAV  323

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP YVL+EW E H L LFGS  Y  AMDTVC ++GV   C +E FQN VLRKG
Sbjct  324   NWSACIKTPDYVLKEWAEEHQLPLFGSTDYLSAMDTVCKRLGVTENCTEEGFQNKVLRKG  383

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             CR L   V ++P+NA   H+CG C++
Sbjct  384   CRNLGLQVDSVPRNASESHFCGSCSY  409


 Score = 80.5 bits (197),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 90/171 (53%), Gaps = 8/171 (5%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPA-------INEALPETTDASVTNFFQTSAAS  184
            R+ E    +   SPSQ+++L+A+C  F+P+       +     +    S+  F++ S + 
Sbjct  18   RRREKGDYSHGFSPSQIQSLAAMCEAFVPSLPMEEFHVTSGKEDPPTKSLQAFYRASGSE  77

Query  185  TGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  364
               P +VA ++ +R     L  + L+LW L+T++GTL+LC   SL  +FPF+ +F ++  
Sbjct  78   FPMPDEVAELMVKRGLKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFPFINKFSDMPI  137

Query  365  KKRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +KRE     W   +    +R  F  +K   L +F++  ++  +N SW AIG
Sbjct  138  EKREEAFKRWNKENFFTPLRLVFVMVKVFCLYIFYSMTNENSENQSWNAIG  188



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   230 bits (586),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 180/281 (64%), Gaps = 27/281 (10%)
 Frame = +3

Query  447   WFSSYSSL-RLMIRGI---------TQVG--------KQ*GYCGPDPSISekqkkqkhhd  572
             W SSY SL R+  R I         TQV         K  GY GP    S+ + +     
Sbjct  107   WSSSYFSLLRMFFRSIKLITAFVFFTQVDENGRNLAWKAIGYDGPSSDHSDHEVELNEKM  166

Query  573   heddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPSF-----VIECD  731
              +   E  +FGPLY GIIDL  P E V  +LT  G +V+  K    G S       I CD
Sbjct  167   QKKPEE--IFGPLYNGIIDLQSPREAVAKKLTGHGFTVSTQKRNTNGSSISDLVMTIRCD  224

Query  732   AvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  911
             AVVVGSG GGGV++GVLA AGYKVLV+E G YYAR+ LSLLEG +MD M+L GGLL T D
Sbjct  225   AVVVGSGSGGGVVAGVLAKAGYKVLVVESGTYYARSKLSLLEGQAMDDMYLSGGLLATSD  284

Query  912   LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGV  1091
              ++V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGSD+Y +AMD VC +MGV
Sbjct  285   TNVVILAGSTVGGGSTINWSASIKTPEHVIKEWAEKSKLEMFGSDLYREAMDVVCERMGV  344

Query  1092  QRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             Q    +E F N +LRKGC EL  PV NIP+NA SDHYCG+C
Sbjct  345   QCGFVEEGFNNEILRKGCEELGLPVKNIPRNAASDHYCGFC  385


 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 96/147 (65%), Gaps = 0/147 (0%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  253
            ME+L A+C+TF+ +I+ +     D  V  +F  SA+ TGTP + A ++++R+ HPK   L
Sbjct  1    MESLVAICDTFISSIDGSGVGHVDDCVAGYFSASASQTGTPDRAARLMSERLHHPKKWIL  60

Query  254  llllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  433
               LW LST IGTL+LCG+ S + QFP+  RF  + +K+RE I+ +W++S    +R FF 
Sbjct  61   RAGLWLLSTWIGTLILCGRRSFTGQFPYFRRFCRLPEKQREEILLNWSSSYFSLLRMFFR  120

Query  434  AMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++K +   VFFT VD+ G N +WKAIG
Sbjct  121  SIKLITAFVFFTQVDENGRNLAWKAIG  147



>ref|XP_002967201.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
 gb|EFJ31800.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
Length=724

 Score =   179 bits (455),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 137/216 (63%), Gaps = 13/216 (6%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKLGCSVAK-----------PKPPGPSFVIECDAvvvgsg  752
             PL + ++D   P+    +RL +LGC++                 G  F I+CD VVVGSG
Sbjct  164   PLERRLVDAKAPDFQ--SRLAELGCAMLDKVDHLEERNDPSTASGKDFGIKCDVVVVGSG  221

Query  753   cgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  932
              GG VI+  LA  G+KV+VLEKG Y+ R  LSLLEGPSM  M+   G L T+D  ++LLA
Sbjct  222   SGGSVIAARLAQQGFKVVVLEKGGYFPRRGLSLLEGPSMKAMYEQSGALTTEDGSVILLA  281

Query  933   GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDE  1112
             G+T+GGGSAVNW+AS+KTP +VL EW  +     FG   Y  AM+ VC ++GVQ  C +E
Sbjct  282   GTTLGGGSAVNWAASLKTPKHVLDEWTSLGLENRFGGPEYQHAMEAVCQRLGVQDGCTEE  341

Query  1113  SFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             SFQN VLR+GC E  Y V +IP+NA  DH CG+C F
Sbjct  342   SFQNRVLRRGCTEKGYSVGDIPRNAARDHGCGFCGF  377


 Score = 94.7 bits (234),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 84/147 (57%), Gaps = 0/147 (0%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  253
            M+ L A+C+T +P++     +  +++   FF+ SA+ +G   +VA +I       +   +
Sbjct  1    MKVLDAICDTLVPSLPVEASKQDNSAKAKFFELSASESGIVPEVAGMICAWTTAQQYFLI  60

Query  254  llllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  433
             +    LSTR+GTLLL G   ++T+FPF+  FP +   KRE+I+ +W+ S    ++  F 
Sbjct  61   YIAFLMLSTRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLNWSRSIFHKLQMLFK  120

Query  434  AMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +K   L  F++  D KG NP+WKAIG
Sbjct  121  VVKCYTLFKFYSRADKKGRNPAWKAIG  147



>gb|KEH30749.1| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=766

 Score =   176 bits (447),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII++    +    + L+  G +V           I+CDAVVVGSGCGGGV + VL
Sbjct  205   PLEKGIIEIMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAVVVGSGCGGGVAASVL  263

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             + AGYKV+VLEKGNY+   + S LEGPSMD+ +  GG+L + D  +VL AGSTVGGGSAV
Sbjct  264   SKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYEKGGMLASVDSRIVLFAGSTVGGGSAV  323

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP  VL+EW + H L LF +  Y  AM+TVC ++GV   C  E FQN VLRKG
Sbjct  324   NWSACIRTPQNVLKEWSDEHKLPLFETLEYLSAMETVCERIGVNENCTQEGFQNQVLRKG  383

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V  +P+N+P +HYCG C +
Sbjct  384   CQNLGLKVDYVPRNSPGNHYCGSCGY  409


 Score = 97.4 bits (241),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 101/167 (60%), Gaps = 9/167 (5%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAI--NEALPETTDAS--VTNFFQTSAASTGTPHQ  202
            EN+      S ++ME+L+++C   LP++  ++AL +  ++S  V +FF  SA+    P +
Sbjct  23   ENSKYKHGFSVAEMESLTSICEVVLPSLPMDDALTKDDESSKDVQSFFNISASMYPIPDE  82

Query  203  VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  382
            VA ++ +      +  + ++LW L+TR+GTLL+CG   LS ++PF+  F  +S  KRE+I
Sbjct  83   VAEMLVKSGVTEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKI  142

Query  383  VHSWATSSLQFIRNF---FTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            V       L+F+  F   F  +K L L VFF+ VD+ GDNP+WKAIG
Sbjct  143  VQR--ALKLRFLTPFRLAFAYIKVLCLFVFFSWVDENGDNPAWKAIG  187



>ref|XP_002960521.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
 gb|EFJ38060.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
Length=724

 Score =   179 bits (453),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 138/216 (64%), Gaps = 13/216 (6%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKLGCSVAK-----------PKPPGPSFVIECDAvvvgsg  752
             PL + ++D   P+    +RL +LGC++                 G  F I+CD VVVGSG
Sbjct  164   PLERRLVDAKAPDFQ--SRLAELGCAMLDNVDHLEERNDPSTASGKDFGIKCDVVVVGSG  221

Query  753   cgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  932
              GG VI+  LA  G+KV+VLEKG Y+ R  LSLLEGPSM  M+   G L T+D  ++LLA
Sbjct  222   SGGSVIAARLAQQGFKVVVLEKGGYFPRRGLSLLEGPSMKAMYEQSGALTTEDGSVILLA  281

Query  933   GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDE  1112
             G+T+GGGSAVNW+AS+KTP +VL EW  +   + FG   Y  AM+ VC ++GVQ  C +E
Sbjct  282   GTTLGGGSAVNWAASLKTPKHVLDEWTSLGLEDRFGGPEYQHAMEAVCQRLGVQDVCTEE  341

Query  1113  SFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             SFQN VLR+GC +  Y V +IP+NA  DH CG+C F
Sbjct  342   SFQNRVLRRGCTKKGYSVGDIPRNAARDHGCGFCGF  377


 Score = 95.1 bits (235),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 85/147 (58%), Gaps = 0/147 (0%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  253
            M+ L+A+C+T +P++     +  +++   FF+ SA+ +G   +VA +I       +   +
Sbjct  1    MKVLNAICDTLVPSLPVEASKQDNSAKAKFFELSASESGIVPEVAGMICAWTTAQQYFLI  60

Query  254  llllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  433
             +    LSTR+GTLLL G   ++T+FPF+  FP +   KRE+I+ +W+ S    ++  F 
Sbjct  61   YIAFLMLSTRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLTWSRSIFHKLQMLFK  120

Query  434  AMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +K   L  F++  D KG NP+WKAIG
Sbjct  121  VVKCYTLFKFYSRADKKGRNPAWKAIG  147



>ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
Length=741

 Score =   187 bits (474),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 140/206 (68%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +   E  +   L + G  V K  P    + I+CD VVVGSGCGGGV + VL
Sbjct  192   PLQKGMVETMQETESTLVQSLNQKGLKVVK-DPEQKLYKIKCDVVVVGSGCGGGVAAAVL  250

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G+KV+VLEKG Y+  T+ S LEGPSM+++F  GG+L T D  M++LAGSTVGGGSA+
Sbjct  251   ASSGHKVVVLEKGTYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGSTVGGGSAI  310

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VL EW E H L LFGS  Y  AMD VC ++GV   C +E FQN VL+KG
Sbjct  311   NWSASIKTPKSVLHEWAEEHKLPLFGSSQYFSAMDAVCERIGVTETCVEEGFQNQVLQKG  370

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+   HYCG C++
Sbjct  371   CENLGLKVDLVPRNSSEKHYCGSCSY  396


 Score = 86.3 bits (212),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 87/157 (55%), Gaps = 2/157 (1%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  226
            T   S ++M++L+++C   LP +   ++      +V +F+Q S +    P + A +  +R
Sbjct  19   THGFSSAEMQSLASICEVLLPPLPLNSIEGQPSKAVQSFYQASGSQHPIPDEGAELFVKR  78

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
                 +  + ++L  LSTR+GTLLLCG  S S ++PF+  F  IS +KRE+I+  W    
Sbjct  79   ALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNFSSISLEKREKILQRWFKHR  138

Query  407  LQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            L   IR  F  +K L L  FFT  D+  +N +W+AIG
Sbjct  139  LLTPIRLAFVYIKFLCLYAFFTLADENSENAAWEAIG  175



>ref|XP_010684652.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Beta vulgaris subsp. 
vulgaris]
Length=750

 Score =   171 bits (432),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNL-PEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             P+ KGI++  +  +  V   L + G +V++         ++CD V+VGSGCGGGV + +L
Sbjct  200   PIQKGIVECRMMNDSTVVQILEEKGLTVSEDVDQSV-LKVQCDVVIVGSGCGGGVAAAIL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+ G+KV++LEKGNY+A  + S LEGPS+++++L GG+L T D  M++ +GSTVGGGSAV
Sbjct  259   ASHGHKVVILEKGNYFAPGDYSSLEGPSLNELYLSGGMLTTLDGKMIVFSGSTVGGGSAV  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL EW   H L +FGS  Y  AM+ V  ++GV  +C +E FQN VLRKG
Sbjct  319   NWSACIKTPDSVLNEWSVNHKLPIFGSPDYKSAMNEVWKRLGVTEDCSEEGFQNQVLRKG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P N+  DHYCG C +
Sbjct  379   CEHLGLKVEKVPTNSSKDHYCGSCCY  404


 Score =   102 bits (254),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 98/170 (58%), Gaps = 7/170 (4%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAI------NEALPETTDASVTNFFQTSAAST  187
            R  ++N+     S SQ++TL+A+C T +P++       + L      S+ +FF  SA+  
Sbjct  13   RSDKDNSFKHGFSSSQIQTLTAMCETIIPSLPHTSVTQQILSLHPQNSILSFFGNSASQP  72

Query  188  GTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  367
              P +VA +I +R+    +  + ++L  LSTR+GTLL CG   L  ++PF+ +F E+S +
Sbjct  73   PIPDEVAEIIVKRVLPEAVILIRVVLKLLSTRLGTLLFCGCLCLEWKWPFIHKFSEMSLE  132

Query  368  KRERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            KRE+++  W+T S    +R  F  +K     +FFT  DD  +NP+W+AIG
Sbjct  133  KREKLLQRWSTESYWTSLRVVFLLIKIACCFIFFTRTDDNAENPAWEAIG  182



>ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
Length=744

 Score =   173 bits (438),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 142/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ +   +  +   LT+ G  V + K     + ++CD V+VGSGCGGGV + VL
Sbjct  193   PLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQNL-YKVKCDVVIVGSGCGGGVAAAVL  251

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G+KV+VLEKG Y+   + S LEGPSMD+ +  GG++ + D  M++LAGSTVGGGSAV
Sbjct  252   ANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGSTVGGGSAV  311

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VLREW + + + LFGS  Y  AMD+VC ++GV  +C+ ESFQN +L +G
Sbjct  312   NWSASIRTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQNQILIQG  371

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C ++   V ++  N+ +DHYCG C +
Sbjct  372   CEKMGLKVESVAINSSADHYCGSCCY  397


 Score = 99.4 bits (246),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 94/164 (57%), Gaps = 1/164 (1%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQV  205
            R+ E       LS +QM  ++A+C+  +P++      + D ++++F+ TSA+    P + 
Sbjct  15   RRREEKGYNHGLSTTQMHVMAAICDALIPSLPLNKDTSQDQALSDFYNTSASQLPFPDEA  74

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
            A ++ +R     ++ +  +LW LS R+GTLLLCG+ SL  ++PF+ +F EIS +KRE+I 
Sbjct  75   AELLYKRTVPEAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIF  134

Query  386  HSWA-TSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +W    S   +R  F  +K      FF+  D  G NP+WKAIG
Sbjct  135  RNWTREKSWVALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIG  178



>ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=743

 Score =   184 bits (468),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 140/206 (68%), Gaps = 1/206 (0%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +   +  +   LTK G  V           I+CD V+VGSGCGGGV + VL
Sbjct  191   PLEKGIIETMKKTDSTLIESLTKKGIEVTDGAAHPQIHKIKCDVVIVGSGCGGGVAAAVL  250

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + SLLEGPSM++++  GG++ +KD  M++LAGSTVGGGSAV
Sbjct  251   AQSGQKVVVLEKGNYFVPKDYSLLEGPSMNELYESGGIMASKDGKMMILAGSTVGGGSAV  310

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL EW   H + LFGS  Y  AMD VC ++GV   C +E+ QN +LRKG
Sbjct  311   NWSASIRTPNSVLEEWFVDHKIPLFGSPDYQSAMDAVCKRIGVTDSCTEENMQNQILRKG  370

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   V ++P+N+ +DHYCG C +
Sbjct  371   CEKLGLKVDSVPRNSSADHYCGSCNY  396


 Score = 87.4 bits (215),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 83/152 (55%), Gaps = 3/152 (2%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  241
            S +Q+++L+A+C   +P +  +L +T+D ++ +F++ S +    P +VA +I +R     
Sbjct  25   SAAQIQSLAAMCEALIPPL--SLDDTSDQALHSFYKASGSEPPIPDEVADLIRKRGAPEA  82

Query  242  lnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFI  418
            +  L   L  LS R+G LL+CG   L   +PF+  F E+S +KRE  +  W+    L  +
Sbjct  83   VGVLSFFLKVLSYRLGNLLVCGYPCLDKNWPFIHNFAEMSLEKREEALQRWSREKRLIPL  142

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            R  F  +K      FF+ +     NPSWKAIG
Sbjct  143  RLLFVVVKIFCFFCFFSRIVGDSQNPSWKAIG  174



>ref|XP_008447391.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2-like 
[Cucumis melo]
Length=739

 Score =   182 bits (463),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 141/206 (68%), Gaps = 1/206 (0%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +G+I+  N  +  +F  L++ G  V + K  G ++ I+CD V+VGSGCGGGV + VL
Sbjct  194   PLERGMIETGNEDDSTLFRSLSQKGLEVIEDKKHGNAYKIKCDVVIVGSGCGGGVAAAVL  253

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPSM++++  GGL  T D  ++LLAG+TVGGGSA+
Sbjct  254   AKSGLKVVVLEKGNYFVAEDYSSLEGPSMNELYESGGLKSTLDGKVMLLAGTTVGGGSAI  313

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL EW   H + L+GS  Y  AMD VC ++GV R C  ESFQN VLRKG
Sbjct  314   NWSASIRTPKSVLDEWSTDHKIPLYGSIDYQLAMDAVCDRIGVTRGCRVESFQNQVLRKG  373

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++ +N+  DHYCG C +
Sbjct  374   CENLGLKVDSVSRNSSEDHYCGSCCY  399


 Score = 89.0 bits (219),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 86/154 (56%), Gaps = 3/154 (2%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  241
            S SQME ++A C   +P +        D  + +F+Q+SA     P +VA ++ +R     
Sbjct  24   SSSQMEAMAAFCEALIPPLPLFSETPLDQFLLSFYQSSAFQAPIPDEVADLLVERANPKA  83

Query  242  lnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF--  415
            +  + L+L  LS RIGTLLLCG      ++PF L+F EIS +KRE+I+ +W+ +  ++  
Sbjct  84   VFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFFLKFSEISLEKREQILKNWSMAHHKYTV  143

Query  416  -IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +R  F  +K      FF+ +D+   N +WKA+G
Sbjct  144  LLRMTFMIIKIFCCFKFFSRIDEGTKNVAWKAMG  177



>ref|XP_010934290.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=755

 Score =   184 bits (468),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 141/206 (68%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ ++  +  + + LTK G +V++  P    + I CD  +VGSGCGGGV + VL
Sbjct  204   PLEKGIIETMDQNDSSLLHSLTKKGLAVSQ-DPIQNMYRIRCDVAIVGSGCGGGVAAAVL  262

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG+KV+V+EKGNY+   + + +E PSM +M+  GG+L T D  M+LLAGSTVGGGSAV
Sbjct  263   ASAGHKVVVIEKGNYFTSEDYTSIEAPSMYEMYESGGILSTLDGKMMLLAGSTVGGGSAV  322

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP YVL+EW E H L LF S  Y  +MD VC ++GV   C  E FQN VLRKG
Sbjct  323   NWSACIKTPDYVLKEWAEEHQLPLFRSTDYLSSMDAVCKRLGVTENCTQEGFQNEVLRKG  382

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V ++P+N+   H+CG C +
Sbjct  383   CQNLGLKVDSVPRNSSESHFCGSCCY  408


 Score = 87.0 bits (214),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 98/171 (57%), Gaps = 10/171 (6%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAIN-EALPETT---DASVTN---FFQTSAAST  187
            + E        SPSQ+++L+A+C  F+P+++ E L  ++   D    N   F+  S + +
Sbjct  18   RREEGGYRHGFSPSQIQSLAAMCEAFIPSLSMEELHVSSGKEDPPTKNLQAFYLASGSES  77

Query  188  GTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  367
              P +VA ++ +R     +  + L+LW L+T++GTL+LCG  SL  +FPF+ +F ++S +
Sbjct  78   PVPDEVAELMVKRGLREAVLLVKLVLWLLATKLGTLVLCGSLSLCGEFPFINKFSDMSVE  137

Query  368  KRERIVHSWATSSLQFI--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            KRE ++  W   ++ FI  R  F  +K   L +F++  ++  +N SW AIG
Sbjct  138  KREEVLKRWNKENI-FIPLRMVFVMVKVFCLHIFYSMTNENSENLSWNAIG  187



>ref|XP_011030464.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Populus euphratica]
Length=745

 Score =   177 bits (449),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+ID N      + + L + G  V +  P    + I+CD V+VGSGCGGGV + VL
Sbjct  197   PLQKGLIDTNQETASTLLHSLKEKGLRVTQ-DPRKNVYKIKCDVVIVGSGCGGGVAAAVL  255

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV VLEKGNY+  ++ S LEGPSMD+++  GG L T D +M+++AGS VGGGSAV
Sbjct  256   AASGQKVFVLEKGNYFTASDYSGLEGPSMDQLYESGGKLATTDAEMLIMAGSAVGGGSAV  315

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VL+EW     + LFGS  Y  AMD VC ++GV   C +E FQN VLRKG
Sbjct  316   NWSASIKTPNSVLQEWTRNQKIPLFGSSEYFSAMDAVCTRIGVTESCGEEGFQNQVLRKG  375

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L  PV  +P+N+   HYCG C +
Sbjct  376   CESLGIPVKTVPRNSSERHYCGSCGY  401


 Score = 94.0 bits (232),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 89/157 (57%), Gaps = 6/157 (4%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAIN-----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  223
            LS ++ME LS+LC T  P+++     +        ++  F++ SA+ T  P ++A ++ +
Sbjct  23   LSSAEMEALSSLCETIFPSLSPIPKFDGKQNQPTKAMQAFYRASASQTPMPDEMAELLTK  82

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R     +  + L+LW LSTR+GT LLCG      ++P+   F  I   KRER++  W   
Sbjct  83   RGLLEAVFLVRLVLWLLSTRLGTFLLCGSLCFEEKWPYFKNFSSIPLDKRERVLQKWFKH  142

Query  404  SL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
                 IR  F  +K L+L VFF+ VD+KGDNP+W+AI
Sbjct  143  RFFTPIRAAFVYVKILILYVFFSRVDEKGDNPAWEAI  179



>ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gb|KGN58167.1| Electron carrier [Cucumis sativus]
Length=738

 Score =   177 bits (450),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 140/206 (68%), Gaps = 1/206 (0%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +G+I+  N  +  +   L++ G  V + K  G ++ I+CD V+VGSGCGGGV + VL
Sbjct  194   PLERGMIETGNEDDSTLLRSLSQKGLEVIEDKKHGNAYKIKCDVVIVGSGCGGGVAAAVL  253

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPSM++++  GGL  T D  ++LLAG+TVGGGSA+
Sbjct  254   AKSGLKVVVLEKGNYFVAEDYSSLEGPSMNELYESGGLKSTLDGKVMLLAGTTVGGGSAI  313

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  +L EW   + + L+GS  Y  AMD VC ++GV  EC  ESFQN VLRKG
Sbjct  314   NWSASIKTPKSILDEWSTDYKIPLYGSIDYQLAMDAVCDRIGVTEECPVESFQNQVLRKG  373

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++ +N+  DHYCG C +
Sbjct  374   CENLGLKVDSVSRNSSKDHYCGSCCY  399


 Score = 93.2 bits (230),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 86/154 (56%), Gaps = 3/154 (2%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  241
            S SQME ++A C   +P +        D S+ +F+Q+SA     P +VA ++ +R     
Sbjct  24   SSSQMEAMAAFCEALIPPVPLFKESPLDQSLLSFYQSSAFQAPIPDEVADLLVERANPKA  83

Query  242  lnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF--  415
            +  + L+L  LS RIGTLLLCG      ++PF L+F EIS +KRERI+ +W+ +  ++  
Sbjct  84   VFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFFLKFSEISLEKRERILKNWSMAHHKYTV  143

Query  416  -IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +R  F  +K      FF+ +D+   N +WK +G
Sbjct  144  LLRMTFMIIKIFCCFKFFSRIDEGTKNVAWKGMG  177



>gb|KHN02487.1| Long-chain-alcohol oxidase FAO2 [Glycine soja]
Length=744

 Score =   171 bits (434),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 142/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ +   +  +   LT+ G  V + K     + ++CD V+VGSGCGGGV + VL
Sbjct  193   PLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQNL-YKVKCDVVIVGSGCGGGVAAAVL  251

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G+KV+VLEKG Y+   + S LEGPSMD+ +  GG++ + D  M++LAGSTVGGGSAV
Sbjct  252   ANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGSTVGGGSAV  311

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VLREW + + + LFGS  Y  AMD+VC ++GV  +C+ ESFQN +L +G
Sbjct  312   NWSASIRTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQNQILIQG  371

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C ++ + V ++  N+ +D YCG C +
Sbjct  372   CEKMGFKVESVAINSSADDYCGSCCY  397


 Score = 99.8 bits (247),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 94/164 (57%), Gaps = 1/164 (1%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQV  205
            R+ E       LS +QM  ++A+C+  +P++      + D ++++F+ TSA+    P + 
Sbjct  15   RRREEKGYNHGLSTTQMHVMAAICDALIPSLPLNKDTSQDQALSDFYNTSASQLPFPDEA  74

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
            A ++ +R     ++ +  +LW LS R+GTLLLCG+ SL  ++PF+ +F EIS +KRE+I 
Sbjct  75   AELLYKRTVPEAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIF  134

Query  386  HSWA-TSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +W    S   +R  F  +K      FF+  D  G NP+WKAIG
Sbjct  135  RNWTREKSWVALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIG  178



>gb|KCW78401.1| hypothetical protein EUGRSUZ_D02566 [Eucalyptus grandis]
Length=748

 Score =   227 bits (579),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 188/298 (63%), Gaps = 40/298 (13%)
 Frame = +3

Query  441   KLWFSS-YSSLRLMIRGI---------TQVG--------KQ*GYCGPDP-----------  533
             + WF S +  LR+  R I         TQ+         K  GY GPDP           
Sbjct  157   RRWFRSVFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDPDFENSKKLKRM  216

Query  534   ----SISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-----  686
                 S  E+Q +++        +E + GPL++G+I +  P++ V   L + G  V     
Sbjct  217   SCQVSADEQQGQEQAKAKNCYEDEAISGPLHQGLIQMVHPQDIVTKSLRQFGFPVLICPS  276

Query  687   --AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEG  860
                  KP  PS  I+CDAVV+GSG GGGV++GVLA AG+KVLVLEKG+Y AR+NLSLLEG
Sbjct  277   NHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLSLLEG  336

Query  861   PSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFG  1040
             P+MD+M+L GGL+ T+D+  ++LAGSTVGGGS +NWSAS++TP +V+ EW   + LELF 
Sbjct  337   PTMDQMYLSGGLVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYDLELFD  396

Query  1041  SDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             S +Y +A+D VC +MGVQ    +E F N VLRKGC+EL YPV NIP+N+P+DHYCGWC
Sbjct  397   SKLYQEALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCGWC  454


 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAI-NEALPETT----DASVTNFFQTSAASTGTPHQVAWVIN  220
            +LSP QMETL++LC+TFLP+I +   P  T    D  V  F+QTSA+  GTP ++  +++
Sbjct  42   SLSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVS  101

Query  221  QRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  400
            +RMKHPKL  L L LW LST IGT +LCG+   S+ FP++ RF EI Q++RE I   W  
Sbjct  102  ERMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREEIARRWFR  161

Query  401  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            S    +R F   +K L  LVFFT +D+K  N SWKAIG     P
Sbjct  162  SVFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDP  205



>ref|XP_004505474.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=762

 Score =   172 bits (437),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+     +    + L+  G +V           I+CDAVVVGSG GGGV + VL
Sbjct  205   PLEKGIIETMHEHDSTLQKSLSDKGLNVI-VDSKNNILKIKCDAVVVGSGSGGGVAASVL  263

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             + AGYKV+VLEKGNY+   + S LEGPSM++ +  GG+L++ D  +++LAGSTVGGGSA+
Sbjct  264   SNAGYKVIVLEKGNYFVPKDYSSLEGPSMNQQYECGGMLVSADSRILVLAGSTVGGGSAI  323

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA +KTP  V++EW E H L +F S  Y  AM+TVC ++GV + C  E FQN VLRKG
Sbjct  324   NWSACLKTPQEVIKEWSEKHKLSMFSSLEYLSAMETVCERIGVNQNCTQEGFQNQVLRKG  383

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V  +P+N+  +HYCG C +
Sbjct  384   CQNLGLKVDYVPRNSSGNHYCGSCGY  409


 Score = 97.8 bits (242),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 96/172 (56%), Gaps = 12/172 (7%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLP-----AINE------ALPETTDASVTNFFQTSAA  181
            EN+      S ++ME+L+++C   LP     A+N+         + +   V +F   SA+
Sbjct  14   ENSKYKHGFSVAEMESLTSICEVVLPSLPVDAMNQRKDDQHDDDDESRKHVQSFLNLSAS  73

Query  182  STGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEIS  361
                PH+VA  + +R     +  + ++LW L+TR+GTLLLCG   LS ++PF+ +F  +S
Sbjct  74   QYPIPHEVAEALVKRGLIEAVMLIRVVLWLLATRLGTLLLCGFLCLSKEWPFVNKFSSMS  133

Query  362  QKKRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              KRE+IV  W     L  IR  F  +K L   VFF+ VD+ GDNP+WKAIG
Sbjct  134  LDKREKIVQRWLKHRFLTPIRVAFGYIKVLCHFVFFSWVDENGDNPTWKAIG  185



>ref|XP_011659885.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cucumis sativus]
 gb|KGN53994.1| hypothetical protein Csa_4G246400 [Cucumis sativus]
Length=386

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 159/212 (75%), Gaps = 6/212 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEH--VFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcg  758
             L+GPL+KGI++L   ++       L K G  V       KPP PS +I+CDAVVVGSG G
Sbjct  56    LYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSG  115

Query  759   ggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  938
             GGVI+GVLA AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+   GL+ T ++++++LAGS
Sbjct  116   GGVIAGVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGS  175

Query  939   TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESF  1118
             TVGGGS VNWSASI+TP ++ REW + + LELF S++Y +A+D VC KMGVQ + ++E F
Sbjct  176   TVGGGSTVNWSASIETPSHITREWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGF  235

Query  1119  QNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
              N VLRKGC EL    + IP+N+ SDHYCGWC
Sbjct  236   NNAVLRKGCEELGGHAITIPRNSTSDHYCGWC  267



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score =   227 bits (578),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 188/298 (63%), Gaps = 40/298 (13%)
 Frame = +3

Query  441   KLWFSS-YSSLRLMIRGI---------TQVG--------KQ*GYCGPDP-----------  533
             + WF S +  LR+  R I         TQ+         K  GY GPDP           
Sbjct  157   RRWFRSVFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDPDFENSKKLKRM  216

Query  534   ----SISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-----  686
                 S  E+Q +++        +E + GPL++G+I +  P++ V   L + G  V     
Sbjct  217   SCQVSADEQQGQEQAKAKNCYEDEAISGPLHQGLIQMVHPQDIVTKSLRQFGFPVLICPS  276

Query  687   --AKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEG  860
                  KP  PS  I+CDAVV+GSG GGGV++GVLA AG+KVLVLEKG+Y AR+NLSLLEG
Sbjct  277   NHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLSLLEG  336

Query  861   PSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFG  1040
             P+MD+M+L GGL+ T+D+  ++LAGSTVGGGS +NWSAS++TP +V+ EW   + LELF 
Sbjct  337   PTMDQMYLSGGLVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYDLELFD  396

Query  1041  SDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             S +Y +A+D VC +MGVQ    +E F N VLRKGC+EL YPV NIP+N+P+DHYCGWC
Sbjct  397   SKLYQEALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCGWC  454


 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = +2

Query  56   TLSPSQMETLSALCNTFLPAI-NEALPETT----DASVTNFFQTSAASTGTPHQVAWVIN  220
            +LSP QMETL++LC+TFLP+I +   P  T    D  V  F+QTSA+  GTP ++  +++
Sbjct  42   SLSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVS  101

Query  221  QRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  400
            +RMKHPKL  L L LW LST IGT +LCG+   S+ FP++ RF EI Q++RE I   W  
Sbjct  102  ERMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREEIARRWFR  161

Query  401  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            S    +R F   +K L  LVFFT +D+K  N SWKAIG     P
Sbjct  162  SVFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDP  205



>gb|ACF22878.1| alcohol oxidase [Glycine max]
Length=723

 Score =   173 bits (439),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 142/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ +   +  +   LT+ G  V + K     + ++CD V+VGSGCGGGV + VL
Sbjct  172   PLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQNL-YKVKCDVVIVGSGCGGGVAAAVL  230

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G+KV+VLEKG Y+   + S LEGPSMD+ +  GG++ + D  M++LAGSTVGGGSAV
Sbjct  231   ANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGSTVGGGSAV  290

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VLREW + + + LFGS  Y  AMD+VC ++GV  +C+ ESFQN +L +G
Sbjct  291   NWSASIRTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQNQILIQG  350

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C ++   V ++  N+ +DHYCG C +
Sbjct  351   CEKMGLKVESVAINSSADHYCGSCCY  376


 Score = 96.3 bits (238),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  238
            LS +QM  ++A+C+  +P++      + D ++++F+ TSA+    P + A ++ +R    
Sbjct  5    LSTTQMHVMAAICDALIPSLPLNKDTSQDQALSDFYNTSASQLPFPDEAAELLYKRTVPE  64

Query  239  KlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA-TSSLQF  415
             ++ +  +LW LS R+GTLLLCG+ SL  ++PF+ +F EIS +KRE+I  +W    S   
Sbjct  65   AVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWTREKSWVA  124

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +R  F  +K      FF+  D  G NP+WKAIG
Sbjct  125  LRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIG  157



>ref|XP_002529832.1| electron carrier, putative [Ricinus communis]
 gb|EEF32533.1| electron carrier, putative [Ricinus communis]
Length=745

 Score =   171 bits (434),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 140/206 (68%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++L N  +  +   L + G  V +  P   ++ I+CD V++GSGCGGGV + VL
Sbjct  199   PLEKGIVELANEDDLTLVKSLMQKGIQVTE-DPDHNTYKIKCDVVIIGSGCGGGVAAAVL  257

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KVLVLEKGNY+   + S +EGPSM +++  GG L T +  +++LAGSTVGGGSA+
Sbjct  258   ASSGQKVLVLEKGNYFVPEDYSSVEGPSMAELYESGGFLPTLNGKIMILAGSTVGGGSAI  317

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EWC  + + LFGS  Y  AMD V  ++GV   C +E FQN VLR+G
Sbjct  318   NWSACIKTPDTVLKEWCVDYRIPLFGSPDYHYAMDVVQKRIGVTDNCSNEGFQNQVLRRG  377

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+ +DHYCG C +
Sbjct  378   CENLGLKVDSVPRNSSADHYCGSCCY  403


 Score = 97.1 bits (240),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 87/164 (53%), Gaps = 6/164 (4%)
 Frame = +2

Query  41   NTATKTLSPSQMETLSALCNTFLPAI-----NEALPETTDASVTNFFQTSAASTGTPHQV  205
            NT     S +Q++TLSA C T +P +     +  LP     ++ +F++ S +    P +V
Sbjct  19   NTYNHGFSSAQIQTLSAFCETLIPPLPVNNFSNELPFDKQKALLSFYKASGSEQPIPDEV  78

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
            A ++  R     +  +  LL  LS R+GTLLLCG   L   +PF+ +F EIS  KRE IV
Sbjct  79   AELMVNRGLKEVVLVVDFLLKVLSFRLGTLLLCGFICLEWNWPFIHKFSEISLSKREDIV  138

Query  386  HSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              WA     F +R  F A+K      FF+  DD  +NP+W+AIG
Sbjct  139  KRWAKQKYFFPLRVLFMAVKIFCSYTFFSRTDDNSENPAWEAIG  182



>ref|XP_007224435.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
 gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
Length=721

 Score =   175 bits (443),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 135/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +   +  + +   + G +V +  P    + I+CD VVVGSGCGGGV + VL
Sbjct  173   PLQKGIIETIYETDTTLLHSFAEKGLTV-RHDPQEKLYKIKCDVVVVGSGCGGGVAAAVL  231

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKGNYY  ++ S LEGPS D+M+  GG+  T D  +V+ AGSTVGGGSAV
Sbjct  232   ASSGQKVVVLEKGNYYTHSDYSSLEGPSQDQMYESGGIFATIDGKLVIQAGSTVGGGSAV  291

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP  VL EW + H +  FG   Y  AMDTVC ++GV   C +E FQN VLRKG
Sbjct  292   NWSACIRTPDNVLEEWAKDHEIRFFGEPEYVSAMDTVCERIGVTDNCVEEGFQNQVLRKG  351

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+   HYCG C +
Sbjct  352   CENLGLGVDFVPRNSSEKHYCGSCGY  377


 Score = 92.8 bits (229),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 87/157 (55%), Gaps = 12/157 (8%)
 Frame = +2

Query  74   METLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  226
            M++L+++C   LPA+          E  P  TD +V +F Q S A T  P +VA ++ +R
Sbjct  1    MQSLASVCEALLPALPLNDFCFEGKEEQP--TDKAVQSFHQASGAQTPIPDEVAELLVKR  58

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
                 +  + ++LW LSTR+GTLLLCG      ++PF+L F  +   KRER++  W    
Sbjct  59   AFIEAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPFILNFSSLPLAKRERLLQKWFKHR  118

Query  407  -LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             L  IR  F  +K L L +FF+ VD   +NP W+AIG
Sbjct  119  FLTPIRLAFVYIKFLCLYIFFSRVDKNAENPIWQAIG  155



>ref|XP_010036770.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW48412.1| hypothetical protein EUGRSUZ_K02114 [Eucalyptus grandis]
Length=748

 Score =   174 bits (442),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 139/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +G+++ ++  +  +   LT+ G  V +  P   +F I+CD V++GSGCGGGV + VL
Sbjct  197   PLQRGLVETVHETDSSLIQSLTQKGLKVTQI-PQHNAFKIKCDVVIIGSGCGGGVAAAVL  255

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPS+D+++    LL T D  +V+LAGSTVGGGSAV
Sbjct  256   AHSGQKVVVLEKGNYFVPQDYSSLEGPSLDQLYESSALLSTVDGKIVVLAGSTVGGGSAV  315

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP +VL+EW   H + LFG+  Y  AMD VC K+GV ++CE E FQN +LRKG
Sbjct  316   NWSACIRTPSHVLKEWSVDHKIRLFGTPDYGSAMDAVCKKIGVTQKCEQEGFQNQILRKG  375

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  + +N+   H+CG C +
Sbjct  376   CESLGLKVEAVARNSSEGHFCGSCCY  401


 Score = 93.2 bits (230),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 91/157 (58%), Gaps = 7/157 (4%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPA-----INEALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  226
            SP+Q++ L+A+C T +P+     IN  +P   D ++  F+  S +    P +VA ++ +R
Sbjct  23   SPAQIQALAAICETLIPSVSLDSINPKIPHD-DPALHGFYSASGSQPSVPDEVAEILTKR  81

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
             +   +  + ++L  LS R+GTL+LC    L++ +PF+L F E+  ++RER++ +W+   
Sbjct  82   AQRQVVVMVSIVLKMLSFRLGTLVLCWGSCLASTWPFILNFSEMPVERRERVLMNWSRQK  141

Query  407  LQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
                +R  F  +K   L +F+T  D+  +N +W+AIG
Sbjct  142  FVVPLRVVFMMIKIYCLFIFYTRTDENSNNLAWEAIG  178



>ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=786

 Score =   177 bits (450),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 138/206 (67%), Gaps = 4/206 (2%)
 Frame = +3

Query  606   PLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  G+++   L +  +   L   G +V+          ++CDAV+VGSGCGGGV + +L
Sbjct  231   PLDSGVVETRALNDTTLLRSLADRGLAVSSD---ARHHTVQCDAVIVGSGCGGGVAAAML  287

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG KV+VLEKG+Y+   + S +EGPSM+++F  GG+  T ++  ++  GSTVGGGSAV
Sbjct  288   ASAGLKVVVLEKGDYFTAEDYSSVEGPSMERLFEKGGIFCTSNVTTMVFTGSTVGGGSAV  347

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL+EW + HGL +FGSD Y +AMD VC ++ V   C +E FQN V+R+G
Sbjct  348   NWSASIRTPGTVLQEWSQEHGLPVFGSDGYVQAMDAVCSRLAVTDACLEEGFQNKVVRRG  407

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L  PV  +P+N+ + HYCG C F
Sbjct  408   CEALGLPVDAVPRNSSAGHYCGSCNF  433


 Score = 89.7 bits (221),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 90/172 (52%), Gaps = 17/172 (10%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQ  202
            T  + P+QME L A+C  F+P++           A P      +  F+  SAA +  P +
Sbjct  36   THGMHPAQMEALRAICGAFIPSMPAEEAAGAGGRADPPPGGKDLERFYLASAADSTIPDE  95

Query  203  VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ-------FPFLLRFPEIS  361
            VA ++  R     +    ++LW LSTR+GTLLLCG+ SLS         FP + RF ++ 
Sbjct  96   VAELMVTRCIREAVLLAWVVLWVLSTRVGTLLLCGRLSLSFSGGARDFSFPCVSRFADMP  155

Query  362  QKKRERIVHSW-ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              +RE  +  W +T  L  +R  FT +K L   VF+  V++K +NP WKAIG
Sbjct  156  VARREAALQRWNSTRWLLPLRIVFTLVKILSHYVFYAMVNEKSENPHWKAIG  207



>ref|XP_008444239.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Cucumis 
melo]
Length=731

 Score =   224 bits (570),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 160/212 (75%), Gaps = 6/212 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEH--VFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcg  758
             L+GPL+KGI++L   ++       L K G  V       KPP PS +I+CDAVVVGSG G
Sbjct  170   LYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSG  229

Query  759   ggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  938
             GGV++GVLA AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+   GL+ T ++++++LAGS
Sbjct  230   GGVVAGVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGS  289

Query  939   TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESF  1118
             TVGGGS VNWSASIKTP +V +EW + + LELF S++Y +A+D VC KMGVQ + ++E F
Sbjct  290   TVGGGSTVNWSASIKTPSHVTKEWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGF  349

Query  1119  QNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
              N VLRKGC EL    +NIP+N+ SDHYCGWC
Sbjct  350   NNAVLRKGCEELGGHAINIPRNSTSDHYCGWC  381



>gb|KJB10006.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=742

 Score =   177 bits (448),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 135/203 (67%), Gaps = 2/203 (1%)
 Frame = +3

Query  615   KGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATA  791
             KGII+    ++  F   LT+ G  V +  P    F I+CD V+VGSGCGGGV + VLA++
Sbjct  198   KGIIETMHEDDSTFVQSLTEKGLQVTE-DPDHNVFNIKCDVVIVGSGCGGGVAAAVLASS  256

Query  792   GYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWS  971
             G KV+V+EKGNY+A T+ + LEGPSM +++  GG L T +   +++AGSTVGGGSA+NWS
Sbjct  257   GQKVVVIEKGNYFATTDYTSLEGPSMSELYEYGGFLTTTNGKFMIMAGSTVGGGSAINWS  316

Query  972   ASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRE  1151
             ASIKTP  VL+EW   H + LFGS  Y  AMD V  ++GV   C +E  QN VLRKGC  
Sbjct  317   ASIKTPNNVLKEWSLDHKIPLFGSSEYENAMDAVYQRLGVTENCTEEGLQNQVLRKGCEN  376

Query  1152  LCYPVVNIPQNAPSDHYCGWCTF  1220
             L   V  +P+N+P DHYCG C  
Sbjct  377   LGLKVEAVPRNSPEDHYCGSCNL  399


 Score = 90.1 bits (222),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 94/161 (58%), Gaps = 6/161 (4%)
 Frame = +2

Query  44   TATKTLSPSQMETLSALCNTFLPAINEALPETTDAS-VTNFFQTSAASTGTPHQVAWVIN  220
            T T   S +Q+++L+A+C   +P +   L     AS +  F++ S A    P +VA ++ 
Sbjct  23   TYTHGFSSAQIQSLAAICEALIPPL--PLDSAHQASSLDAFYKASGAEPPLPDEVAEMMV  80

Query  221  QRMKHPKlns-lllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  397
            +R+  P++ S + ++L  +S R+G LLLCG      ++PF+ +F E+  ++RE+I+  W+
Sbjct  81   KRVVEPRVLSFVKVVLTVISFRLGALLLCGWDCCDWKWPFIHKFSELPVERREKILMKWS  140

Query  398  TSSLQFI--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++    +  R  F  +K   L +FF+  D+K +NPSWKAIG
Sbjct  141  SNGHHRLPLRAVFALIKTYCLFIFFSMTDEKSENPSWKAIG  181



>ref|XP_008364320.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Malus domestica]
Length=743

 Score =   176 bits (445),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+     +      LTK G  VA          I CD V+VGSGCGGGV + VL
Sbjct  198   PLDKGIIETVYESDSTLVQSLTKKGLEVAD-DAANNIHRINCDVVIVGSGCGGGVAAAVL  256

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPSM +++  GG++ + D  +++LAGSTVGGGSAV
Sbjct  257   AQSGQKVVVLEKGNYFVPKDYSSLEGPSMSELYESGGIMASVDAMVMILAGSTVGGGSAV  316

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VLREW   H + L+ S+ Y  AMD VC ++ V   C +E+FQN +LRKG
Sbjct  317   NWSASIRTPHNVLREWSVDHKIPLYASEDYQSAMDIVCKRISVTEGCTEENFQNQILRKG  376

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+ +DHYCG+C +
Sbjct  377   CENLGLKVESVPRNSSADHYCGFCNY  402


 Score = 91.3 bits (225),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 90/156 (58%), Gaps = 5/156 (3%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN-EALPETTDA---SVTNFFQTSAASTGTPHQVAWVINQRM  229
            S +QM++L+A+C   +P ++ E +P+   A   S +++   S +    P +VA +I +R 
Sbjct  26   SSAQMQSLAAICEALIPPLSLEEIPDDHQALHYSSSSYHTASGSQPPIPDEVAEMIVKRA  85

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  409
            +   ++++ L L  LS R+GT LLCGK     ++PF+ +F E S  KRE++++ W+   L
Sbjct  86   QPEAVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSEXSLDKREQVLNKWSRGKL  145

Query  410  QF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
               IR  F  +K      FF+ +D+   NP+WKAIG
Sbjct  146  VITIRLMFMVVKMFCFYTFFSRIDENSRNPAWKAIG  181



>dbj|BAJ86655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   173 bits (439),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 136/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  606   PLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++   L +  +   L   G +V KP   G    +ECD V+VGSGCGGGV + VL
Sbjct  209   PLDKGVVETRELDDATLLRSLADKGLAV-KPATSGYYHAVECDVVIVGSGCGGGVAAAVL  267

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+ G+KVLV+EKG+Y+   + S +EGPSM++++  GG+  T ++  VL AG+TVGGGSAV
Sbjct  268   ASVGHKVLVVEKGDYFTPDDYSSVEGPSMERLYEQGGIFCTSNVTTVLFAGTTVGGGSAV  327

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL EW   HGL +FGS  Y ++MD VC ++ V   C +E FQN V+R+G
Sbjct  328   NWSASIRTPREVLLEWSRDHGLPVFGSAGYVQSMDAVCARLAVTDGCREEGFQNKVVRRG  387

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C  L  PV  +P+N+   HYCG C
Sbjct  388   CEALGLPVDCVPRNSSEGHYCGNC  411


 Score = 93.2 bits (230),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 92/174 (53%), Gaps = 7/174 (4%)
 Frame = +2

Query  14   YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAI--NEALPETTDA----SVTNFFQTS  175
            + L R +  +  T  L P+QME L A+C+  +P++   EAL    D      +  F+  S
Sbjct  14   HPLLRVLRRDKYTHGLYPAQMEALRAMCDALIPSLPPEEALDGRRDTPRDKDLERFYLAS  73

Query  176  AASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPE  355
             A +  P +VA +   R        + + LW L TR+GTL LCG+  +S +FP++ RF +
Sbjct  74   GADSTIPDEVAELAFTRCVWEAGLLVHVTLWLLCTRLGTLALCGRLCVSGEFPYVRRFAD  133

Query  356  ISQKKRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +   +RE  +  W  +  L  ++  F  +K+L   VF+T V++  +NP WKAIG
Sbjct  134  MPVGRREEALGRWTRARWLIPVKIAFAIVKSLCFNVFYTKVNENSENPCWKAIG  187



>gb|KDO60414.1| hypothetical protein CISIN_1g004496mg [Citrus sinensis]
Length=748

 Score =   174 bits (442),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 133/208 (64%), Gaps = 4/208 (2%)
 Frame = +3

Query  606   PLYKGIIDL---NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisg  776
             PL KGI++    N  +  +F RL   G  V         F I+CD VVVGSGCGGGV + 
Sbjct  195   PLQKGIVETVHENENDHSLFQRLVDHGLQVTVDHEHNL-FEIKCDVVVVGSGCGGGVAAA  253

Query  777   vLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGS  956
             VLA++G KVLVLEKGNY+   + S LEGPSM +++  GGLL T D   ++ AGS VGGGS
Sbjct  254   VLASSGQKVLVLEKGNYFVAEDYSSLEGPSMHELYESGGLLSTLDGKFMVFAGSAVGGGS  313

Query  957   AVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLR  1136
             AVNWSA I+TP  VLR+W   H + LFGS  Y  AMD V  ++GV   C +E FQN VLR
Sbjct  314   AVNWSACIETPDSVLRDWFVEHKIPLFGSLDYRAAMDKVSKRIGVTEHCTEEGFQNQVLR  373

Query  1137  KGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             KGC  L + V ++ +N P +HYCG C +
Sbjct  374   KGCENLGFKVESVARNTPEEHYCGSCNY  401


 Score = 91.7 bits (226),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 88/155 (57%), Gaps = 10/155 (6%)
 Frame = +2

Query  71   QMETLSALCNTFLPAINEALPETT------DASVTNFFQTSAASTGTPHQVAWVINQRMK  232
            ++E+L+A+C T +P +    PET       + ++ +F++ SA+    PH+VA ++ +R +
Sbjct  27   EIESLAAICQTLVPPLP---PETITKQHSHNQAIVSFYKASASQHPIPHEVAELMVKRGQ  83

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  412
               +    L+L  LS R+GTLLLCG       +PF+  F EIS +KRE+I+  W+     
Sbjct  84   PQAVFLARLILTLLSFRLGTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKKWSRERYL  143

Query  413  F-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              +R  F  +K   L  FF   D+K +NP+W+AIG
Sbjct  144  LPLRIVFVMIKMFCLFDFFARTDEKSENPAWEAIG  178



>gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Erythranthe guttata]
Length=747

 Score =   171 bits (433),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 130/206 (63%), Gaps = 1/206 (0%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+     +      L + G  VA+      +  IECD V+VGS CGGGV + VL
Sbjct  196   PLEKGVIETEKENKLTLRESLVQKGLKVAENPKDHNTLNIECDVVIVGSDCGGGVAAAVL  255

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+VLEKG+Y+   + S LEGPSM++M+  GG+  T     +LLAGSTVGGGSAV
Sbjct  256   AKAGLKVVVLEKGHYFTAEDYSELEGPSMNEMYASGGIFSTLHGKFILLAGSTVGGGSAV  315

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP +VL+EW     + +FG   Y  AMD V G++GV   C +E FQN V+RKG
Sbjct  316   NWSASIKTPDHVLQEWSAEKKISMFGGAEYQSAMDEVWGRIGVTENCVEEGFQNQVVRKG  375

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  + +N+  +HYCG C +
Sbjct  376   CENLGLKVEGVARNSTENHYCGSCGY  401


 Score = 95.5 bits (236),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 93/154 (60%), Gaps = 3/154 (2%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            S SQ+++L+A+C   +P++  N     + D ++ +++ +SA+ T  P++ A +I +R   
Sbjct  26   SSSQIQSLAAVCEALIPSLPTNGVNQISDDNALYSYYTSSASQTPFPNETAELIVKRGIP  85

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
              +  + L+L FLSTRIGTLLLCG   L  ++PF+ +F E+S  KRE I+  W+  +L  
Sbjct  86   KAVLVVSLVLKFLSTRIGTLLLCGSNCLDWKWPFIHKFSELSINKRESILQKWSRGTLVL  145

Query  416  -IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +R  F  +K      FF+  D+K  NP+W+AIG
Sbjct  146  PLRTVFFMLKVTCFYTFFSLTDEKSQNPAWEAIG  179



>ref|XP_004150760.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Cucumis sativus]
Length=617

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 159/212 (75%), Gaps = 6/212 (3%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEH--VFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcg  758
             L+GPL+KGI++L   ++       L K G  V       KPP PS +I+CDAVVVGSG G
Sbjct  56    LYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSG  115

Query  759   ggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  938
             GGVI+GVLA AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+   GL+ T ++++++LAGS
Sbjct  116   GGVIAGVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGS  175

Query  939   TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESF  1118
             TVGGGS VNWSASI+TP ++ REW + + LELF S++Y +A+D VC KMGVQ + ++E F
Sbjct  176   TVGGGSTVNWSASIETPSHITREWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGF  235

Query  1119  QNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
              N VLRKGC EL    + IP+N+ SDHYCGWC
Sbjct  236   NNAVLRKGCEELGGHAITIPRNSTSDHYCGWC  267



>ref|XP_006367233.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum tuberosum]
Length=734

 Score =   175 bits (444),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 143/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +GI++ +N  +E +   L+K G ++A+      +F I+CD ++VGSGCGGGV +G+L
Sbjct  189   PLERGIVETINESDETLKESLSKKGVAIAEDTKDN-TFKIKCDVLIVGSGCGGGVAAGIL  247

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +GYKV+VLEKG+Y+   + S LEGPS+ +++  G +L + D  ++++AG+TVGGGSAV
Sbjct  248   AKSGYKVVVLEKGHYFVPEDYSGLEGPSLSELYETGAMLSSLDGKVMIMAGTTVGGGSAV  307

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL++W E H +  FG+  Y  AMDTVC ++GV   C +E  QN V+RKG
Sbjct  308   NWSASIRTPNDVLKDWSENHKISWFGTSEYQSAMDTVCKRIGVTENCSEEGLQNQVIRKG  367

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  IP+N+  +HYCG C +
Sbjct  368   CENLGLKVDKIPRNSSENHYCGSCGY  393


 Score = 89.4 bits (220),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 95/175 (54%), Gaps = 12/175 (7%)
 Frame = +2

Query  38   NNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVI  217
            N+  T   S +Q++T+S+ C T +P  N            +FF +S A    P++VA ++
Sbjct  17   NSNYTHGFSSTQIQTISSFCETLVPPCN-----NKGIDDNSFFASSGARPPYPNEVAELL  71

Query  218  NQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  397
             +R K   L  + ++++ LSTR+G+LLLCG+  L  ++PF+  F E+  K RE ++  W+
Sbjct  72   VKRSKPEALFIIRIVVFLLSTRLGSLLLCGRVCLDKRWPFVHNFSELDLKDREALLQRWS  131

Query  398  TSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRPFHF*KTKET  559
              +    +R  F  +K +   +FF+  D+   NP+W+AIG      +H  +T ET
Sbjct  132  RETFLIPLRITFLMIKIVCFFIFFSWTDENCKNPTWEAIG------YHLPETTET  180



>ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=744

 Score =   169 bits (429),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 138/211 (65%), Gaps = 12/211 (6%)
 Frame = +3

Query  606   PLYKGIID------LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  767
             PL KGI++      L+LP+      L++ G  + +         ++CD V+VGSGCGGGV
Sbjct  198   PLEKGIVEAMNEDNLSLPQS-----LSQKGLEI-EIDAKNNILKVKCDVVIVGSGCGGGV  251

Query  768   isgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  947
              + VLA +G KVLVLEKGNY+ + + S LEGPS+++++  GG   + D ++ +LAGSTVG
Sbjct  252   AAAVLAKSGLKVLVLEKGNYFTQNDYSSLEGPSLNELYELGGTFASCDGNIAILAGSTVG  311

Query  948   GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNM  1127
             GGSAVNWSASI+TP YVL+EW E H L LF S  Y  AMD VC ++GV   C +E  QN 
Sbjct  312   GGSAVNWSASIRTPDYVLKEWSENHKLPLFSSHEYVSAMDMVCKRIGVTDTCVEEGLQNQ  371

Query  1128  VLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             VLRKGC +L   V  +P+N+   HYCG C +
Sbjct  372   VLRKGCEKLGLQVDYVPRNSSQHHYCGSCNY  402


 Score = 95.1 bits (235),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 87/157 (55%), Gaps = 6/157 (4%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTN-----FFQTSAASTGTPHQVAWVINQR  226
            S + ME L+++C   LP I     +      TN     F++ S +    PHQVA ++ +R
Sbjct  25   SSANMEALASMCEALLPPIESEYLDKKGMKPTNKAIHLFWKLSGSHLSVPHQVAEMLVER  84

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
                 L  + ++L  LSTR+GTLLLCG   L+ ++PF+  F  IS + RE+++  W    
Sbjct  85   ALPEALTLIRVILSMLSTRLGTLLLCGSLCLNKKWPFINNFSNISLENREKVIQKWLKHR  144

Query  407  -LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             L  +R  F  +K L L+VFF+  ++ G+N +W+AIG
Sbjct  145  FLTPVRLVFIYIKVLCLIVFFSRCNENGENQAWEAIG  181



>ref|XP_008668721.1| PREDICTED: uncharacterized protein LOC100274574 isoform X1 [Zea 
mays]
 gb|ACR36691.1| unknown [Zea mays]
 tpg|DAA49652.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=783

 Score =   171 bits (432),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 135/206 (66%), Gaps = 1/206 (0%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  G+++  L +++   R L   G +V           ++CDAV+VGSGCGGGV + VL
Sbjct  230   PLDVGVVETRLLDDNKLLRSLVGRGLTVKPASSDANHHTVQCDAVIVGSGCGGGVAAAVL  289

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AGYKV+V+EKG+Y+   + S +EGPSM+++F  GG+  T ++  ++  G+TVGGGSAV
Sbjct  290   ASAGYKVVVVEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNVTTMIFTGATVGGGSAV  349

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  V +EW   HGL +F S  Y +AMD VC ++GV   C++E FQN V+R+G
Sbjct  350   NWSASIRTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDGCQEEGFQNKVVRRG  409

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L      +P+N+   H+CG C F
Sbjct  410   CEALGLCADAVPRNSSDAHFCGSCNF  435


 Score = 93.6 bits (231),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 88/171 (51%), Gaps = 14/171 (8%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEALPETTDAS---------VTNFFQTSAASTGTPHQ  202
            T  + P+QME L A+C   +P+    LP   DA          +  F+  SAA +  P +
Sbjct  49   THGMRPAQMEALRAMCGALIPS----LPADADAGRGDPPGGKDLERFYLASAADSTIPDE  104

Query  203  VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  382
            VA ++  R     +    ++LW LSTR GTLLLCG+ SL   FP++ RF +++ ++RE  
Sbjct  105  VAELMVTRCIREAVALAWVVLWALSTRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAA  164

Query  383  VHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +  W      F +R  F  +K L   VF+  V++  +NP WKAIG     P
Sbjct  165  LRRWNRVRWLFPLRIAFAIVKILCHYVFYAMVNENSENPYWKAIGYSVDEP  215



>ref|XP_009336115.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=750

 Score =   177 bits (449),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+     +      LTK G  VA          I+CD V+VGSGCGGGV + VL
Sbjct  200   PLDKGIIETVYESDSTLVQSLTKKGLEVAD-DAENNIHRIKCDVVIVGSGCGGGVAAAVL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPSM +++  GG++ + D  +++LAGSTVGGGSAV
Sbjct  259   AQSGQKVVVLEKGNYFVPKDYSSLEGPSMSELYESGGIMSSVDAMVMILAGSTVGGGSAV  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VLREW   H + L+ S+ Y  AMD VC ++GV   C  E+FQN +LRKG
Sbjct  319   NWSASIRTPNNVLREWSVDHKIPLYASEDYQSAMDIVCKRIGVTESCTKENFQNQILRKG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+ +DHYCG+C +
Sbjct  379   CENLGLKVESVPRNSSADHYCGFCNY  404


 Score = 87.0 bits (214),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 90/158 (57%), Gaps = 7/158 (4%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN-EALPETTDA-----SVTNFFQTSAASTGTPHQVAWVINQ  223
            S +QM++L+A+C + +P +  E +P+   A     S +++   S +    P +VA +I +
Sbjct  26   SSAQMQSLAAICESLIPPLPLEEIPDDHQALHSSSSSSSYHTASGSQPPIPDEVAEMIVK  85

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R     ++++ L L  LS R+GT LLCGK     ++PF+ +F E+S  KRE++++ W+  
Sbjct  86   RALPEGVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSEMSLDKREQVLNKWSRG  145

Query  404  SLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             L   IR  F  +K      FF+ +D+   NP+WKAIG
Sbjct  146  KLVITIRLMFMVVKMCCFYTFFSRIDENSRNPAWKAIG  183



>gb|KJB72414.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=746

 Score =   183 bits (465),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 145/206 (70%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ ++  +  ++  L++ G  V++       + I+CDAVV+GSGCGGGV + +L
Sbjct  199   PLQKGMIETVHEKDSTLYRSLSQKGLLVSEDTQQN-VYRIKCDAVVIGSGCGGGVAAAML  257

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+V+EKGNY+  T+ S  EGPSMDK++  GG+L + D  +++LAGSTVGGGSAV
Sbjct  258   AGSGLKVVVVEKGNYFTSTDYSPFEGPSMDKLYESGGILPSLDGQLLILAGSTVGGGSAV  317

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP YVL+EW E   + LFGS+ Y  AM+TVC ++GV  +C++E FQN VLRKG
Sbjct  318   NWSACIKTPKYVLKEWAEDCKIPLFGSNEYVSAMETVCERIGVTHDCKEEGFQNQVLRKG  377

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+   HYCG C F
Sbjct  378   CENLGLKVEKVPRNSSESHYCGSCGF  403


 Score = 80.5 bits (197),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 89/175 (51%), Gaps = 13/175 (7%)
 Frame = +2

Query  20   LHRKMENNTATKTLSPSQMETLSALCNTFLPAI--------NEALPETTDASVTNFFQTS  175
            LH        +     ++++TL+++   F P++         E  P     +V +F + S
Sbjct  11   LHGDKREPKYSHGFCSAEIQTLASVAEVFFPSLPPDSGFQGKETQP---SKAVQSFLKAS  67

Query  176  AASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPE  355
            A+    P +VA ++ +R     +  + ++L  L TR+G+LLLCG+  L  ++PF+  F  
Sbjct  68   ASQPAFPDEVAELLGKRAFIESVIVVRIVLVLLWTRVGSLLLCGRQCLGKEWPFINDFGS  127

Query  356  ISQKKRERIVHSWATSSLQF--IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +  +KRE+++ +W      F   R  F  +K   L V+F+ V + G NP+W+AIG
Sbjct  128  MGVEKREKVMQNWLKHGFLFTPTRVAFIYLKVFCLFVYFSRVGEDGYNPAWEAIG  182



>ref|XP_012069873.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Jatropha curcas]
 gb|KDP40361.1| hypothetical protein JCGZ_02359 [Jatropha curcas]
Length=755

 Score =   177 bits (448),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +GII+ +   E  + + LT+ G  V K  P      I CD  +VGSGCGGGV + VL
Sbjct  193   PLQEGIIETMQENESTLMHNLTQKGLKVTK-DPKKKICKINCDVAIVGSGCGGGVAAAVL  251

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             AT+G KVLVLEKGNY+   + S LEGPS D+++  G +L T D +++++AGS VGGGSA+
Sbjct  252   ATSGQKVLVLEKGNYFTAKDYSGLEGPSHDQLYESGAILPTTDANLMIMAGSAVGGGSAI  311

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I TP  +L+EW E H L+LFG+  Y  AM+TVC ++GV R C +E FQN VLRKG
Sbjct  312   NWSACINTPQSLLQEWSENHKLKLFGTAEYLSAMETVCQRIGVTRNCVEEGFQNQVLRKG  371

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+   HYC  C +
Sbjct  372   CENLGLEVNTVPRNSSEKHYCWSCGY  397


 Score = 86.7 bits (213),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 83/156 (53%), Gaps = 7/156 (4%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTN----FFQTSAASTGTPHQVAWVINQRM  229
            S ++M+ LS++C T LP I  ++P      ++     FF+ S      P Q+A ++ +R 
Sbjct  23   SSAEMKALSSICETVLPPI--SIPGKGGHEISKPVQAFFKASGFENPVPDQIAELLVKRA  80

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-  406
                L  + L+L  LSTR+GTLLLCG      ++P+L  F  IS  KRE+I+  W  +  
Sbjct  81   IIEGLILVRLVLLALSTRLGTLLLCGSLCFGEKWPYLNTFSSISLDKREKIMQKWFKNRF  140

Query  407  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
               IR  F  +K   L  FF   D+ G NP+W+AIG
Sbjct  141  FTPIRLVFQLIKVGCLYTFFAQADENGKNPAWEAIG  176



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score =   173 bits (439),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 133/204 (65%), Gaps = 2/204 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPE-EHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++        +   LT+ G  V K       + I+CD V+VGSGCGGGV + VL
Sbjct  196   PLEKGIVETMYETGSTIVQSLTQKGLQVTKDSKQNV-YKIKCDVVIVGSGCGGGVAAAVL  254

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG KV+V+EKGNY+   + SLLEGPS ++++  GG+L T D  M +LAGSTVGGGSAV
Sbjct  255   ASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPTTDASMTILAGSTVGGGSAV  314

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  +L+EW   + L LFGS  Y  AMD V  ++GV   C  E FQN VLRKG
Sbjct  315   NWSACIKTPKSLLQEWAGQYKLPLFGSPDYLSAMDIVWERIGVTENCVQEGFQNQVLRKG  374

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C+ L   V  IP+N+  +HYCG C
Sbjct  375   CKNLGLDVERIPRNSSENHYCGSC  398


 Score = 90.5 bits (223),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 96/167 (57%), Gaps = 5/167 (3%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAI----NEALPETTDASVTNFFQTSAASTGT  193
            R+ +       LS +++ +L++LC  FLP +    +E   +    ++ +F++ S A    
Sbjct  12   RRSKAEKHNHGLSSAELLSLASLCEVFLPTLPSVSSEGKEDRPSQALESFYKASGAQAPV  71

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
            P +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KR
Sbjct  72   PDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKR  131

Query  374  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            E+++  W  + +   +R  F  +K   L VFF+ +D+ G NP+W+AI
Sbjct  132  EKVLQKWFKNWIFTPVRIAFFILKIFCLFVFFSQLDENGKNPAWEAI  178



>ref|XP_008224323.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Prunus mume]
Length=751

 Score =   172 bits (437),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ +   +  + + L + G +V +  P    + I+CD VVVGSGCGGGV + VL
Sbjct  199   PLQKGMIETIYETDTTLLHSLAEKGLTV-RHDPQENLYKIKCDVVVVGSGCGGGVAAAVL  257

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKGNY+  ++ S LEGPS D+M+  GG+  T D  +V+ AGSTVGGGSAV
Sbjct  258   ASSGQKVIVLEKGNYFTHSDYSSLEGPSQDQMYELGGIFATIDGKLVIQAGSTVGGGSAV  317

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP  VL EW + H +  FG   Y  AMDTVC ++GV   C +E FQN VLRKG
Sbjct  318   NWSACIRTPDNVLEEWAKDHDIRFFGEPEYVSAMDTVCERIGVTDNCVEEGFQNQVLRKG  377

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+   HYCG C +
Sbjct  378   CENLGLGVDFVPRNSSEKHYCGSCGY  403


 Score = 90.9 bits (224),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 89/159 (56%), Gaps = 8/159 (5%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  220
            S ++M++L+++C   LPA+            + T+ +V +F + S A T  P +VA ++ 
Sbjct  23   SSAEMQSLASVCEALLPALPLNDFCFEGKEEQRTNKAVQSFHKASGAQTPIPDEVAELLV  82

Query  221  QRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  400
            +R     +  + ++LW LSTR+GTLLLCG      ++PF+L F  +   KRER++  W  
Sbjct  83   KRAFIEAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPFILNFSSLPLAKRERLLQKWFK  142

Query  401  SS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
               L  IR  F  +K L L +FF+ VD   +NP W+AIG
Sbjct  143  HRFLTPIRLAFVYIKFLCLYIFFSRVDKNAENPIWQAIG  181



>ref|XP_012085273.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Jatropha curcas]
Length=735

 Score =   174 bits (442),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++L N  +  +   L + G  V +         I+CD V+VGSGCGGGV + VL
Sbjct  192   PLQKGIVELANEDDSTILQSLIEKGLEVTEDSEHKIC-KIKCDVVIVGSGCGGGVAAAVL  250

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KVLVLEKGNY+   + S LEGPSM +++  GG+L T +  +++LAGSTVGGGSA+
Sbjct  251   ASSGLKVLVLEKGNYFVAEDYSSLEGPSMAELYESGGILSTLNGKVMILAGSTVGGGSAI  310

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP YVLREW   H +  +GS  Y  AMD V  ++GV   C +ESFQN VLRKG
Sbjct  311   NWSACIRTPDYVLREWSLDHKIRFYGSSDYQYAMDAVSKRIGVTDNCLNESFQNQVLRKG  370

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++ +N+ +DHYCG C F
Sbjct  371   CENLGLKVESVARNSSADHYCGSCNF  396


 Score = 89.4 bits (220),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 85/158 (54%), Gaps = 6/158 (4%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLP-----AINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  223
            L   Q++ L+A+C  F+P      ++  +P     ++ +F+Q S +    PH+VA  + +
Sbjct  20   LCSGQIQALAAMCEAFVPPLPVNDLSNEIPVDKQQALRSFYQASGSDPPIPHEVAEFMVK  79

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R     +  +  +L  LS R+GTLLLCG       +PF  +F E+S KKRE I+  W+  
Sbjct  80   RGLPEIVKVVKSVLKVLSFRLGTLLLCGFICFDWNWPFFHKFSELSVKKREEILLKWSRQ  139

Query  404  SLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
               F +R  F A++   L  FF+  D+  +NP+W+AIG
Sbjct  140  KYIFPLRAAFVAVRIFCLYTFFSRTDENSENPAWEAIG  177



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score =   174 bits (440),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 137/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +   +  + + LT+ G  V K       + I+CD V+VGSGCGGGV + VL
Sbjct  196   PLEKGIVETMYETDSTIVHSLTQKGLQVTKDSKQ-KVYKIKCDVVIVGSGCGGGVAAAVL  254

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG KV+V+EKGNY+   + SLLEGPS ++++  GG+L T D +M +LAGST+GGGSA+
Sbjct  255   ASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPTTDANMTILAGSTIGGGSAI  314

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  +L+EW   + L LFGS  Y  AMD V  ++GV   C  E FQN VLRKG
Sbjct  315   NWSACIKTPKSLLQEWAGDYKLPLFGSPDYLSAMDIVWERIGVTENCVQEGFQNQVLRKG  374

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C+ L   V  IP+N+  +HYCG C
Sbjct  375   CKNLGLDVERIPRNSSENHYCGSC  398


 Score = 89.4 bits (220),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 93/167 (56%), Gaps = 5/167 (3%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAIN----EALPETTDASVTNFFQTSAASTGT  193
            R+ +       LS +++  L++LC  FLP +     E   +    ++ +F++ S A    
Sbjct  12   RRSKAEKYNHGLSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGAQAPV  71

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
            P +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KR
Sbjct  72   PDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKR  131

Query  374  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            E+++  W  + +   +R  F  +K   L VFF  +D+ G NP+W+AI
Sbjct  132  EKVLQKWFKNWIFTPVRIAFVTLKIFCLFVFFCQLDENGKNPAWEAI  178



>gb|AGC65582.1| fatty alcohol oxidase [Simmondsia chinensis]
Length=721

 Score =   180 bits (456),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 137/205 (67%), Gaps = 0/205 (0%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLA  785
             PL KGI++    +     R  K  C           F ++CD V+VGSGCGGGV +GVLA
Sbjct  171   PLQKGIVECTNTDNDNLLRSLKEKCVEVTEDHEKNMFKVKCDVVIVGSGCGGGVAAGVLA  230

Query  786   TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVN  965
             ++G KVLV+EKGNY+A  + S LEGPS+D++++ GG+L T D  M+L +GSTVGGGSA+N
Sbjct  231   SSGLKVLVIEKGNYFAPGDYSSLEGPSLDELYVSGGMLTTLDGKMLLFSGSTVGGGSAIN  290

Query  966   WSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGC  1145
             WSASI+TP  V++EW   H L +F S  Y  AMD VC ++GV  +C +E FQN VLR+GC
Sbjct  291   WSASIRTPDPVIKEWSVNHRLPIFNSSDYRLAMDEVCKRIGVTEKCTEEGFQNQVLRQGC  350

Query  1146  RELCYPVVNIPQNAPSDHYCGWCTF  1220
               L   V  +P+N+  +HYCG CT+
Sbjct  351   ENLGLEVEKVPRNSSENHYCGSCTY  375


 Score = 83.2 bits (204),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = +2

Query  149  SVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ  328
            ++  FF    +    P  VA ++ +R     + ++ + L  LSTRIGTLLLCG  SL+ +
Sbjct  32   AIRAFFSAPGSRPPIPEAVAELMKRRALPEAVVAVRVALRLLSTRIGTLLLCGFRSLTWK  91

Query  329  FPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWK  505
            +PFLL+F +I   KRE+I+ SW+  S    +R  F  +K +   VFF+  D+   NP+W+
Sbjct  92   WPFLLKFSQIQLHKREKILQSWSKQSFWTSLRVVFLLIKVVCCFVFFSQTDENSKNPAWE  151

Query  506  AIG  514
            AIG
Sbjct  152  AIG  154



>ref|XP_010038987.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
Length=441

 Score =   176 bits (447),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 139/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +G+++ ++  +  +   LT+ G  V +  P   +F I+CD V++GSGCGGGV + VL
Sbjct  210   PLQRGLVETVHETDSSLIQSLTQKGLKVTQI-PQHNAFKIKCDVVIIGSGCGGGVAAAVL  268

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPS+D+++    LL T D  +V+LAGSTVGGGSAV
Sbjct  269   AHSGQKVVVLEKGNYFVPQDYSSLEGPSLDQLYESSALLSTVDGKIVVLAGSTVGGGSAV  328

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP +VL+EW   H + LFG+  Y  AMD VC K+GV R+CE E FQN +LRKG
Sbjct  329   NWSACIRTPSHVLKEWSVDHKIRLFGTPDYGSAMDAVCKKIGVTRKCEQEGFQNQILRKG  388

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  + +N+   H+CG C +
Sbjct  389   CESLGLKVEAVARNSSEGHFCGSCCY  414


 Score = 86.7 bits (213),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 92/170 (54%), Gaps = 20/170 (12%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPA-----INEALPETTDASVTNFFQTSAASTGTP----------  196
            SP+Q++ L+A+C T +P+     IN  +P   D ++ +F+  S +    P          
Sbjct  23   SPAQIQALAAICETLIPSVSLDSINPKIPHD-DPALHSFYSASGSQPSVPDEVFVSDSFH  81

Query  197  ---HQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  367
                QVA ++ +R +   +  + ++L  LS R+GTL+LC    L++ +PF+L F E+  +
Sbjct  82   DNGEQVAEILTKRAQRQVVVMVSIVLKMLSFRLGTLMLCWGSCLASTWPFILNFSEMPVE  141

Query  368  KRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +RER++ +W+       +R  F  +K   L +F+T  D+  +N +W+AIG
Sbjct  142  RRERVLMNWSRQKFVVPLRIVFVMIKIYCLFIFYTRTDENSNNLAWEAIG  191



>ref|XP_010069617.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW58025.1| hypothetical protein EUGRSUZ_H00753 [Eucalyptus grandis]
Length=746

 Score =   179 bits (454),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 135/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPE-EHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG I+        +   LT  G  V++      S  I+CDAV++GSGCGGGV + VL
Sbjct  194   PLEKGTIETMYESGSSLVQSLTGKGLKVSECSKTN-SCNIKCDAVIIGSGCGGGVAAAVL  252

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKG+Y+   + S LE PSM++M+  GGLL T D   +++AGSTVGGGSAV
Sbjct  253   AQSGQKVVVLEKGDYFTPQDYSSLEAPSMNQMYESGGLLSTVDGKFMIMAGSTVGGGSAV  312

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VL EW   H + LFGS  Y  AMD VC ++GV   C +E FQN +LRKG
Sbjct  313   NWSASIKTPSSVLHEWSVDHKIPLFGSPEYLSAMDAVCKRIGVTENCSEEGFQNQILRKG  372

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+P +HYCGWC +
Sbjct  373   CSNLGLHVETVPRNSPENHYCGWCCY  398


 Score = 83.6 bits (205),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 90/157 (57%), Gaps = 8/157 (5%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLP-----AINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  226
            S  Q+++L+A+C T LP     +I+E  P   + +V +FF+ S +    P ++A  + +R
Sbjct  23   SADQIQSLAAMCETLLPPLSPDSIDEDSPR--NEAVYSFFRASGSQHPIPDEIAERLAKR  80

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA-TS  403
             +   L  + L+L  LS R+GTLLLCG   L  ++PF+ +F E+  ++RE +++ W+   
Sbjct  81   GQRSALLVVSLVLKILSYRLGTLLLCGFLCLDWRWPFIRKFHEMPLERREIVLNRWSRQK  140

Query  404  SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             L  ++  F  +K   L  FF+  D+   NPSW+AIG
Sbjct  141  KLIPLKVAFAMVKLFCLFHFFSRTDENSKNPSWEAIG  177



>ref|XP_010670985.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Beta vulgaris subsp. 
vulgaris]
Length=748

 Score =   169 bits (427),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 132/206 (64%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPE-EHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  GII+        +   LT  G SV +       + I+CD V+VGSGCGGGV + +L
Sbjct  196   PLENGIIETFYETPTTLLQSLTSKGLSVTEDHIDN-LYRIKCDVVIVGSGCGGGVAAAIL  254

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+VLEKGNYY   + S LEGPSMD++   GG++ T D  ++LLAGSTVGGG+AV
Sbjct  255   AGAGQKVVVLEKGNYYTAPDYSSLEGPSMDELLEKGGMIPTTDGAVMLLAGSTVGGGTAV  314

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA++ TP  VL+EW E HGL LFGS  Y  AM +V  ++GV  EC  E FQN VLRKG
Sbjct  315   NWSAALNTPDPVLKEWSEEHGLSLFGSPQYKFAMQSVTQRLGVTTECVKEGFQNQVLRKG  374

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L      +P+N+   HYCG C +
Sbjct  375   CENLGLEADRVPRNSSESHYCGSCYY  400


 Score = 94.0 bits (232),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 97/168 (58%), Gaps = 13/168 (8%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDA------SVTNFFQTSAASTGTP  196
            + N   + LS S+ME+L ++C TF P ++   P   D       S+  FFQ+SA+    P
Sbjct  16   KKNYDRQLLSSSEMESLISICETFFPPLDP--PSKLDHHDQINNSIKYFFQSSASQKPIP  73

Query  197  HQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRE  376
            ++VA V+  R     +  + ++LW +STR+GTLLLCG      ++P++ +F  +  ++RE
Sbjct  74   NEVAEVMKDRGLVEAVILVRVVLWLISTRLGTLLLCGFLCFGKEWPYITKFSHLPIERRE  133

Query  377  RIVHSWATSSLQF---IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            RI+ +W  SS +F   +R  F  +K+L L   F+ VDD   NP+W+AI
Sbjct  134  RILKNW--SSHRFFSPLRLVFYFLKSLCLYFCFSLVDDHAHNPAWEAI  179



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score =   172 bits (437),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 135/204 (66%), Gaps = 2/204 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +   +  +   LT+ G  V K       + I+CD V+VGSGCGGGV + VL
Sbjct  196   PLEKGIVETMYETDSTIVQSLTQKGLQVTKDSKQNV-YKIKCDVVIVGSGCGGGVAAAVL  254

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG KV+V+EKGNY+   + SLLEGPS ++++  GG+L T D  M +LAGSTVGGGSAV
Sbjct  255   ASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPTTDASMTILAGSTVGGGSAV  314

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  +L+EW   + L LFGS  Y  AMD V  ++GV   C  E FQN VL+KG
Sbjct  315   NWSACIKTPKSLLQEWAGDYKLPLFGSPDYLSAMDIVWERIGVTENCVQEGFQNQVLQKG  374

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C+ L   V  IP+N+  +HYCG C
Sbjct  375   CKNLGLDVERIPRNSSENHYCGSC  398


 Score = 90.1 bits (222),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 95/167 (57%), Gaps = 5/167 (3%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAIN----EALPETTDASVTNFFQTSAASTGT  193
            R+ +       LS +++ +L++LC  FLP ++    E   +    ++ +F++ S A    
Sbjct  12   RRSKAEKHNHGLSSAELLSLASLCEVFLPTLSSVSSEGKEDRPSQALESFYKASGAQAPV  71

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
            P +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KR
Sbjct  72   PDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKR  131

Query  374  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            E+++  W  + +   +R  F  +K   L VFF  +D+ G NP+W+AI
Sbjct  132  EKVLQKWFKNWIFTPVRIAFFILKTFCLFVFFCQLDENGKNPAWEAI  178



>gb|EMS48507.1| Long-chain-alcohol oxidase FAO1 [Triticum urartu]
Length=579

 Score =   176 bits (447),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 137/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  606   PLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  G+++   L +  +   L   G +V KP   G    +ECD V+VGSGCGGGV + VL
Sbjct  209   PLDNGVVETRELDDATLLRSLADKGVAV-KPATSGDYHAVECDVVIVGSGCGGGVAAAVL  267

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G+KVLV+EKG+Y+   + S +EGPSM++++  GG+  T ++  VL AG+ VGGGSAV
Sbjct  268   ASSGHKVLVVEKGDYFTPDDYSSVEGPSMERLYEQGGVFCTSNVSTVLFAGTAVGGGSAV  327

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL+EW   HGL +FGS  Y +AMD VC ++ V   C +E FQN V+R+G
Sbjct  328   NWSASIRTPREVLQEWSRDHGLPVFGSAGYVQAMDAVCARLAVTDGCREEGFQNKVVRRG  387

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C  L  PV ++P+N+   HYCG C
Sbjct  388   CEALGLPVDSVPRNSSEGHYCGSC  411


 Score = 86.3 bits (212),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 89/174 (51%), Gaps = 7/174 (4%)
 Frame = +2

Query  14   YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAI--NEALPETTDA----SVTNFFQTS  175
            + L R +  +  T  L P+QME L A+C   +P++   EAL    D      +  F+  S
Sbjct  14   HPLLRVLRRDKYTHGLYPAQMEALRAMCGALIPSLPPEEALDGRRDTPRDKDLERFYLAS  73

Query  176  AASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPE  355
             A +  P +VA +   R        + + LW L TR+GTL LCG+  +S +FP++ RF +
Sbjct  74   GADSTIPDEVAELAFTRCVWEAGLLVHVTLWLLCTRLGTLALCGRLCVSGEFPYVRRFAD  133

Query  356  ISQKKRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +   +RE  +  W  +  L  ++  F  +K L   VF+T +++  +NP  KAIG
Sbjct  134  MPVGRREEALRRWTRARWLIPVKIAFAMVKTLCFNVFYTKLNENSENPCLKAIG  187



>ref|XP_008804287.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=759

 Score =   178 bits (451),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 138/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ ++  +  +   LT  G +V++  P    + I+CD  +VGSGCGGGV + VL
Sbjct  206   PLEKGIIETMDQTDSSLLQSLTMKGLAVSQ-DPNQNLYEIKCDVAIVGSGCGGGVAAAVL  264

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG KV+V+EKGNY+   + + +E PSM++M+  GG+L T D  ++LLAGSTVGGGSAV
Sbjct  265   ASAGRKVVVIEKGNYFTSEDYTSIEAPSMNEMYESGGILSTLDGKIMLLAGSTVGGGSAV  324

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP +VL+EW     L LFGS  Y  AMD VC ++GV   C +E FQN VLRKG
Sbjct  325   NWSACIKTPDHVLKEWAGERRLRLFGSTDYLSAMDAVCRRLGVTENCTEEGFQNKVLRKG  384

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N    H+CG C +
Sbjct  385   CENLGLQVDSVPRNTSERHFCGSCCY  410


 Score = 84.3 bits (207),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 93/171 (54%), Gaps = 8/171 (5%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPA-------INEALPETTDASVTNFFQTSAAS  184
            R+ E    +   SPSQ+++L+A+C  F+P+       ++    +    S+  F+  S + 
Sbjct  19   RRTEKGGHSHGFSPSQIQSLAAMCEAFIPSLPMEELHVSSGKEDPPTKSLQAFYLASGSE  78

Query  185  TGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  364
            +  P +VA ++ +R     L  + L+LW L+T++GTL+LC   SL  +FPF+ +F ++  
Sbjct  79   SPIPDEVAELLVKRGMKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFPFINKFSDMPI  138

Query  365  KKRERIVHSW-ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +KRE ++  W    +   +R  F  +K   L +F++  ++  +N SW AIG
Sbjct  139  EKREEVLKRWNKEKNFVPLRMVFVMVKIFCLYIFYSMTNENSENQSWNAIG  189



>ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao]
 gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]
Length=740

 Score =   178 bits (452),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+    ++  F   LT+ G  V +  P    + I+CD V+VGSGCGGGV + VL
Sbjct  195   PLQKGIIETMHEDDSTFVQSLTEKGLQVME-DPEHNVYKIKCDVVIVGSGCGGGVAAAVL  253

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+V+EKGNY+A  + + LEGPSM +++  GG L T +  ++++AGSTVGGGSA+
Sbjct  254   ASSGQKVVVIEKGNYFAPQDYTSLEGPSMSELYESGGFLTTTNGKIMIMAGSTVGGGSAI  313

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VLREWC  H +  FGS  Y  AMD V  ++GV   C +E FQN VLRKG
Sbjct  314   NWSASIKTPKNVLREWCVDHKIPFFGSSEYEIAMDAVRKRIGVTENCTEEGFQNQVLRKG  373

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   V  +P+N   +HYCG C  
Sbjct  374   CEKLGLKVEAVPRNTADNHYCGSCNL  399


 Score = 84.0 bits (206),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 91/169 (54%), Gaps = 4/169 (2%)
 Frame = +2

Query  20   LHRKMENNTATKTLSPSQMETLSALCNTFLPAI---NEALPETTDASVTNFFQTSAASTG  190
            L      ++ T   S +Q+++L+A+C TF+P +    +   +   A++  F + S A   
Sbjct  11   LQGGRRRSSYTHGFSSAQIQSLAAICETFVPPLPLDAKFDDKQNSAALDAFHKASGAEPP  70

Query  191  TPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKK  370
             P +VA  + +R +   ++   L+L  +S R+GTLLLCG      ++PF+ +F EI  ++
Sbjct  71   FPDEVADFLMKRGQPKAVSFAKLVLTLVSFRLGTLLLCGWDCCDWKWPFIHKFSEIPVER  130

Query  371  RERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            RE+I+  W+       +R  F  +K   L +FF+  D+   NP+WKAIG
Sbjct  131  REKILIKWSWKVHPLPLRAVFALIKTYCLFIFFSMTDENSGNPAWKAIG  179



>ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
 ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis]
 gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
Length=748

 Score =   169 bits (427),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 132/208 (63%), Gaps = 4/208 (2%)
 Frame = +3

Query  606   PLYKGIIDL---NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisg  776
             PL KGI++    N  +  +F  L   G  V         F I+CD VVVGSGCGGGV + 
Sbjct  195   PLQKGIVETVHENENDHSLFQCLVDHGLQVTVDHEHNL-FEIKCDVVVVGSGCGGGVAAA  253

Query  777   vLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGS  956
             VLA++G KVLVLEKGNY+   + S LEGPSM +++  GGLL T D   ++ AGS VGGGS
Sbjct  254   VLASSGQKVLVLEKGNYFVAEDYSSLEGPSMLELYESGGLLSTLDGKFMVFAGSAVGGGS  313

Query  957   AVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLR  1136
             AVNWSA I+TP  VLR+W   H + LFGS  Y  AMD V  ++GV   C +E FQN VLR
Sbjct  314   AVNWSACIETPDSVLRDWFVEHKIPLFGSLDYRAAMDKVSKRIGVTEHCTEEGFQNQVLR  373

Query  1137  KGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             KGC  L + V ++ +N P +HYCG C +
Sbjct  374   KGCENLGFKVESVARNTPEEHYCGSCNY  401


 Score = 93.2 bits (230),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 89/155 (57%), Gaps = 10/155 (6%)
 Frame = +2

Query  71   QMETLSALCNTFLPAINEALPETT------DASVTNFFQTSAASTGTPHQVAWVINQRMK  232
            ++E+L+A+C T +P +    PET       + ++ +F++ SA+    PH+VA ++ +R +
Sbjct  27   EIESLAAICQTLVPPLP---PETITKQHSHNQAIVSFYKASASQHPIPHEVAELMVKRGQ  83

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  412
               +    L+L  LS R+GTLLLCG       +PF+  F EIS +KRE+I+ +W+     
Sbjct  84   PQAVFLARLILTLLSFRLGTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKNWSRERYL  143

Query  413  F-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              +R  F  +K   L  FF   D+K +NP+W+AIG
Sbjct  144  LPLRVVFVMIKMFCLFYFFARTDEKSENPAWEAIG  178



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score =   173 bits (438),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 133/204 (65%), Gaps = 2/204 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPE-EHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++        +   LT+ G  V K       + I+CD V+VGSGCGGGV + VL
Sbjct  196   PLEKGIVETMYETGSTIVQSLTQKGLQVTKDSKQN-VYKIKCDVVIVGSGCGGGVAAAVL  254

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG KV+V+EKGNY+   + SLLEGPS ++++  GG+L T D  M +LAGSTVGGGSAV
Sbjct  255   ASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPTTDASMTILAGSTVGGGSAV  314

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  +L+EW   + L LFGS  Y  AMD V  ++GV   C  E FQN VLRKG
Sbjct  315   NWSACIKTPKSLLQEWAGQYKLPLFGSPDYLSAMDIVWERIGVTENCVQEGFQNQVLRKG  374

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C+ L   V  IP+N+  +HYCG C
Sbjct  375   CKNLGLDVERIPRNSSENHYCGSC  398


 Score = 88.6 bits (218),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 94/167 (56%), Gaps = 5/167 (3%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAIN----EALPETTDASVTNFFQTSAASTGT  193
            R+ +       LS +++  L++LC  FLP +     E   +    ++ +F++ S A    
Sbjct  12   RRSKAEKYNHGLSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGAQAPV  71

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
            P +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KR
Sbjct  72   PDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKR  131

Query  374  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            E+++  W  + +   +R  F  +K   L VFF+ +D+ G NP+W+AI
Sbjct  132  EKVLQKWFKNWIFTPVRIAFFILKIFCLFVFFSQLDENGKNPAWEAI  178



>gb|KHG08529.1| Long-chain-alcohol oxidase FAO2 [Gossypium arboreum]
Length=684

 Score =   175 bits (444),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 135/203 (67%), Gaps = 2/203 (1%)
 Frame = +3

Query  615   KGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATA  791
             KGII+    ++  F   LT+ G  V +  P    F I+CD V+VGSGCGGGV + VLA++
Sbjct  198   KGIIETMHEDDSTFVQSLTEKGLQVTE-DPDHNVFKIKCDVVIVGSGCGGGVAAAVLASS  256

Query  792   GYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWS  971
             G+KV+V+EKGNY+A T+ + LEGPSM +++  GG L T +   +++AGSTVGGGSA+NWS
Sbjct  257   GHKVVVIEKGNYFATTDYTSLEGPSMSELYEYGGFLTTTNGKFMIMAGSTVGGGSAINWS  316

Query  972   ASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRE  1151
             ASIKTP  VL+EW   H + LF S  Y  AMD V  ++GV   C +E  QN VLRKGC  
Sbjct  317   ASIKTPNNVLKEWSLGHKIPLFRSSEYENAMDAVYQRLGVTENCTEEGLQNQVLRKGCEN  376

Query  1152  LCYPVVNIPQNAPSDHYCGWCTF  1220
             L   V  +P+N+P DHYCG C  
Sbjct  377   LGLKVEAVPRNSPQDHYCGSCNL  399


 Score = 86.3 bits (212),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 91/161 (57%), Gaps = 6/161 (4%)
 Frame = +2

Query  44   TATKTLSPSQMETLSALCNTFLPAINEALPETTDAS-VTNFFQTSAASTGTPHQVAWVIN  220
            T T   S +Q+ +L+A C   +P +   L     AS +  F++ S A    P +VA ++ 
Sbjct  23   TYTHGFSSAQIRSLAATCEALIPPL--PLDSAHQASSLDAFYKASGAEPPLPDEVAEMMV  80

Query  221  QRMKHPKlns-lllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  397
            +R+  P++ S + ++L  +S R+G LLLCG      ++PF+ +F E+  ++RE+I+  W+
Sbjct  81   KRVVEPRVLSFVKVVLAVISFRLGALLLCGWDCCDWKWPFIHKFSELPVERREKILMKWS  140

Query  398  TSSLQF--IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++      +R  F  +K   L +FF+  D+  +NPSWKAIG
Sbjct  141  SNGHHRLPLRAVFALIKTYCLFIFFSMTDENSENPSWKAIG  181



>ref|XP_010466677.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=746

 Score =   173 bits (438),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +N  E+ +   L + G   A       +  I+CDAVV+GSG GGGV + VL
Sbjct  193   PLEKGIVETMNETEQTLLESLARKGLE-ADHDMDQDTIRIKCDAVVIGSGSGGGVAASVL  251

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKG+YY  ++    EGP MDK++  GG+L T D ++++LAG+TVGGGSAV
Sbjct  252   AKSGLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGILPTVDGNLMVLAGATVGGGSAV  311

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   +  +G+  Y  AMD V  +MGV  +CE ESFQN +LRKG
Sbjct  312   NWSACIKTPKSVLQEWSEDQKIPFYGTKEYVSAMDVVWKRMGVTEKCEMESFQNQILRKG  371

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  +   V N+P+N+   HYCG C +
Sbjct  372   CENIGVNVENVPRNSSEGHYCGSCGY  397


 Score = 88.6 bits (218),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 90/166 (54%), Gaps = 15/166 (9%)
 Frame = +2

Query  53   KTLSPSQMETLSALCNTFLPAINEALPETTDASVTN--------FFQTSAASTGTPHQVA  208
            + ++ ++METL++ C    P +     E + A   N        F+ TSA+ T    Q  
Sbjct  13   RDITAAEMETLASFCEAVFPPVAPPQEELSGAGDNNHRKEALRSFYSTSASQTPILCQSM  72

Query  209  WVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  388
             ++ +R          L+L+ L++R+GTLL+CG   L T++PF+ +F E+S +KRER++ 
Sbjct  73   ELLTKRATMEACLVTRLILFLLASRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVIQ  132

Query  389  ----SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
                +W    L  IR  F  +K + L  FF+ V  KG+NP+W+AIG
Sbjct  133  KQFRNWI---LTPIRAGFVYIKVIFLFCFFSRVSPKGENPAWEAIG  175



>ref|XP_004982881.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Setaria italica]
Length=761

 Score =   170 bits (431),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 135/206 (66%), Gaps = 1/206 (0%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  G+++  L +++   R L   G +V          V++CDAV+VGSGCGGGV + VL
Sbjct  212   PLDVGVVETRLLDDNALLRSLVGRGLTVKPVASDANHHVVQCDAVIVGSGCGGGVAAAVL  271

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AGYKV+V+EKG+Y+  ++ S +EGPSM+++F  GG+  T ++  ++  G+TVGGGSAV
Sbjct  272   ASAGYKVVVVEKGDYFTASDYSSIEGPSMERLFERGGIFCTSNVTTMIFTGATVGGGSAV  331

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  V +EW   HGL +F S  Y +AMD VC ++ V   C +E FQN V+R+G
Sbjct  332   NWSASIRTPKEVTQEWAREHGLPVFASPGYAQAMDAVCARLSVTDGCREEGFQNKVVRRG  391

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L      +P+N+   H+CG C F
Sbjct  392   CEALGLCADAVPRNSSEGHFCGSCNF  417


 Score = 91.3 bits (225),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 98/192 (51%), Gaps = 14/192 (7%)
 Frame = +2

Query  14   YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQT  172
            + L R    +  T  + P+QME L A+C   +P++           P   D  +  F++ 
Sbjct  20   HPLLRGWRRDRYTHGMHPAQMEALRAMCGALIPSLPADGAHGRGDPPGGKD--LERFYRA  77

Query  173  SAASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFP  352
            SAA +  P +VA ++  R     +    ++LW LSTR+GTLLLCG+  L+  FP++ +F 
Sbjct  78   SAADSTIPDEVAELMVTRCIREAVALAWVVLWVLSTRVGTLLLCGRLCLAGGFPYVRKFA  137

Query  353  EISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSR  529
            +++ ++RE  +  W      F +R  F  +K L   VF+  V++  +NP WKAIG     
Sbjct  138  DMTPERREAALQRWNRVRWLFPLRIAFAIVKILCHYVFYAMVNENSENPYWKAIGYSVHE  197

Query  530  PFHF*KTKETEA  565
            P    +  +TEA
Sbjct  198  P----REDQTEA  205



>gb|KJB10008.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=749

 Score =   177 bits (448),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 135/203 (67%), Gaps = 2/203 (1%)
 Frame = +3

Query  615   KGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATA  791
             KGII+    ++  F   LT+ G  V +  P    F I+CD V+VGSGCGGGV + VLA++
Sbjct  205   KGIIETMHEDDSTFVQSLTEKGLQVTE-DPDHNVFNIKCDVVIVGSGCGGGVAAAVLASS  263

Query  792   GYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWS  971
             G KV+V+EKGNY+A T+ + LEGPSM +++  GG L T +   +++AGSTVGGGSA+NWS
Sbjct  264   GQKVVVIEKGNYFATTDYTSLEGPSMSELYEYGGFLTTTNGKFMIMAGSTVGGGSAINWS  323

Query  972   ASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRE  1151
             ASIKTP  VL+EW   H + LFGS  Y  AMD V  ++GV   C +E  QN VLRKGC  
Sbjct  324   ASIKTPNNVLKEWSLDHKIPLFGSSEYENAMDAVYQRLGVTENCTEEGLQNQVLRKGCEN  383

Query  1152  LCYPVVNIPQNAPSDHYCGWCTF  1220
             L   V  +P+N+P DHYCG C  
Sbjct  384   LGLKVEAVPRNSPEDHYCGSCNL  406


 Score = 84.0 bits (206),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 95/168 (57%), Gaps = 13/168 (8%)
 Frame = +2

Query  44   TATKTLSPSQMETLSALCNTFLPAINEALPETTDAS-VTNFFQTSAASTGTPHQVAWVIN  220
            T T   S +Q+++L+A+C   +P +   L     AS +  F++ S A    P +VA ++ 
Sbjct  23   TYTHGFSSAQIQSLAAICEALIPPL--PLDSAHQASSLDAFYKASGAEPPLPDEVAEMMV  80

Query  221  QRMKHPKlns-lllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  397
            +R+  P++ S + ++L  +S R+G LLLCG      ++PF+ +F E+  ++RE+I+  W+
Sbjct  81   KRVVEPRVLSFVKVVLTVISFRLGALLLCGWDCCDWKWPFIHKFSELPVERREKILMKWS  140

Query  398  TSSLQF--IRNFFTAMKALVLLVFFTSV-------DDKGDNPSWKAIG  514
            ++      +R  F  +K   L +FF+ +       D+K +NPSWKAIG
Sbjct  141  SNGHHRLPLRAVFALIKTYCLFIFFSMLLKFVSQTDEKSENPSWKAIG  188



>ref|XP_008382148.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A 
[Malus domestica]
Length=768

 Score =   219 bits (558),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 153/206 (74%), Gaps = 5/206 (2%)
 Frame = +3

Query  597   LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisg  776
             LFGPL++GII++    + V + +++ G     P     S  I CDAVV+G+G GGGV++G
Sbjct  215   LFGPLFRGIINMKXTNDLVAD-ISRFGV----PAFVHHSLTIRCDAVVIGTGLGGGVVAG  269

Query  777   vLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGS  956
             VLA  GYKV+VLEKG+Y+AR NL+LLEGP+MD+M+L GGL+ T D  + +LAGSTVGGGS
Sbjct  270   VLAKDGYKVVVLEKGHYHARHNLTLLEGPTMDQMYLSGGLIATDDTXVFVLAGSTVGGGS  329

Query  957   AVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLR  1136
              VN SAS++TP +VL+EWC  H LELF S +Y  A+D VC +MGVQ E ++E F N VLR
Sbjct  330   TVNRSASVRTPVHVLKEWCNAHKLELFDSKLYQLALDVVCERMGVQSEIQEEGFNNAVLR  389

Query  1137  KGCRELCYPVVNIPQNAPSDHYCGWC  1214
             KGC+EL YP+ NIP+N+   HYCGWC
Sbjct  390   KGCQELRYPMENIPRNSTPGHYCGWC  415



>ref|XP_010264984.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Nelumbo nucifera]
Length=750

 Score =   170 bits (431),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 138/209 (66%), Gaps = 8/209 (4%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSF---VIECDAvvvgsgcgggvis  773
             PL KGII+ ++  +  +   LT  G  V +    GP +    IECD ++VGSGCGGGV +
Sbjct  197   PLEKGIIETVSESDSTLVQSLTIKGFKVTR----GPRWNLHKIECDVIIVGSGCGGGVAA  252

Query  774   gvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  953
              VLA++G KV+VLEKGNY+   + S LEGPS  +++  GG+L + D  ++++AGSTVGGG
Sbjct  253   AVLASSGQKVIVLEKGNYFVPEDYSSLEGPSFSQLYESGGILPSLDGKIMMMAGSTVGGG  312

Query  954   SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVL  1133
             SAVNWSA IKTP  VLREW   H + LFGS  Y  AMDTVC + GV   C +E FQN VL
Sbjct  313   SAVNWSACIKTPSSVLREWHMDHKIPLFGSSDYLSAMDTVCERNGVTDTCLEEGFQNQVL  372

Query  1134  RKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             R+GC  L   +  +P+N+  +HYCG C F
Sbjct  373   RRGCENLGLKIDPVPRNSSENHYCGSCGF  401


 Score = 90.1 bits (222),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 87/158 (55%), Gaps = 13/158 (8%)
 Frame = +2

Query  71   QMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  223
            QME LSA+C  F+P+I          E  P   + SV +F+  S +    P +VA ++  
Sbjct  26   QMEALSAICEAFIPSIPFDPLRATGGEGSP---NKSVQSFYLVSGSQKPIPDEVAELLVS  82

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R     +  +  LLW LSTR+GT LLCG  +    +PFL +F E+  +KRE+I+  W+ +
Sbjct  83   RSLWHAVFMVKFLLWMLSTRLGTSLLCGVLTFGCGWPFLYKFSELPLEKREQILQKWSGA  142

Query  404  SL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
               + +R FF  +K   +L FF+  ++  +NP+W AIG
Sbjct  143  RYHRHLRMFFMLLKVFCMLTFFSMTNENSENPAWDAIG  180



>ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-like [Vitis vinifera]
Length=749

 Score =   177 bits (449),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 138/206 (67%), Gaps = 3/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             P+ KGI++     +      L++ G  V + +       I+CD V++GSGCGGGV + VL
Sbjct  200   PIRKGIVETMYENDSTLVQSLSQRGIKVIEDQKN--ICKIKCDVVIIGSGCGGGVTAAVL  257

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++GYKVL+LEKGNY+   + S LEGPSM + +  GG++ T D  +++LAGSTVGGGSAV
Sbjct  258   ASSGYKVLILEKGNYFEPEDYSSLEGPSMSEQYESGGVMSTIDAKVMILAGSTVGGGSAV  317

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA+IKTP  +LREW   H L LFGS  Y  AMDTV  ++GV  +C +E FQN VLRKG
Sbjct  318   NWSAAIKTPNSILREWSTDHKLPLFGSSEYLSAMDTVWKRIGVTEKCTEEGFQNQVLRKG  377

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V +IP+N+  +HYCG C +
Sbjct  378   CENLGLDVESIPRNSSENHYCGSCAY  403


 Score = 83.6 bits (205),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN-EAL-PETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            S SQ++ L+++C T +P ++ E++  E    ++ +F++ S +    P + A ++ +R   
Sbjct  30   SSSQIQALASICETLIPPLHLESISKENPPEALYSFYKASGSQFPVPDEAAELLKKRGLP  89

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
              +  + ++L  LSTR+GTLLLCG   L  ++PF+L+F EIS +KRE+++ +W+     F
Sbjct  90   EGVMLVSIVLKILSTRLGTLLLCGFLCLGWKWPFILKFSEISLEKREQVLKNWSRQRFLF  149

Query  416  -IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +R FF  MK     +FF+  DD  +NP+W AIG
Sbjct  150  PLRLFFAIMKIFCFFIFFSRTDDNLENPAWDAIG  183



>ref|XP_011091281.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Sesamum indicum]
Length=748

 Score =   165 bits (417),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 131/206 (64%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +G+++     +  F N L   G  V +       + ++CD V+VGSGCGGGV + VL
Sbjct  197   PLEQGMVETRHETDLTFANSLAAKGLKVTQ-NAQRSMYKVKCDVVIVGSGCGGGVAAAVL  255

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             + AG KV+VLEKGNYY   + S LEGPSM +++  GGLL T D   ++LAGSTVGGGSAV
Sbjct  256   SRAGLKVVVLEKGNYYTSKDYSALEGPSMSELYESGGLLSTLDGKTMILAGSTVGGGSAV  315

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP +VL EW     L LF S  Y  AM+ VCG++GV  +C+ E FQN +LRKG
Sbjct  316   NWSACIKTPDFVLDEWGNGQKLPLFSSSEYIAAMEKVCGRIGVTEKCDKEGFQNQILRKG  375

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L      + +N+   H+CG C +
Sbjct  376   CEKLGLKADPVARNSSEGHFCGSCCY  401


 Score = 95.1 bits (235),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 83/157 (53%), Gaps = 7/157 (4%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI------NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  223
            S S++E L+++C   LP I        +     D S   F   S +    P +VA +I +
Sbjct  23   STSELEILTSICEVLLPPIPLMNSQENSTKNEVDQSYEAFCNASGSQYPVPDEVAELIKK  82

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R        +   L  LSTR+GTLL+CG  S   ++P+L +F EIS +KRE++V  W  +
Sbjct  83   RGSWEAKILVRATLRILSTRLGTLLICGSHSFDKKWPYLKKFSEISLEKREKVVQKWFRN  142

Query  404  SLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
             L   +R  F  +K LVL VFFT V +   NP+WKA+
Sbjct  143  RLLTPVRLAFVFIKFLVLYVFFTQVGEDAKNPAWKAM  179



>gb|KHG17178.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=746

 Score =   179 bits (455),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 143/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ ++  +  ++  L++ G  V +       + I+CDAV++GSGCGGGV + +L
Sbjct  199   PLQKGMIETVHEKDSTLYRSLSQKGLLVTEDTQQN-VYRIKCDAVIIGSGCGGGVAAAML  257

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+V+EKGNY+  T+ S  EGPSMDK++  GG+L + D  +++LAGSTVGGGSAV
Sbjct  258   AGSGLKVVVVEKGNYFTSTDYSPFEGPSMDKLYESGGILPSLDGQLLILAGSTVGGGSAV  317

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   + LFGS+ Y  AM+TVC ++GV  +C++E FQN VLRKG
Sbjct  318   NWSACIKTPKSVLKEWAEDCKIPLFGSNEYVSAMETVCERIGVTHDCKEEGFQNQVLRKG  377

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+   HYCG C F
Sbjct  378   CENLGVKVEKVPRNSSESHYCGSCGF  403


 Score = 80.5 bits (197),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 86/156 (55%), Gaps = 7/156 (4%)
 Frame = +2

Query  68   SQMETLSALCNTFLPAIN-----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMK  232
            ++++TL+++   F P++      +        +V +F + SA+    P +VA ++ +R  
Sbjct  27   AEIQTLASVAEVFFPSLPPDSWFQGKDTQPSKAVQSFLKASASQPPFPDEVAELLGKRAF  86

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  412
               +  + ++L  L TR+G+LLLCG+  L  ++P +  F  +  +KRE+++ +W      
Sbjct  87   IESVIVVRIVLMLLWTRVGSLLLCGRQCLGKEWPIINDFGSMGLEKREKVMQNWLKHGFL  146

Query  413  F--IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            F  IR  F  +K   L V+F+ V + G+NP+W+AIG
Sbjct  147  FTPIRAAFIYLKVFCLFVYFSRVGEDGENPAWEAIG  182



>ref|XP_011628129.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Amborella trichopoda]
Length=787

 Score =   179 bits (455),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 130/200 (65%), Gaps = 1/200 (1%)
 Frame = +3

Query  621   IIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  800
             I    L +E + + +   G +V +  P      +ECDAVVVGSG GG V +  LA +GY+
Sbjct  207   ISTTTLTKESLVSTIKTKGITVTE-DPSADLLTLECDAVVVGSGPGGSVAAAKLAKSGYQ  265

Query  801   VLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASI  980
             VLVLEKG Y+   + SLLEGPSMD+M+  GG+L T D  +++ AGSTVGGGSA+NWSA I
Sbjct  266   VLVLEKGLYFTPQDYSLLEGPSMDQMYESGGILSTTDAKVLITAGSTVGGGSAINWSACI  325

Query  981   KTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCY  1160
             KTP  VL++W E   L LFGS  Y  AM+ VC ++GV  +CE E+FQN V R GC  L  
Sbjct  326   KTPDKVLKQWSEDFSLSLFGSHNYRAAMEAVCKRLGVTEKCEKENFQNEVFRSGCERLGL  385

Query  1161  PVVNIPQNAPSDHYCGWCTF  1220
              V  +P+N+P  HYCG C +
Sbjct  386   KVEFVPRNSPEGHYCGQCGY  405


 Score = 80.1 bits (196),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 88/162 (54%), Gaps = 19/162 (12%)
 Frame = +2

Query  68   SQMETLSALCNTFLPA-------INEALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  226
            +Q+++L+A+C   +P+       ++         S+ +F++ S +    P QVA ++ +R
Sbjct  28   AQIQSLTAICEALIPSMPITALHVSSQRDPPPSPSLVSFYKASGSDYQVPDQVAELMVKR  87

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  406
                 +  +  +LW LSTR+GTLLLCG   LS  FPF+  F E+  +KRE+++ +W+   
Sbjct  88   GLPDAVTLVSWVLWALSTRLGTLLLCGSTCLSLNFPFIRSFSEMPVEKREKVLMAWSRE-  146

Query  407  LQFIRNFFTAM-------KALVLLVFFTSVDDKGDNPSWKAI  511
                R+FF+A+       K   + VF++  D    NPSW+AI
Sbjct  147  ----RSFFSALRLSFALFKIFCVYVFYSWTDVNSKNPSWEAI  184



>ref|XP_010262397.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X2 [Nelumbo 
nucifera]
Length=757

 Score =   176 bits (447),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 138/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +N  +  +   LT+ G  V +  P      IECD VVVGSGCGGGV + VL
Sbjct  205   PLQKGIIETMNESDSTLVQSLTQKGFKVTE-DPKRNLHKIECDVVVVGSGCGGGVAASVL  263

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKGNY+A  + S +EGPS+++++  GG+L T D  ++++AGSTVGGGSAV
Sbjct  264   ASSGQKVIVLEKGNYFAPEDYSSVEGPSLNQLYESGGMLSTFDGKVMIMAGSTVGGGSAV  323

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VLREW   H + LFGS  Y  AMD V  + GV   C  E  QN VL+KG
Sbjct  324   NWSASIKTPSSVLREWFVGHKIPLFGSSDYLSAMDVVFKRNGVTENCVKEGLQNQVLQKG  383

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+  +HYCG C F
Sbjct  384   CENLGLKVESVPRNSSENHYCGSCGF  409


 Score = 83.2 bits (204),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 86/161 (53%), Gaps = 13/161 (8%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVAWV  214
            S S+M+ ++A+C   +P I          E+ P     S+ +F+  S +    P +VA +
Sbjct  31   SLSEMQVVTAICEALIPPIPLGSLHVNGKESPP---SKSIQSFYLASGSQKPIPDEVAEL  87

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  394
            I  +     +  + LLLW LSTR+GTLL+CG  S  +++PFL +F E+S +KRE ++  W
Sbjct  88   IVTKALWHGVLVVRLLLWMLSTRLGTLLICGTLSFGSRWPFLCKFSELSLEKREEVLKKW  147

Query  395  ATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            + +  Q  +R  F   K      FF+  D+   NP+W AIG
Sbjct  148  SRARYQIHLRLMFAMFKIFCCFAFFSLTDENSTNPAWDAIG  188



>ref|XP_009369441.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=746

 Score =   170 bits (431),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+     +      LTK G  +           I+CD V+VGSGCGGGV + VL
Sbjct  197   PLEKGIIETAYESDSTLVESLTKKGLDLTD-DAVNNIHKIKCDVVIVGSGCGGGVAAAVL  255

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPSM++++  GG++ + D  +++LAGSTVGGGSAV
Sbjct  256   ARSGQKVVVLEKGNYFVPKDYSSLEGPSMNELYESGGIMSSVDGMVMILAGSTVGGGSAV  315

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VLR+W   H + L+ S+ Y  AMD VC ++GV   C +E+F N +LRKG
Sbjct  316   NWSASIKTPDNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTESCTEENFPNQILRKG  375

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+ +DHYCG+C +
Sbjct  376   CENLGLKVDAVPRNSSADHYCGFCNY  401


 Score = 88.6 bits (218),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 92/167 (55%), Gaps = 4/167 (2%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN-EALPETTDA--SVTNFFQTSAASTGTPHQVAWVINQRMK  232
            S +Q+++LSA+C   LP I+ E +P+  +   S +++   SA+    P +VA ++ +R  
Sbjct  26   SSAQIQSLSAICEALLPPISPEDIPDDHNPLHSSSSYCTASASQPPIPDEVAELMVKRTL  85

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA-TSSL  409
               +  + + L  LS R+GT LLCGK     ++ F+ +F E+S  KRE+++  W+   S+
Sbjct  86   PEVVGGVRVFLKMLSLRLGTFLLCGKCCFDWKWTFIDKFSEMSLDKREQVLKKWSRQKSV  145

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRPFHF*KT  550
              IR  F  +K     +FF+ VD+   NP+WKAIG    R     KT
Sbjct  146  ITIRLMFMVIKMFCFYIFFSRVDENSRNPAWKAIGYELDRKEKLIKT  192



>ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
 gb|KHN27785.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=751

 Score =   177 bits (450),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 138/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +N  +  +   L   G +V           ++CDA+VVGSGCGGGV + VL
Sbjct  202   PLEKGIIETMNESDSALQQSLANKGLNVTLDSKSNI-LKVKCDALVVGSGCGGGVAAAVL  260

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             ++AGYKV+VLEKGNY++  + S LEGPSM++++  GG+L + D  +++LAGSTVGGGSAV
Sbjct  261   SSAGYKVVVLEKGNYFSTQDYSSLEGPSMNQLYETGGILASVDSRVLVLAGSTVGGGSAV  320

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL EW E H L  F S  Y  AM+TVC ++GV   C  E FQN VLRKG
Sbjct  321   NWSACIKTPHKVLNEWSENHKLPFFSSQEYLSAMETVCERIGVTENCTQEGFQNQVLRKG  380

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V  +P+N+  +HYCG C +
Sbjct  381   CQNLGLKVDYVPRNSSGNHYCGSCGY  406


 Score = 80.5 bits (197),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 94/162 (58%), Gaps = 11/162 (7%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI--------NEALPETTDAS--VTNFFQTSAASTGTPHQVAW  211
            S ++ME+L+++C   LP +         E   +  D+S  + +F+  SA+    PH+VA 
Sbjct  24   SAAEMESLASICEVVLPPLPMDALKIRKEDQIDDYDSSKSLKSFWDISASRYPIPHEVAE  83

Query  212  VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  391
            ++ +R     +  + ++LW L+TR+GTLLLCG   L  ++P++  F  IS +KRE ++  
Sbjct  84   MLTKRSLIEAVILIRVVLWLLATRLGTLLLCGFLCLGEKWPYVNNFSNISLEKREMVMQK  143

Query  392  WATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            W     L  IR  F  +K L L VFF+ VD+ GDNP+WKAIG
Sbjct  144  WLKHRFLTPIRLAFAYIKVLCLFVFFSWVDENGDNPAWKAIG  185



>gb|KHN28101.1| Long-chain-alcohol oxidase FAO1-like protein [Glycine soja]
Length=749

 Score =   170 bits (430),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 134/201 (67%), Gaps = 2/201 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +N  +  +   L   G +V           ++CDA+VVGSGCGGGV + VL
Sbjct  201   PLEKGIIETMNESDSTLQQSLANKGLNVTLDSKSNI-LKVKCDALVVGSGCGGGVAAAVL  259

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             ++AG+KV+VLEKGNY+   + S LEGPSM++++  GG+L + D  +++LAGSTVGGGSAV
Sbjct  260   SSAGHKVVVLEKGNYFTPQDYSSLEGPSMNQLYETGGILASVDSRVLVLAGSTVGGGSAV  319

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E H L  F S  Y  AM+ VC ++GV   C  E FQN VLRKG
Sbjct  320   NWSACIKTPHKVLKEWSESHKLPFFSSQEYLSAMENVCERIGVTENCSQEGFQNQVLRKG  379

Query  1143  CRELCYPVVNIPQNAPSDHYC  1205
             C+ L   V  +P+N+  +HYC
Sbjct  380   CQNLGLKVDYVPRNSSGNHYC  400


 Score = 87.8 bits (216),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 97/170 (57%), Gaps = 11/170 (6%)
 Frame = +2

Query  38   NNTATKTLSPSQMETLSALCNTFLPAI----------NEALPETTDASVTNFFQTSAAST  187
            +N      S ++ME+L+++C   LP +          +    ++++ S+ +F   SA+  
Sbjct  15   DNKYKHGFSAAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKSLQSFLDISASRY  74

Query  188  GTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  367
              PH+VA +I +R     +  + ++LW L+TR+GTLLLCG   L   +P++ +F  IS +
Sbjct  75   PIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENWPYINKFSNISLE  134

Query  368  KRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            KRE+I+  W     L  IR  F  +K L L VFF+ VD+ GDNP+WKAIG
Sbjct  135  KREKIMQKWLKHRFLTPIRLTFACIKVLCLFVFFSWVDENGDNPAWKAIG  184



>ref|XP_006582261.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
Length=749

 Score =   170 bits (430),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 134/201 (67%), Gaps = 2/201 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +N  +  +   L   G +V           ++CDA+VVGSGCGGGV + VL
Sbjct  201   PLEKGIIETMNESDSTLQQSLANKGLNVTLDSKSNI-LKVKCDALVVGSGCGGGVAAAVL  259

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             ++AG+KV+VLEKGNY+   + S LEGPSM++++  GG+L + D  +++LAGSTVGGGSAV
Sbjct  260   SSAGHKVVVLEKGNYFTPQDYSSLEGPSMNQLYETGGILASVDSRVLVLAGSTVGGGSAV  319

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E H L  F S  Y  AM+ VC ++GV   C  E FQN VLRKG
Sbjct  320   NWSACIKTPHKVLKEWSESHKLPFFSSQEYLSAMENVCERIGVTENCSQEGFQNQVLRKG  379

Query  1143  CRELCYPVVNIPQNAPSDHYC  1205
             C+ L   V  +P+N+  +HYC
Sbjct  380   CQNLGLKVDYVPRNSSGNHYC  400


 Score = 87.8 bits (216),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 97/170 (57%), Gaps = 11/170 (6%)
 Frame = +2

Query  38   NNTATKTLSPSQMETLSALCNTFLPAI----------NEALPETTDASVTNFFQTSAAST  187
            +N      S ++ME+L+++C   LP +          +    ++++ S+ +F   SA+  
Sbjct  15   DNKYKHGFSTAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKSLQSFLDISASRY  74

Query  188  GTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  367
              PH+VA +I +R     +  + ++LW L+TR+GTLLLCG   L   +P++ +F  IS +
Sbjct  75   PIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENWPYINKFSNISLE  134

Query  368  KRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            KRE+I+  W     L  IR  F  +K L L VFF+ VD+ GDNP+WKAIG
Sbjct  135  KREKIMQKWLKHRFLTPIRLTFACIKVLCLFVFFSWVDENGDNPAWKAIG  184



>ref|XP_010093072.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
Length=743

 Score =   178 bits (452),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 142/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  G+I+ +   +  +   L + G  V +  P   ++ I+CDAVVVGSGCGGGV + VL
Sbjct  193   PLDNGVIETMKETDSSLVQSLIQKGLEVTE-DPNDNNYKIKCDAVVVGSGCGGGVAAAVL  251

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLE+GNY+   + S LEGPSM++++  GG+  T D  ++LLAGSTVGGGSAV
Sbjct  252   AKSGQKVIVLEQGNYFVAQDYSSLEGPSMEELYKFGGISSTIDGKIMLLAGSTVGGGSAV  311

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL EW   H + LFGS  Y  AMD VC ++GV  +C  E+FQN +LRKG
Sbjct  312   NWSASIRTPSSVLHEWSVDHKIPLFGSSEYQSAMDVVCKRLGVTDKCTKENFQNQILRKG  371

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   +V++P+N+ +DHYC +C +
Sbjct  372   CQNLGLEIVSVPRNSSADHYCSFCCY  397


 Score = 79.0 bits (193),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 86/155 (55%), Gaps = 8/155 (5%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETT--DASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            S +Q+++L+++C   +P +   +P       S+  F++ S + +  P + A ++ ++   
Sbjct  26   SSAQIQSLASMCEALIPPL---IPNKNPLHKSLQTFYEASGSQSPIPDETAEMVVKKALP  82

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  415
            P  + +  +L  LS R+GTLLLCG      ++PFL +F E+S +KRE ++  W+    +F
Sbjct  83   PAASLVSWVLKILSFRLGTLLLCGFICFDWKWPFLHKFSEMSLEKREAVLKKWSKQR-RF  141

Query  416  I--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +  R  F  +K      FF+ VD+   NP+W+AIG
Sbjct  142  VPLRLAFVLIKLFCFFTFFSRVDENSHNPAWEAIG  176



>ref|XP_003607656.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1, partial [Medicago truncatula]
Length=584

 Score =   181 bits (460),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 138/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII++    +    + L+  G +V           I+CDAVVVGSGCGGGV + VL
Sbjct  125   PLEKGIIEIMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAVVVGSGCGGGVAASVL  183

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             + AGYKV+VLEKGNY+   + S LEGPSMD+ +  GG+L + D  +++LAGSTVGGGSAV
Sbjct  184   SKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYENGGILASIDSRILILAGSTVGGGSAV  243

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E H L LF S  Y  AM+TVC ++GV   C  E FQN VLRKG
Sbjct  244   NWSACIKTPEKVLKEWSEKHKLSLFDSIEYLSAMETVCERIGVNENCTQEGFQNQVLRKG  303

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V  +P+N+P +HYCG C +
Sbjct  304   CQNLGLKVDYVPRNSPGNHYCGSCGY  329


 Score = 75.5 bits (184),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = +2

Query  275  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF---FTAMKA  445
            +TR+GTLL+CG   LS ++PF+  F  +S  KRE+IV       L+F+  F   F  +K 
Sbjct  27   ATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQR--ALKLRFLTPFRLAFAYIKV  84

Query  446  LVLLVFFTSVDDKGDNPSWKAIG  514
            L L VFF+ VD+ GDNP+WKAIG
Sbjct  85   LCLFVFFSWVDENGDNPAWKAIG  107



>ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=744

 Score =   175 bits (443),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+ID N   +    R LT+ G  V +  P      I+CD V+VGSGCGGGV + VL
Sbjct  198   PLQKGLIDTNQETDSTLLRSLTEKGLEVTR-DPRRNLCKIKCDVVIVGSGCGGGVAAAVL  256

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV VLEKGNY+  T+ S LEGPS+ +++  GGLL + D  ++++AGS VGGGS V
Sbjct  257   AASGQKVFVLEKGNYFTATDYSGLEGPSLAQLYESGGLLTSADAGVIIMAGSAVGGGSVV  316

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VL+EW +   + LFGS  Y  AMDTVC ++GV   C+ E FQN VLRKG
Sbjct  317   NWSASIKTPNSVLQEWTKNQKIPLFGSSEYLSAMDTVCARIGVTENCKVEGFQNQVLRKG  376

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L  PV  +P+N+   HYCG C +
Sbjct  377   CERLGVPVKTVPRNSSERHYCGSCGY  402


 Score = 82.4 bits (202),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 89/166 (54%), Gaps = 23/166 (14%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPETT--------DASVTNFFQTSAASTGTPHQVAWV  214
            LS ++M++L++LC T LP++    P TT          +V   ++ S + T  P ++A +
Sbjct  23   LSSAEMDSLASLCETILPSLPP--PVTTLDGKQHQPTKAVQALYRASGSQTPMPDEIAEL  80

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  394
            + +R     +  + L+LW LSTR+GT LLCG      ++  +  F  IS  KRE+++  W
Sbjct  81   LRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWLCIKNFSSISLDKREKVLQKW  140

Query  395  ATSSLQFIRNFFTAM-------KALVLLVFFTSVDDKGDNPSWKAI  511
                  F R FFTA+       K L + VFF+ V   GDNP+W+AI
Sbjct  141  ------FKRRFFTAIRIAFIYVKVLCVFVFFSRVGQNGDNPAWEAI  180



>gb|AAK64154.1| unknown protein [Arabidopsis thaliana]
Length=748

 Score =   174 bits (442),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 134/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ ++  +  +   LT+ G  VA+       + I CDAVVVGSG GGGV +  L
Sbjct  198   PLEKGIIETMHESDVTITQSLTEKGVHVARDDGDNV-YRIRCDAVVVGSGSGGGVAAANL  256

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+   + S LE PSM +++  GGLL T D   +LLAGS VGGG+AV
Sbjct  257   AKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAGSAVGGGTAV  316

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   ++ FGS  Y  AMD V  ++GV   C    FQN VLRKG
Sbjct  317   NWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHGFQNQVLRKG  376

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+P DHYCG C +
Sbjct  377   CERLGLQVESVPRNSPEDHYCGLCGY  402


 Score = 82.4 bits (202),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 89/171 (52%), Gaps = 14/171 (8%)
 Frame = +2

Query  20   LHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETT-DASVTNFFQTSAASTGTP  196
            L  K          SPSQ+++L+ +C TFLP      PETT +    N F   A+ST  P
Sbjct  14   LRSKKRGEGYNHGFSPSQIQSLAVICQTFLP------PETTSEQQAVNSFHV-ASSTQPP  66

Query  197  --HQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKK  370
               +VA +I +  +   +  L ++L  LS R GTLLLCG   L   +PF+LRF ++   K
Sbjct  67   FTDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLRFSQLPLDK  126

Query  371  RERIVHSWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            RE I+ +W+  S   L F   FF A K   L  FF+  D+   NP+ +AIG
Sbjct  127  REAILRNWSRQSGFLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIG  176



>ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum lycopersicum]
Length=731

 Score =   167 bits (422),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +GI++ +N  +E +   L+K    + +       F IECD ++VGSGCGGGV +G+L
Sbjct  186   PLERGIVETINESDETLKESLSKKDVVITEDAKDNI-FKIECDVLIVGSGCGGGVAAGIL  244

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +GYKV+VLEKG+Y+   + S LEGPS+ +++  G +L + D  ++++AG+TVGGGSAV
Sbjct  245   AKSGYKVVVLEKGHYFVPEDYSGLEGPSLSELYETGAMLSSLDGKVMIMAGTTVGGGSAV  304

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VL++W   H +  FG+  Y  AMD VC ++GV   C +E  QN V+RKG
Sbjct  305   NWSASIKTPNDVLKDWSVNHKISWFGTSEYQSAMDAVCKRIGVTENCSEEGLQNQVIRKG  364

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  IP+N+  +HYCG C +
Sbjct  365   CENLGLKVEKIPRNSSENHYCGSCGY  390


 Score = 89.7 bits (221),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 97/174 (56%), Gaps = 15/174 (9%)
 Frame = +2

Query  38   NNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVI  217
            N++ T   S SQ++T+SA C T +P  N       D S   FF +S A   + ++VA ++
Sbjct  17   NSSYTHGFSSSQIQTISAFCETLVPPCN-----NNDNS---FFASSGAHPPSTNEVAELL  68

Query  218  NQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  397
             +R K   L  + ++++ L+TR+G+LLLCG+  L  ++PF+  F E+  K RE ++  W+
Sbjct  69   VKRSKPEALLIIRIVVFLLTTRLGSLLLCGRVCLDKRWPFVHNFTELDLKDREALLQRWS  128

Query  398  TSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRPFHF*KTKE  556
              +    +R  F  +K + L +FF+  D+   NP+W+AIG      +H  +T E
Sbjct  129  RETFLIPLRITFLMIKIIYLFIFFSWTDENCKNPTWEAIG------YHLPETTE  176



>gb|KGN56837.1| hypothetical protein Csa_3G134850 [Cucumis sativus]
Length=669

 Score =   189 bits (479),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 142/206 (69%), Gaps = 3/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ N   E  F + L + G  +A     G +  +ECD VVVGSGCGGGV + +L
Sbjct  123   PLEKGIIEPNNETESSFKKSLLQKGIRIAGDD--GHTLSVECDVVVVGSGCGGGVAAAIL  180

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV++LEKGNY+  ++ S LEGPS+++++  G +  T D  +++LAGSTVGGGSAV
Sbjct  181   ASSGQKVMILEKGNYFIASDYSSLEGPSLEQLYEAGAIFATDDGKVLILAGSTVGGGSAV  240

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP +VL+EW E H +  FG+  Y  AMD VC ++GV  +CE+E FQN VLRKG
Sbjct  241   NWSASIKTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSEDCEEEGFQNQVLRKG  300

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+ + HYCG C +
Sbjct  301   CENLGLKVEKVPRNSTTGHYCGSCGY  326


 Score = 67.8 bits (164),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query  275  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  451
            +TR+GTLLLCG      ++PF+ +F E+  +KRE  +  W  + +   +R     +K + 
Sbjct  26   ATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRWFKNKVFTPVRAALALIKLVF  85

Query  452  LLVFFTSVDDKGDNPSWKAI  511
            L VFF+ VD  GDNPSW+AI
Sbjct  86   LYVFFSRVDVNGDNPSWEAI  105



>emb|CDY66156.1| BnaA01g34950D [Brassica napus]
Length=508

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +3

Query  714   FVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  893
               I+CDAVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLSL EG ++D+M+L GG
Sbjct  1     MTIQCDAVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQALDEMYLSGG  60

Query  894   LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTV  1073
             LL T D+D+V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGS +Y +AMD V
Sbjct  61    LLATTDMDVVILAGSTVGGGSTINWSASIKTPEHVMKEWSEKSELEMFGSHLYREAMDVV  120

Query  1074  CGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             C +MGVQ E  +E F N +LRKGC  L  PV NIP+NAPSDHYCG+C
Sbjct  121   CERMGVQCEFLEEGFNNEILRKGCENLGLPVKNIPRNAPSDHYCGFC  167



>gb|EYU46424.1| hypothetical protein MIMGU_mgv1a001883mg [Erythranthe guttata]
Length=744

 Score =   171 bits (434),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 137/207 (66%), Gaps = 2/207 (1%)
 Frame = +3

Query  606   PLYKGIIDL--NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgv  779
             PL KG+I+   N  +  +   L + G SV +      +F I+CD  +VGSG GGGV + V
Sbjct  198   PLKKGVIETMKNEDDASLKESLLQKGVSVIEDPNEKNTFKIKCDVAIVGSGSGGGVAAAV  257

Query  780   LATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSA  959
             LA +G KV+++EKGNY+   + S LEGPS+ +++  GG+L T+D  +++ AGSTVGGGS+
Sbjct  258   LAKSGQKVIIIEKGNYFTPQDYSGLEGPSLSELYESGGILSTEDGKIMIQAGSTVGGGSS  317

Query  960   VNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRK  1139
             VNWSA I+TP YVL+EW + + L LF ++ Y  AMD VC ++GV   C +E FQN VLRK
Sbjct  318   VNWSACIRTPDYVLQEWSKQNKLPLFTTNEYKSAMDDVCERLGVTENCVEEGFQNKVLRK  377

Query  1140  GCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             G   L   +  +P+N+ +DHYCG C +
Sbjct  378   GVENLGLKIEPVPRNSSADHYCGSCCY  404


 Score = 84.3 bits (207),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 90/161 (56%), Gaps = 11/161 (7%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPET---------TDASVTNFFQTSAASTGTPHQVAWV  214
            S SQ+++L+A+C+T +P +     E          T   ++N  Q   +S G P +VA +
Sbjct  24   SASQIQSLTAICHTIIPPLTNLRAEVDDDDDDDVITGGDMSNHVQAFYSSNG-PDEVAEL  82

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  394
            I +R     +  + L+L FLS+R+GTL+LCG       +PF+  F E+  KKRE ++ +W
Sbjct  83   IVKRGVPKAVFIVSLVLKFLSSRLGTLVLCGYICFDKNWPFVRTFSELPLKKRESVLQNW  142

Query  395  ATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +  +L   +R  F  +K + L +FF+  D+   NP+W+AIG
Sbjct  143  SRQTLLLPLRIAFLLLKIITLFIFFSWTDENSSNPAWEAIG  183



>ref|NP_194586.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
 sp|Q94BP3.2|FAO4B_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4B; AltName: Full=Long-chain 
fatty alcohol oxidase 4B [Arabidopsis thaliana]
 emb|CAB81445.1| putative protein [Arabidopsis thaliana]
 emb|CAC87644.1| alcohol oxidase [Arabidopsis thaliana]
 gb|AAN71941.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85508.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
Length=748

 Score =   174 bits (441),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 134/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ ++  +  +   LT+ G  VA+       + I CDAVVVGSG GGGV +  L
Sbjct  198   PLEKGIIETMHESDVTITQSLTEKGVHVARDDGDNV-YRIRCDAVVVGSGSGGGVAAANL  256

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+   + S LE PSM +++  GGLL T D   +LLAGS VGGG+AV
Sbjct  257   AKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAGSAVGGGTAV  316

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   ++ FGS  Y  AMD V  ++GV   C    FQN VLRKG
Sbjct  317   NWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHGFQNQVLRKG  376

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+P DHYCG C +
Sbjct  377   CERLGLQVESVPRNSPEDHYCGLCGY  402


 Score = 80.9 bits (198),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 89/171 (52%), Gaps = 14/171 (8%)
 Frame = +2

Query  20   LHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETT-DASVTNFFQTSAASTGTP  196
            L  K          SPSQ+++L+ +C TFLP      PETT +    N F   A+ST  P
Sbjct  14   LRSKKRGEGYNHGFSPSQIQSLAVICQTFLP------PETTSEQQAVNSFHV-ASSTQPP  66

Query  197  --HQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKK  370
               +VA +I +  +   +  L ++L  LS R GTLLLCG   L   +PF+L+F ++   K
Sbjct  67   FTDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDK  126

Query  371  RERIVHSWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            RE I+ +W+  S   L F   FF A K   L  FF+  D+   NP+ +AIG
Sbjct  127  REAILRNWSRQSGFLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIG  176



>gb|AAM63097.1| unknown [Arabidopsis thaliana]
Length=748

 Score =   174 bits (441),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 134/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ ++  +  +   LT+ G  VA+       + I CDAVVVGSG GGGV +  L
Sbjct  198   PLEKGIIETMHESDLTITQSLTEKGVHVARDDGDNV-YRIRCDAVVVGSGSGGGVAAANL  256

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+   + S LE PSM +++  GGLL T D   +LLAGS VGGG+AV
Sbjct  257   AKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAGSAVGGGTAV  316

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   ++ FGS  Y  AMD V  ++GV   C    FQN VLRKG
Sbjct  317   NWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHGFQNQVLRKG  376

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+P DHYCG C +
Sbjct  377   CERLGLQVESVPRNSPEDHYCGLCGY  402


 Score = 80.9 bits (198),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 89/171 (52%), Gaps = 14/171 (8%)
 Frame = +2

Query  20   LHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETT-DASVTNFFQTSAASTGTP  196
            L  K          SPSQ+++L+ +C TFLP      PETT +    N F   A+ST  P
Sbjct  14   LRSKKRGEGYNHGFSPSQIQSLAVICQTFLP------PETTSEQQAVNSFHV-ASSTQPP  66

Query  197  --HQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKK  370
               +VA +I +  +   +  L ++L  LS R GTLLLCG   L   +PF+L+F ++   K
Sbjct  67   FTDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDK  126

Query  371  RERIVHSWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            RE I+ +W+  S   L F   FF A K   L  FF+  D+   NP+ +AIG
Sbjct  127  REAILRNWSRQSGFLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIG  176



>ref|XP_009369442.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=749

 Score =   171 bits (432),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+     +      LTK G  +           I+CD V+VGSGCGGGV + +L
Sbjct  200   PLEKGIIETAYESDSTLVESLTKKGLDLTD-DAVNNIHKIKCDVVIVGSGCGGGVAAAIL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPSM++++  GG++ + D  +++LAGSTVGGGSAV
Sbjct  259   AQSGQKVVVLEKGNYFVPKDYSSLEGPSMNELYESGGIMSSVDGMVMILAGSTVGGGSAV  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VLR+W   H + L+ S+ Y  AMD VC ++GV   C +E+F N +LRKG
Sbjct  319   NWSASIKTPDNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTESCTEENFPNQILRKG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+ +DHYCG+C +
Sbjct  379   CENLGLKVDAVPRNSSADHYCGFCNY  404


 Score = 84.3 bits (207),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 89/170 (52%), Gaps = 7/170 (4%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN-EALPETTD-----ASVTNFFQTSAASTGTPHQVAWVINQ  223
            S +Q+++L+A+C   LP ++ E +P+  +      S +++   SA+    P +VA ++ +
Sbjct  26   SSAQIQSLAAICEALLPPLSPEDIPDDHNPLHSSFSSSSYCTASASQPPIPDEVAELMVK  85

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R     +  + + L  LS R+GT LLCGK     ++PF+ +F E+S  KRE +   W+  
Sbjct  86   RTLPEVVGGVRVFLKMLSLRLGTFLLCGKSCFDWKWPFIHKFSEMSLDKRELVRKKWSRQ  145

Query  404  SLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRPFHF*KT  550
             L   IR  F  +K      FF+ VD+   NP+WKAIG    R     KT
Sbjct  146  KLVITIRLMFMVIKMFCFYTFFSRVDENSRNPAWKAIGYELDRKEKLIKT  195



>ref|XP_009594479.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana tomentosiformis]
Length=745

 Score =   168 bits (425),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +N  +E +   L+K G  + +      +F I CD V+VGSGCGGGV + +L
Sbjct  195   PLEKGIVETINESDETLKESLSKKGVPLTEDTKDN-TFKIRCDVVIVGSGCGGGVAAAIL  253

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G+KV+VLEKG+Y+   + S LEGPS+++++  G +L T D  ++++AG+TVGGGSAV
Sbjct  254   AKSGHKVVVLEKGHYFVPEDYSGLEGPSLNELYETGAMLTTDDGKVMVMAGTTVGGGSAV  313

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL +W   H +  FG+  Y  AMD VC ++GV   C +E  QN  +R+G
Sbjct  314   NWSASIRTPTDVLNDWSVKHKIPWFGTSEYQSAMDAVCKRIGVTENCANEGLQNQAIRRG  373

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V NIP+N+  +HYCG C +
Sbjct  374   CENLGLKVENIPRNSSENHYCGSCGY  399


 Score = 87.0 bits (214),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 93/155 (60%), Gaps = 4/155 (3%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN---EALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMK  232
            S SQ++T+++ C T +P +    + L    + ++ +FF +SA+    P++VA ++ +R  
Sbjct  24   SSSQIQTIASFCETLIPPLPYNPQHLSPCNNKALDSFFSSSASQPPFPNEVAELLVKRSN  83

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  412
               +  + ++++ LSTR+G+L+LCG+  L  ++PF+  F E+S K+RE ++  W+  S  
Sbjct  84   PEAMLIIRIVVFLLSTRLGSLVLCGRVCLDKRWPFVHNFSELSLKQRESLLQRWSRESFL  143

Query  413  F-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              +R  F  +K +   +FF+  D+   NP+W+AIG
Sbjct  144  LPLRITFLLIKTMCFFIFFSWTDENCKNPAWEAIG  178



>ref|XP_011029789.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Populus euphratica]
Length=744

 Score =   173 bits (438),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 134/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+ID N   +    R LT+ G  V +  P      I+CD V+VGSGCGGGV + VL
Sbjct  198   PLQKGLIDTNQETDSTLLRSLTEKGLEVTR-DPRRNLCKIKCDVVIVGSGCGGGVAAAVL  256

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV VLEKGNY+   + S LEGPS+ +++  GGLL + D  M+++AGS VGGGS V
Sbjct  257   AASGQKVFVLEKGNYFTAADYSGLEGPSIAQLYESGGLLASADAGMIIMAGSAVGGGSVV  316

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VL+EW +   + LFGS  Y  AMDTVC ++GV   C+ E FQN VLRKG
Sbjct  317   NWSASIKTPNSVLQEWTKNQKIPLFGSPEYFSAMDTVCARIGVTENCKVEGFQNQVLRKG  376

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L  PV  +P+N    HYCG C +
Sbjct  377   CERLGVPVKTVPRNTSERHYCGSCGY  402


 Score = 82.0 bits (201),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 89/167 (53%), Gaps = 25/167 (15%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVAW  211
            LS ++M++L++LC T LP++          + LP     +V   ++ SA+ T  P ++A 
Sbjct  23   LSSAEMDSLASLCETILPSLPPPVTTFDGKQHLPTK---AVQALYRASASQTPVPDEIAE  79

Query  212  VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  391
            ++ +R     +  + L+LW LSTR+GT LLCG      ++  +  F  IS  KRE+++  
Sbjct  80   LLRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWLCIQNFSSISLDKREKVLQK  139

Query  392  WATSSLQFIRNFFTAM-------KALVLLVFFTSVDDKGDNPSWKAI  511
            W      F R FFT +       K L + VFF+ V   GDNP+W+AI
Sbjct  140  W------FKRRFFTPIRIAFIYVKVLCVFVFFSRVGQNGDNPAWEAI  180



>ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
 gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
Length=754

 Score =   170 bits (430),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +GII+ LN  +      LTK G  V+          I+CD V+VGSGCGGGV + VL
Sbjct  204   PLEQGIIETLNESDSTFVQSLTKRGLQVSDDTTHNI-HKIKCDVVIVGSGCGGGVAAAVL  262

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+V+EKGNY+   + S LEGPSM++++  GG++ + D  +++LAGSTVGGGSA+
Sbjct  263   AQSGQKVMVVEKGNYFLPKDYSSLEGPSMNELYESGGIMSSVDGMIMILAGSTVGGGSAI  322

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL EW   H + L+ S  Y  AMD VC ++ V   C +E+FQN +LRKG
Sbjct  323   NWSASIRTPDTVLHEWSVDHKVPLYASSDYKYAMDVVCKRISVTDSCTEENFQNQILRKG  382

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+P DHYCG C +
Sbjct  383   CDTLGLKVDLVPRNSPGDHYCGSCNY  408


 Score = 84.7 bits (208),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 89/164 (54%), Gaps = 15/164 (9%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN------------EALPETTDASVTNFFQTSAASTGTPHQV  205
            SP+Q+++L+A+C   +P ++            E  P+  D ++ + ++ S +    P +V
Sbjct  26   SPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPD--DQALHSIYRASGSQPPIPDEV  83

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
            A ++ +R     +  + L L  LS R+GTLLLCG   LS ++PF+  F E+S +KRE ++
Sbjct  84   AELMLKRALPEVMEGMKLFLKMLSFRLGTLLLCGHRCLSWKWPFIHSFSEMSLEKREEVL  143

Query  386  HSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              W+   L   +R  F  +K      FF+ +D+   NP+WKA+G
Sbjct  144  KKWSKEKLVLTLRLMFLVVKIFCFYTFFSRLDENSRNPAWKAVG  187



>ref|XP_003574052.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Brachypodium 
distachyon]
Length=757

 Score =   172 bits (437),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 138/206 (67%), Gaps = 1/206 (0%)
 Frame = +3

Query  606   PLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++   L +  +   L   G +V      GP   ++CDAV+VGSGCGGGV + VL
Sbjct  204   PLDKGVVETRELDDAALLRSLAAKGLTVKPAASNGPHHTVQCDAVIVGSGCGGGVAAAVL  263

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG+KV+VLEKG+Y+A  + S +EGPSM++++  GG+  T ++  VL +G+TVGGGSAV
Sbjct  264   AAAGHKVVVLEKGDYFAAQDYSSVEGPSMERLYEQGGIFCTSNVTTVLYSGTTVGGGSAV  323

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  +L+EW   HGL +F S  Y +AMD V  ++ V   C +E FQN V+R+G
Sbjct  324   NWSASIRTPREILQEWSRGHGLPVFASAGYAQAMDAVSARLAVSDACLEEGFQNKVVRRG  383

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L  PV  +P+N+ +DHYCG C  
Sbjct  384   CEALGLPVDAVPRNSSADHYCGSCNL  409


 Score = 81.3 bits (199),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 86/168 (51%), Gaps = 3/168 (2%)
 Frame = +2

Query  14   YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGT  193
            + L R +  +  T  L P+QME L A+C   +P++     E  +  +  F+  S A +  
Sbjct  14   HPLLRVLRRDEYTHGLRPAQMEALRAMCGALIPSLPLPPEEGGNKDLERFYLASGADSAV  73

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
            P +VA +   R        + + LW L+TR+GTL LC  G L      + RF ++  ++R
Sbjct  74   PDEVAELAFTRCVWEAGVLVSVALWLLTTRLGTLALC--GWLCVVDSSVRRFADMPVERR  131

Query  374  ERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            E  +  W  +  L  ++  F  +K+L+  VF+T V++  +NP WKAIG
Sbjct  132  EAALQRWTRARWLIPVKIAFAIVKSLLFNVFYTKVNENSENPCWKAIG  179



>gb|KJB72416.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=677

 Score =   183 bits (465),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 145/206 (70%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ ++  +  ++  L++ G  V++       + I+CDAVV+GSGCGGGV + +L
Sbjct  130   PLQKGMIETVHEKDSTLYRSLSQKGLLVSEDTQQNV-YRIKCDAVVIGSGCGGGVAAAML  188

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+V+EKGNY+  T+ S  EGPSMDK++  GG+L + D  +++LAGSTVGGGSAV
Sbjct  189   AGSGLKVVVVEKGNYFTSTDYSPFEGPSMDKLYESGGILPSLDGQLLILAGSTVGGGSAV  248

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP YVL+EW E   + LFGS+ Y  AM+TVC ++GV  +C++E FQN VLRKG
Sbjct  249   NWSACIKTPKYVLKEWAEDCKIPLFGSNEYVSAMETVCERIGVTHDCKEEGFQNQVLRKG  308

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+   HYCG C F
Sbjct  309   CENLGLKVEKVPRNSSESHYCGSCGF  334


 Score = 70.5 bits (171),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  TRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF--IRNFFTAMKALV  451
            TR+G+LLLCG+  L  ++PF+  F  +  +KRE+++ +W      F   R  F  +K   
Sbjct  33   TRVGSLLLCGRQCLGKEWPFINDFGSMGVEKREKVMQNWLKHGFLFTPTRVAFIYLKVFC  92

Query  452  LLVFFTSVDDKGDNPSWKAIG  514
            L V+F+ V + G NP+W+AIG
Sbjct  93   LFVYFSRVGEDGYNPAWEAIG  113



>ref|XP_010501308.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO1-like 
[Camelina sativa]
Length=744

 Score =   167 bits (423),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 131/206 (64%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ + + E  +  R+   G  V + +    ++ IECDAVVVGSGCGGGV +  L
Sbjct  200   PLEKGIIETDKVNEMTIKQRMINKGLKVTEDRE-SDTYKIECDAVVVGSGCGGGVAAANL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G +V+VLEKGNY+   + S LEGPS  +MF    LLMT D     +AGSTVGGGS V
Sbjct  259   AKSGLRVVVLEKGNYFVPRDYSALEGPSTFEMFESNSLLMTHDGRFRFMAGSTVGGGSVV  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NW+A++KTP  ++ EW    G+  F S+ Y  AMD VC ++GV      E FQN +LRKG
Sbjct  319   NWAAALKTPDAIIEEWSVQRGISTFSSEKYKAAMDRVCKRIGVTERIVREGFQNQILRKG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C++L   V  +P+N+   HYCG C+F
Sbjct  379   CKKLGLDVTTVPRNSTDGHYCGSCSF  404


 Score = 86.7 bits (213),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 91/171 (53%), Gaps = 11/171 (6%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAAST  187
            K EN   +   SPS ++ LSA+C   LP +          L    + ++ +FF++S+   
Sbjct  15   KQEN--VSHGFSPSDLQALSAICEAILPPVPLQSLDLEMKLKVLRNDALLSFFKSSSGPH  72

Query  188  GTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLS-TQFPFLLRFPEISQ  364
              P +VA ++  +     +  + ++L  L+ R+GTLLLCG   L    +PFLL+F EIS 
Sbjct  73   VRPDEVAELLATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVCLDKANWPFLLKFSEISL  132

Query  365  KKRERIVHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +KRE+++  W T       R  F  +KA+ L  +FT  D+  +NP+W AIG
Sbjct  133  EKREKVLQRWNTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAWDAIG  183



>ref|XP_010457422.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Camelina sativa]
Length=752

 Score =   169 bits (428),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 130/206 (63%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +  +E     R+   G  V + +    ++ IECDAVVVGSGCGGGV +  L
Sbjct  200   PLEKGIIETDKEDEMTIKQRMINKGLKVTEDRE-SDTYKIECDAVVVGSGCGGGVAAANL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G +V+VLEKGNY+   + S LEGPS  +MF    LLMT D     +AGSTVGGGS V
Sbjct  259   AKSGLRVVVLEKGNYFVPRDYSSLEGPSTFEMFESNSLLMTHDGRFRFMAGSTVGGGSVV  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NW+AS+KTP  ++ EW    G+ +F S+ Y  AMD VC ++GV      E FQN +LRKG
Sbjct  319   NWAASLKTPDAIIEEWSVQRGISVFSSEKYKTAMDRVCKRIGVTERVIREGFQNQILRKG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   V  +P+N+   HYCG C+F
Sbjct  379   CEKLGLDVTTVPRNSTDGHYCGSCSF  404


 Score = 84.3 bits (207),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 91/171 (53%), Gaps = 11/171 (6%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAAST  187
            K EN   +   SPS ++ LSA+C   LP +          L    + ++ +FF++S+   
Sbjct  15   KHEN--VSHGFSPSDLQALSAICEAILPPVPLQSLDLEMKLKVLRNDALLSFFKSSSGPH  72

Query  188  GTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLS-TQFPFLLRFPEISQ  364
              P +VA ++  +     +  + ++L  L+ R+GTLLLCG   L    +PFLL+F EIS 
Sbjct  73   VRPDEVAELLATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVCLDQANWPFLLKFSEISL  132

Query  365  KKRERIVHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +KRE+++  W T       R  F  +KA+ L  +FT  D+  +NP+W AIG
Sbjct  133  EKREKVLQRWNTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAWDAIG  183



>ref|XP_010262396.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X1 [Nelumbo 
nucifera]
Length=763

 Score =   176 bits (447),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 138/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +N  +  +   LT+ G  V +  P      IECD VVVGSGCGGGV + VL
Sbjct  211   PLQKGIIETMNESDSTLVQSLTQKGFKVTE-DPKRNLHKIECDVVVVGSGCGGGVAASVL  269

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKGNY+A  + S +EGPS+++++  GG+L T D  ++++AGSTVGGGSAV
Sbjct  270   ASSGQKVIVLEKGNYFAPEDYSSVEGPSLNQLYESGGMLSTFDGKVMIMAGSTVGGGSAV  329

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VLREW   H + LFGS  Y  AMD V  + GV   C  E  QN VL+KG
Sbjct  330   NWSASIKTPSSVLREWFVGHKIPLFGSSDYLSAMDVVFKRNGVTENCVKEGLQNQVLQKG  389

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+  +HYCG C F
Sbjct  390   CENLGLKVESVPRNSSENHYCGSCGF  415


 Score = 77.0 bits (188),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 87/168 (52%), Gaps = 21/168 (13%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVAWV  214
            S S+M+ ++A+C   +P I          E+ P     S+ +F+  S +    P +V  V
Sbjct  31   SLSEMQVVTAICEALIPPIPLGSLHVNGKESPP---SKSIQSFYLASGSQKPIPDEVTVV  87

Query  215  -------INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
                   + + + H  +  + LLLW LSTR+GTLL+CG  S  +++PFL +F E+S +KR
Sbjct  88   ELVAELIVTKALWHG-VLVVRLLLWMLSTRLGTLLICGTLSFGSRWPFLCKFSELSLEKR  146

Query  374  ERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            E ++  W+ +  Q  +R  F   K      FF+  D+   NP+W AIG
Sbjct  147  EEVLKKWSRARYQIHLRLMFAMFKIFCCFAFFSLTDENSTNPAWDAIG  194



>ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Glycine 
max]
Length=740

 Score =   170 bits (430),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 138/211 (65%), Gaps = 12/211 (6%)
 Frame = +3

Query  606   PLYKGIID------LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  767
             PL KGI++      L+LP+      L + G  VA       +  I+CD V+VGSGCGGGV
Sbjct  192   PLEKGIVEAMKESNLSLPKS-----LIEKGLEVA-IDSKNNTLNIKCDVVIVGSGCGGGV  245

Query  768   isgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  947
              + +LA++G KVLVLEKGNY+   + S LEGPS+++++  GG   ++D  M +L G+TVG
Sbjct  246   AASILASSGLKVLVLEKGNYFTPNDYSSLEGPSLNELYELGGTFASRDGKMAILTGTTVG  305

Query  948   GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNM  1127
             GGSAVNW+ASI+TP +VL EW + H L LF S  Y  AMD VC ++GV  +C +E  QN 
Sbjct  306   GGSAVNWAASIRTPDFVLEEWGKDHKLSLFSSHEYLSAMDMVCKRIGVTDKCIEEGLQNQ  365

Query  1128  VLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             VLRKGC+ L  PV  +P+N+   HYCG C +
Sbjct  366   VLRKGCKNLGLPVDYVPRNSSERHYCGSCNY  396


 Score = 83.2 bits (204),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 92/160 (58%), Gaps = 3/160 (2%)
 Frame = +2

Query  38   NNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVI  217
            N      LS ++ME+LS++C   LP +   L  T   +V +F++ S +    PH++A ++
Sbjct  16   NKYTPHILSSAEMESLSSICEALLPPLQ--LDSTKSKTVQHFWKASGSQFSIPHEIAEIL  73

Query  218  NQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  397
             +R     L  L ++LW LSTR+GTLLLCG   LS ++PF+  F  +S   RE+++  W 
Sbjct  74   IKRALKEALILLRVILWLLSTRLGTLLLCGTLCLSKKWPFINSFSNLSLDNREKVLQKWF  133

Query  398  TSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
                L  IR  F  +K L   VFF+  DD G+NP+W+AIG
Sbjct  134  KHRFLTPIRLVFIYIKVLCFFVFFSQCDDNGENPAWEAIG  173



>ref|XP_010512451.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Camelina sativa]
Length=749

 Score =   169 bits (428),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 135/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +N  E+ +   L + G   A       +  I+CDAVV+GSG GGGV + VL
Sbjct  196   PLEKGIVETMNETEQTLLESLARKGLK-ADHDMDQDTIRIKCDAVVIGSGSGGGVAASVL  254

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKG+YY  ++    EGP MDK++  GG+L T D ++++LAG+TVGGGSAV
Sbjct  255   AKSGLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGILPTVDGNLMVLAGATVGGGSAV  314

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   +  +G+  Y  AM+ V  +MGV  +CE ESFQN +LRKG
Sbjct  315   NWSACIKTPKSVLQEWSEDQKIHFYGTKDYVSAMNVVWKRMGVTEKCEMESFQNQILRKG  374

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  +   V N+ +N+   HYCG C +
Sbjct  375   CENIGVHVENVARNSSEGHYCGSCGY  400


 Score = 83.6 bits (205),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 88/167 (53%), Gaps = 18/167 (11%)
 Frame = +2

Query  59   LSPSQMETLSALCNT-FLPAINEALPETTDASVTN----------FFQTSAASTGTPHQV  205
            +  ++METL++ C   F P       E + A  TN          F+ TS + T    Q 
Sbjct  15   IKAAEMETLASFCEAIFPPVAPPPPEELSGAGDTNKHRNTEALRSFYSTSGSQTPVLRQS  74

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
              ++ +R          L+L+ L+TR+GTLL+CG   L T++PF+ +F E+S +KRER++
Sbjct  75   IELLTKRGTMEAYLVTRLILFLLATRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVI  134

Query  386  H----SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
                 +W    L  IR  F  +K + L  FF+ V  KG+NP+W+AIG
Sbjct  135  QKQFRNWI---LTPIRAGFVYIKVVFLFCFFSRVSPKGENPAWEAIG  178



>emb|CDX99382.1| BnaC01g11700D [Brassica napus]
Length=508

 Score =   208 bits (529),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  714   FVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  893
               I+CDAVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLSL EG + D+M+L GG
Sbjct  1     MTIQCDAVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQAFDEMYLSGG  60

Query  894   LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTV  1073
             LL T D+++V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGS +Y +AMD V
Sbjct  61    LLATTDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWSEKSELEMFGSHLYREAMDVV  120

Query  1074  CGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             C +MGVQ E  +E F N +LRKGC  L  PV NIP+NAPSDHYCG+C
Sbjct  121   CERMGVQCEFLEEGFNNEILRKGCENLGLPVKNIPRNAPSDHYCGFC  167



>ref|XP_004247745.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Solanum lycopersicum]
Length=741

 Score =   166 bits (421),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 134/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +   E  +   L + G  V +       + ++CD V+VGSGCGGGV + VL
Sbjct  191   PLQKGIIETIYETESSIVKSLVEKGLKVTED-TTNNMYKVQCDVVIVGSGCGGGVAASVL  249

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKGNY+A+++ S LEGPS  +M+  GG+L T D  +++LAGSTVGGGSAV
Sbjct  250   ASSGQKVVVLEKGNYFAKSDYSSLEGPSQSQMYESGGILSTLDGKVMILAGSTVGGGSAV  309

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  V++EW +   + +F +  Y  AMD VC ++ V  +C  E  QN +LRKG
Sbjct  310   NWSACIKTPDSVIQEWGDDKRISMFKTPEYVSAMDKVCERINVTEKCTQEGLQNQILRKG  369

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  + +N+  DHYCG C +
Sbjct  370   CERLGLEVEGVARNSSEDHYCGSCCY  395


 Score = 85.9 bits (211),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 82/152 (54%), Gaps = 1/152 (1%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  241
            S S+++TL+++C T LP I     +  +  + NF + S +    P +VA ++ +R     
Sbjct  23   SSSEIQTLTSICETILPPIPLNSLQKNNKKIQNFHKVSGSQYPIPDEVAEIVMKRGFFEA  82

Query  242  lnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFI  418
               +  LL  LSTRIG+LLLCG       +P++ +F +IS  KRE ++  W  +     +
Sbjct  83   RMLVRSLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWFNNRFFTPV  142

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            R  F  +K L L +FFT V +  +NP+W  IG
Sbjct  143  RLAFVFVKFLCLYIFFTQVGEDSNNPAWDDIG  174



>emb|CDX92884.1| BnaC07g41420D [Brassica napus]
Length=742

 Score =   178 bits (452),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 132/206 (64%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +GII+  N  +  +   LT+ G  VA+         I CD V+VGSG GGGV +  L
Sbjct  195   PLERGIIETKNESDVTIRQSLTQKGVHVAREDNDNI-HRIRCDVVIVGSGSGGGVAAANL  253

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+   + S LEGPSM +++  G L+ T D   ++LAGSTVGGG+AV
Sbjct  254   AKAGLKVLVLEKGNYFTSRDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTVGGGTAV  313

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VLREW E   +E FGS  Y  AMD V  ++GV   C  E  QN VLR G
Sbjct  314   NWSASIRTPDHVLREWSEESKIEFFGSQEYQLAMDEVTRRLGVTERCVKEGLQNQVLRGG  373

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   VV++P+N+P DHYCG C +
Sbjct  374   CERLGLEVVSVPRNSPEDHYCGSCGY  399


 Score = 73.9 bits (180),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 8/167 (5%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETT--DASVTNFFQTSAASTGTPH  199
            +K +    +   S SQ++TLS +C T LP      PETT    +V +F   S +      
Sbjct  16   KKRQEGGYSHGFSISQIQTLSVICQTLLPPP----PETTAEQNAVDSFKVASGSQPPFTD  71

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            +VA +I +  +   +    ++   L+ R GTL LCG   L+  +PF+L+F E+   KRE 
Sbjct  72   EVAEMIVKNGRSEAVKVFKIISTVLAYRFGTLFLCGSLCLAKDWPFVLKFSELPLDKREE  131

Query  380  IVHSWATSSLQF--IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            I+  W+  S  F  +R  F   K   L  FF+  D+   NP+ +AIG
Sbjct  132  ILRMWSRQSGFFLPLRITFFLAKFYTLFSFFSQRDENMKNPALEAIG  178



>emb|CDP11641.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   174 bits (442),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 143/206 (69%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++  +  E  + + L + G  VA+  P    + I+CD V+VGSGCGGGV + VL
Sbjct  199   PLMKGMVETTHETESTIVSSLVQKGLRVAE-DPKEKLYKIKCDVVIVGSGCGGGVAAAVL  257

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+V+EKGNY+ +T+ S LEGPSM++++  GG+L T D  +++LAGSTVGGGSAV
Sbjct  258   AKSGQKVVVIEKGNYFTKTDYSSLEGPSMNELYESGGILATLDGKLLMLAGSTVGGGSAV  317

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA +KTP  VL+EW +   + LF S  Y  AMDTV  ++GV  +C +E FQN +LR+G
Sbjct  318   NWSACLKTPMSVLQEWAKDCQIPLFTSSQYVSAMDTVSQRIGVTEKCSEEGFQNQILRQG  377

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   V ++P+N+  +HYCG C +
Sbjct  378   CEKLGLEVESVPRNSSENHYCGSCNY  403


 Score = 77.4 bits (189),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 87/159 (55%), Gaps = 10/159 (6%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI--NEALPET------TDASVTNFFQTSAASTGTPHQVAWVI  217
            S S++E L+ +C  F+P +  N + P+       T  ++ +F+++S A    P +VA ++
Sbjct  24   SSSELEALTGMCEAFIPPLPLNNS-PDIVGKDGKTKEAIQSFYKSSGAQYPNPDKVAELV  82

Query  218  NQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  397
             +R     +  + +LL  LSTR+GTLLLCG      ++P++ +F +I    RE+++  W 
Sbjct  83   VKRGFMEAVMLVRILLIILSTRLGTLLLCGALCFGKKWPYINKFSDIPVDNREKVIQKWL  142

Query  398  TSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
                L  IR  F  +K L L  FFT V +   NP+W+A+
Sbjct  143  KHKFLTPIRLPFVLIKFLCLYAFFTQVWEDFKNPAWEAM  181



>ref|XP_009790215.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Nicotiana sylvestris]
Length=742

 Score =   167 bits (424),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 134/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +   E  +   L + G  V         + ++CD V+VGSGCGGGV + VL
Sbjct  192   PLEKGIVEAIYETESTIVKSLVQKGLKVIDD-TKNNMYKVQCDVVIVGSGCGGGVAASVL  250

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G+KV+VLEKGNYY +++ S LEGPSM++M+  GG+L T D  ++++AGSTVGGGSA+
Sbjct  251   ASSGHKVIVLEKGNYYTKSDYSSLEGPSMNQMYESGGILSTLDAKIMIMAGSTVGGGSAI  310

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  V++EW +   L +F S  Y  AMD VC ++GV   C  E  QN +LRKG
Sbjct  311   NWSACIKTPDCVIQEWGDDKRLPIFQSPEYVSAMDKVCERIGVTENCTQEGLQNQILRKG  370

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  + +N   +HYCG C +
Sbjct  371   CENLGLEVEGVARNTSENHYCGSCCY  396


 Score = 84.0 bits (206),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 85/154 (55%), Gaps = 4/154 (3%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            S S+METL+++C T LP +  NE +PE    ++    + SA+    P + A V+ +R   
Sbjct  23   SSSEMETLTSICETILPPLPQNE-IPEKNSHNIQYLHKASASQYPIPDECAEVVMKRGFL  81

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQ  412
              +  +  LL  LSTRIGTLLLCG      ++P++ +F +I  +KRE ++  W  +  L 
Sbjct  82   EAIILVRGLLRILSTRIGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQKWFKNRFLT  141

Query  413  FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +R  F  +K L L +FFT V +   N +W  IG
Sbjct  142  PVRLAFMFIKFLCLYIFFTQVGEDSKNQAWDDIG  175



>ref|XP_008785203.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=758

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ ++  +  +   L K G +V++  P    + I CD  +VGSGCGGGV + VL
Sbjct  206   PLEKGIIETMDQTDASLLESLAKKGLTVSQ-DPMQNIYRIRCDVAIVGSGCGGGVAAAVL  264

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG KV+V+EKGNY+   + + +E PSM +++  GG+  T D  ++LLAGSTVGGGSAV
Sbjct  265   ASAGRKVVVIEKGNYFTSEDYTSIEAPSMYELYESGGIHSTVDGKVMLLAGSTVGGGSAV  324

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NW+A IKTP +VLREW E   L LF S  Y  AMD VC ++GV   C +E FQN VLRKG
Sbjct  325   NWAACIKTPDHVLREWAEERQLPLFTSTDYLSAMDAVCRRLGVTESCSEEGFQNKVLRKG  384

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V ++P+N+   H+CG C +
Sbjct  385   CQNLGLRVDSVPRNSSESHFCGSCCY  410


 Score = 78.2 bits (191),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 88/160 (55%), Gaps = 10/160 (6%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPA-------INEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  220
            SPSQ+++L+A+C   +P+       ++    +    S+  F+  S + +  P +VA ++ 
Sbjct  31   SPSQIQSLAAMCEALIPSLPMEELHVSSGKEDPPTKSLQAFYLASGSESPVPDEVAELLV  90

Query  221  QRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  400
            +R     +  + L+LW L+T++GTL+LCG  SL   FPF+ +F ++  +KRE ++  W  
Sbjct  91   KRGLREAVLLVKLVLWLLATKLGTLVLCGFLSLRGGFPFINKFSDMPVEKREEVLKRWNK  150

Query  401  SSLQFI--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +  FI  R  F  +K     +F++  ++  +N SW AIG
Sbjct  151  ENF-FIPLRMVFVMVKVFCFHIFYSMTNENSENLSWNAIG  189



>gb|ERN18825.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
Length=798

 Score =   180 bits (456),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 130/200 (65%), Gaps = 1/200 (1%)
 Frame = +3

Query  621   IIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYK  800
             I    L +E + + +   G +V +  P      +ECDAVVVGSG GG V +  LA +GY+
Sbjct  218   ISTTTLTKESLVSTIKTKGITVTE-DPSADLLTLECDAVVVGSGPGGSVAAAKLAKSGYQ  276

Query  801   VLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASI  980
             VLVLEKG Y+   + SLLEGPSMD+M+  GG+L T D  +++ AGSTVGGGSA+NWSA I
Sbjct  277   VLVLEKGLYFTPQDYSLLEGPSMDQMYESGGILSTTDAKVLITAGSTVGGGSAINWSACI  336

Query  981   KTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCY  1160
             KTP  VL++W E   L LFGS  Y  AM+ VC ++GV  +CE E+FQN V R GC  L  
Sbjct  337   KTPDKVLKQWSEDFSLSLFGSHNYRAAMEAVCKRLGVTEKCEKENFQNEVFRSGCERLGL  396

Query  1161  PVVNIPQNAPSDHYCGWCTF  1220
              V  +P+N+P  HYCG C +
Sbjct  397   KVEFVPRNSPEGHYCGQCGY  416


 Score = 71.6 bits (174),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 88/173 (51%), Gaps = 30/173 (17%)
 Frame = +2

Query  68   SQMETLSALCNTFLPA-------INEALPETTDASVTNFFQTSAASTGTPHQ--------  202
            +Q+++L+A+C   +P+       ++         S+ +F++ S +    P Q        
Sbjct  28   AQIQSLTAICEALIPSMPITALHVSSQRDPPPSPSLVSFYKASGSDYQVPDQALFRSRNS  87

Query  203  ---VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
               VA ++ +R     +  +  +LW LSTR+GTLLLCG   LS  FPF+  F E+  +KR
Sbjct  88   ETFVAELMVKRGLPDAVTLVSWVLWALSTRLGTLLLCGSTCLSLNFPFIRSFSEMPVEKR  147

Query  374  ERIVHSWATSSLQFIRNFFTAM-------KALVLLVFFTSVDDKGDNPSWKAI  511
            E+++ +W+       R+FF+A+       K   + VF++  D    NPSW+AI
Sbjct  148  EKVLMAWSRE-----RSFFSALRLSFALFKIFCVYVFYSWTDVNSKNPSWEAI  195



>ref|XP_002869492.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45751.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
Length=748

 Score =   175 bits (444),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 134/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPS-FVIECDAvvvgsgcgggvisgvL  782
             PL  GII+    E  V    + +G  V   +  G +   I CDAVVVGSG GGGV +  L
Sbjct  198   PLETGIIETT-HESDVTITQSLIGKGVHVARDDGDNVHRIRCDAVVVGSGSGGGVAAANL  256

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG+KVLVLEKGNY+A  + S LEGPSM +++   GLL T D   +LLAGSTVGGG+AV
Sbjct  257   AKAGFKVLVLEKGNYFAPQDYSGLEGPSMLELYEKSGLLTTVDGKFMLLAGSTVGGGTAV  316

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   ++ FGS  Y  AMD V  ++GV   C  + FQN VLRKG
Sbjct  317   NWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVMTRIGVTERCVKDGFQNQVLRKG  376

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+P DHYCG C +
Sbjct  377   CERLGLQVESVPRNSPEDHYCGLCGY  402


 Score = 75.9 bits (185),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 84/157 (54%), Gaps = 14/157 (9%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETT-DASVTNFFQTSAASTGTP--HQVAWVINQRMK  232
            SPSQ+++L+ +C T LP      PETT +    N F   A+ST  P   +VA +I +  +
Sbjct  28   SPSQIQSLAVICQTLLP------PETTAEQQALNSFNV-ASSTQPPFTEEVAEMIVKNGR  80

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS--  406
               +  L ++L  LS R GTLLLCG   L   +PF+L+F ++   KRE I+  W+  S  
Sbjct  81   SEAVKVLKIILIILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREEILRKWSRQSGF  140

Query  407  -LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             L F   FF A K   L  FF+  D+   NP+ + IG
Sbjct  141  LLPFRITFFLA-KFYTLFYFFSQTDENLKNPALETIG  176



>ref|XP_010488398.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=750

 Score =   169 bits (428),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 135/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +N  E+ +   L + G   A       +  I+CDAVV+GSG GGGV + VL
Sbjct  196   PLEKGIVETMNETEQTLLESLARKGLE-ADHDMDQDTIRIKCDAVVIGSGSGGGVAASVL  254

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKG+YY  ++    EGP MDK++  GG+L T D ++++LAG+TVGGGSAV
Sbjct  255   AKSGLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGILPTVDGNLMVLAGATVGGGSAV  314

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW +   +  +G+  Y  AMD V  +MGV  +CE ESFQN +LRKG
Sbjct  315   NWSACIKTPKSVLQEWSDDQKIPFYGTKEYVSAMDVVWKRMGVTEKCEMESFQNQILRKG  374

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  +   V N+ +N+   HYCG C +
Sbjct  375   CENIGVHVENVARNSSEGHYCGSCGY  400


 Score = 81.6 bits (200),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 89/169 (53%), Gaps = 18/169 (11%)
 Frame = +2

Query  53   KTLSPSQMETLSALCNTFLPAINEALPETTDASVTN-----------FFQTSAASTGTPH  199
            + ++ ++METL++ C    P +    PE    +  N           F+ TS + T    
Sbjct  13   RDITAAEMETLASFCEAVFPPVAPPPPEELSGAGDNNNHRNTEALWSFYSTSGSQTPVLR  72

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            Q   ++ +R          L+L+ L+TR+GTLL+CG   L T++PF+ +F E+S +KRER
Sbjct  73   QSIELLTKRATMEACLVTRLILFLLATRLGTLLICGTECLVTRWPFVEKFSELSLEKRER  132

Query  380  IVH----SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++     +W    L  IR  F  +K + L  FF+ V  KG+NP+W+AIG
Sbjct  133  VIQKQFRNWI---LTPIRAGFVYIKVIFLFCFFSRVSPKGENPAWEAIG  178



>ref|XP_010475034.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Camelina sativa]
Length=752

 Score =   169 bits (427),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 131/206 (64%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ + + E  +  R+   G  V + +    ++ IECDAVVVGSGCGGGV +  L
Sbjct  200   PLEKGIIETDKVNEMTIKQRMINKGLKVTEDRE-SDTYKIECDAVVVGSGCGGGVAAANL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G +V+VLEKGNY+   + S LEGPS  ++F    LLMT D     +AGSTVGGGS V
Sbjct  259   AKSGLRVVVLEKGNYFVSRDYSALEGPSTFELFESNSLLMTHDGRFRFMAGSTVGGGSVV  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NW+AS+KTP  ++ EW    G+ +F S+ Y  AMD VC ++GV      E FQN +LRKG
Sbjct  319   NWAASLKTPDAIIEEWSVQRGISIFSSEKYKAAMDRVCKRIGVTERVIREGFQNQILRKG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   V  +P+N+   HYCG C+F
Sbjct  379   CEKLGLDVTTVPRNSTDGHYCGSCSF  404


 Score = 82.0 bits (201),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 90/171 (53%), Gaps = 11/171 (6%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAAST  187
            K EN   +   S S ++ LSA+C   LP +          L    + ++ +FF++S    
Sbjct  15   KHEN--VSHGFSASDLQALSAICEAILPPVPLQSLDLEMKLKVLRNDALLSFFKSSPGPH  72

Query  188  GTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLS-TQFPFLLRFPEISQ  364
              P +VA V+  +     +  + ++L  L+ R+GTLLLCG  +L    +PFLL+F EIS 
Sbjct  73   VRPDEVAEVLATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVNLDKASWPFLLKFSEISL  132

Query  365  KKRERIVHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +KRE+++  W T       R  F  +KA+ L  +FT  D+  +NP+W AIG
Sbjct  133  EKREKVLQRWNTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAWDAIG  183



>ref|XP_008235630.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Prunus mume]
Length=760

 Score =   170 bits (431),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +GII+ +N  +  +   LTK G  V+          I+CD V+VGSGCGGGV + VL
Sbjct  204   PLEQGIIETMNESDSTLVQSLTKRGLRVSDDTTHNL-HKIQCDVVIVGSGCGGGVAAAVL  262

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+V+EKGNY+   + S LEGPSM++++  GG++ + D  +++LAGSTVGGGSA+
Sbjct  263   AESGQKVIVVEKGNYFLPKDYSSLEGPSMNELYESGGIMSSVDGMIMILAGSTVGGGSAI  322

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  VL EW   H + L+ S  Y  AMD VC ++ V   C +E+FQN +LRKG
Sbjct  323   NWSASIRTPDTVLHEWSVDHKVRLYASSDYKSAMDVVCKRIRVTDSCTEENFQNQILRKG  382

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+P DHYCG C +
Sbjct  383   CDTLGLKVDLVPRNSPGDHYCGSCNY  408


 Score = 80.1 bits (196),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 88/164 (54%), Gaps = 15/164 (9%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN------------EALPETTDASVTNFFQTSAASTGTPHQV  205
            SP+Q+++L+A+C   +P ++            E  P+  D ++ + ++ S +    P +V
Sbjct  26   SPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPD--DQALHSIYRASGSQPPIPDEV  83

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
            A ++ +R     L  + L L  LS R+GTLLLC    LS ++PF+  F E+S +KRE ++
Sbjct  84   AELMVKRALPEVLEGMKLFLKMLSFRLGTLLLCRHRCLSWKWPFIHSFSEMSLEKREEVL  143

Query  386  HSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              W+   L   +R  F  +K      FF+ +D+   NP+WKA+G
Sbjct  144  KKWSREKLVLTLRLMFLVVKIFCFYTFFSWLDENSRNPAWKAVG  187



>ref|XP_002528823.1| disulfide oxidoreductase, putative [Ricinus communis]
 gb|EEF33557.1| disulfide oxidoreductase, putative [Ricinus communis]
Length=747

 Score =   170 bits (431),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 135/207 (65%), Gaps = 4/207 (2%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFV-IECDAvvvgsgcgggvisgv  779
             PL KGI++     +  F N + + G  VA    PG +   I+CD V+VGSGCGGGV + V
Sbjct  195   PLEKGIVETMHESDSTFLNSIAQKGLKVAHV--PGHNLCKIKCDVVIVGSGCGGGVAAAV  252

Query  780   LATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSA  959
             LA +G KVLVLEKGNY+   + S LEGPS + ++  GGL+ + D   ++LAGS VGGGSA
Sbjct  253   LAASGQKVLVLEKGNYFTAKDFSGLEGPSYNHLYEAGGLMPSADAKFIILAGSVVGGGSA  312

Query  960   VNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRK  1139
             VNWSA I TP YVL+EW E H ++LFGS  Y  AMD VC ++GV   C +E FQN V+RK
Sbjct  313   VNWSACINTPNYVLKEWAENHKIQLFGSPEYLSAMDIVCKRIGVTENCVEEGFQNQVIRK  372

Query  1140  GCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             GC  L   +  +P+N+   HYCG C +
Sbjct  373   GCENLGLEINTVPRNSSEKHYCGSCGY  399


 Score = 79.3 bits (194),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 91/156 (58%), Gaps = 4/156 (3%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEAL---PETTDASVTNFFQTSAASTGTPHQVAWVINQRM  229
             S ++M++L++LC+T  P I+ A     E  + +V  FF+ S +    P +VA +I  R 
Sbjct  23   FSSAEMDSLASLCHTIWPPISAAQHHNQEPANPAVQEFFKASGSQYPLPDEVAELIAMRG  82

Query  230  KHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-  406
                +  + L+L  LSTR+GTLLL G      ++PF+ +F  I  +KRE+++  W     
Sbjct  83   LIEAVMVVRLVLLLLSTRLGTLLLSGSLCFGEKWPFINKFSSIPVEKREKVLQKWLRHRF  142

Query  407  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            L  IR  F  +KA+ L VFFT +D+ G+NP+W+AIG
Sbjct  143  LTPIRLAFFYVKAICLHVFFTQIDENGNNPAWEAIG  178



>ref|XP_009764096.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana sylvestris]
Length=733

 Score =   170 bits (430),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 138/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +N  +E +   LTK G  + +      +F I CD V+VGSGCGGGV + +L
Sbjct  180   PLEKGIVETINESDETLKESLTKKGVPLTEDTKDN-TFKIRCDVVIVGSGCGGGVAAAIL  238

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G+KV+VLEKG+Y+   + S LEGPS+++++  G +L T D  ++++AG+TVGGGSAV
Sbjct  239   AKSGHKVVVLEKGHYFVPEDYSGLEGPSLNELYESGAMLSTLDGKIMIMAGTTVGGGSAV  298

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSAS++TP  VL +W   H +  FG+  Y  AMD VC ++GV   C +E  QN V+R+G
Sbjct  299   NWSASLRTPTDVLNDWSVKHKIPWFGTSEYQSAMDAVCKRIGVTENCSNEGLQNQVIRRG  358

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V NIP+N+  +HYCG C +
Sbjct  359   CENLGLKVENIPRNSSENHYCGSCGY  384


 Score = 79.3 bits (194),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 87/152 (57%), Gaps = 9/152 (6%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  241
            S SQ++T+++ C T +P      P     S   FF +S +    P++VA ++ +R K   
Sbjct  20   SSSQIQTIASFCETLIPP-----PYDHQDS---FFSSSGSQPPFPNEVAELLVKRSKPEA  71

Query  242  lnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-I  418
            +  + ++++ LSTR+G+L+LCG+  L  + PF+  F E+S K+RE ++  W+  S    +
Sbjct  72   MFIIRIVVFMLSTRLGSLVLCGRVCLDKRRPFVHNFSELSLKQREPLLQRWSRESFLLPL  131

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            R  F  +K +   +FF+  D+   NP+W+AIG
Sbjct  132  RITFLLIKIMSFFIFFSWTDENFKNPAWEAIG  163



>ref|XP_007035183.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035184.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035185.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06110.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06111.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
Length=750

 Score =   184 bits (467),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 144/206 (70%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ ++  +  +   LT+ G  V +       + I+CDAV+VGSGCGGGV + +L
Sbjct  201   PLQKGMIETMHEKDSTLLQSLTQKGLQVTEDTERN-VYKIKCDAVIVGSGCGGGVAAAIL  259

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKG+Y+A ++ S  EGPSMD+++  GG+L + D  M++LAGSTVGGGSA+
Sbjct  260   ASSGLKVVVLEKGSYFAPSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGSTVGGGSAI  319

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  +L+EW E   L LFGS  Y  AMD VC ++GV   C++E FQN +LRKG
Sbjct  320   NWSASIKTPKSILQEWAEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGFQNQILRKG  379

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V N+P+N+   HYCG C F
Sbjct  380   CKNLGLEVENVPRNSSESHYCGSCGF  405


 Score = 65.1 bits (157),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 86/158 (54%), Gaps = 6/158 (4%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAIN-----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  223
            LS ++++TL+++     P++      E        +V +F + SA+ +  P +VA ++ +
Sbjct  27   LSSAEVQTLASIGEAVFPSLKPNSDFEGKQNQPRKAVQSFLEASASESPIPDEVAQLLVK  86

Query  224  RMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  403
            R        L ++L  LSTR+GTLLLCG   L  ++P++  F  +  + RE+++  W  S
Sbjct  87   RTFMETRILLRVVLLLLSTRLGTLLLCGSLCLGDKWPYINYFSCMPLENREKVLQMWFKS  146

Query  404  SL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             L   +R  F  +K   L VFF+ V +  DNP+W+AIG
Sbjct  147  WLFTLVRIAFIYLKVACLYVFFSRVGENNDNPAWEAIG  184



>ref|XP_009384756.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Musa acuminata 
subsp. malaccensis]
Length=787

 Score =   209 bits (532),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 164/242 (68%), Gaps = 13/242 (5%)
 Frame = +3

Query  513   GYCGPDPSISekqkkqkhhdheddieeLLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV--  686
             GY GPDP  + K   ++     D       GPLYK ++ +  P + +   L++ G S+  
Sbjct  196   GYVGPDPRRAIKSSSEEEEGARD-------GPLYKALVHMAGPMDVLCTSLSRAGLSLVT  248

Query  687   AKPKPPG----PSFVIECDAvvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLL  854
             ++ +P G    P   I CDAVVVGSG GGGV++GVLA AG+KV+VLEKG Y+AR NL+LL
Sbjct  249   SQSQPDGLKSKPLPTIYCDAVVVGSGSGGGVVAGVLAKAGFKVVVLEKGGYHARNNLTLL  308

Query  855   EGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLEL  1034
             E  ++D M+ G G+L T+DL + +L+GSTVGGGSAVNWSASI+TP +V+ EW   HGLEL
Sbjct  309   ERHTLDHMYEGCGVLTTEDLGVFVLSGSTVGGGSAVNWSASIRTPDHVISEWRHEHGLEL  368

Query  1035  FGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVVNIPQNAPSDHYCGWC  1214
             F SDVY +A+D V G+MGVQ E   ES  N VLR+GC EL YPV  + QNAP DH CGWC
Sbjct  369   FDSDVYAEALDAVSGRMGVQCEVRHESLANAVLRRGCAELGYPVQTVGQNAPPDHDCGWC  428

Query  1215  TF  1220
              F
Sbjct  429   CF  430


 Score =   124 bits (310),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 103/168 (61%), Gaps = 2/168 (1%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  238
            LS  + ++L+A+C+ FLP+I+  +P     S+  ++  SA+  GTP  V   +++R++HP
Sbjct  47   LSSREKDSLAAVCDAFLPSIH--VPHAPHQSLRTYYANSASMIGTPEVVGGYLSERIQHP  104

Query  239  KlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  418
            +L  L L LW LST  GT +LCG  SLS +FPF   FPE+    RE I+ SW+ S +  +
Sbjct  105  RLWQLRLALWLLSTWFGTFILCGTNSLSCRFPFFRSFPEVEAAGREDIIRSWSMSCIFLL  164

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRPFHF*KTKETE  562
            R  +   KALV+L +FT +++K +NP+W+AIG +   P    K+   E
Sbjct  165  RVLYKGFKALVVLFYFTQLNEKNENPAWEAIGYVGPDPRRAIKSSSEE  212



>ref|XP_008664883.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Zea mays]
 tpg|DAA49658.1| TPA: hypothetical protein ZEAMMB73_936795 [Zea mays]
Length=762

 Score =   154 bits (389),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 133/204 (65%), Gaps = 2/204 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  G+++  +L +  +   LT+ G +V K    G    ++CD V+VGSGCGGGV + VL
Sbjct  215   PLDSGVVETRSLNDATLLKSLTERGVAV-KAGVSGAHHTVQCDVVIVGSGCGGGVAAAVL  273

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+V+EKG+Y+   + + +EGPSM++++  GG+  T ++  ++ AG+TVGGGSA+
Sbjct  274   AAAGRKVVVVEKGDYFTAESYTSVEGPSMERLYEKGGIFCTSNVTTIMFAGTTVGGGSAI  333

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSAS++TP +V +EW   HGL +FG   Y  AMD VC ++ V   C +E FQN VLR+G
Sbjct  334   NWSASVRTPEWVTQEWAREHGLPMFGRPEYAHAMDAVCARLAVTGGCREEGFQNKVLRRG  393

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C  L      +P+N+   H+CG C
Sbjct  394   CEALGLRGDAVPRNSSEGHFCGSC  417


 Score = 94.4 bits (233),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 93/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  20   LHRKMENNTATKTLSPSQMETLSALCNTFLPAIN-EAL-----PETTDASVTNFFQTSAA  181
            L R+ +    T  L P QME L A+C   +P++  E L     P      +  FF+ SAA
Sbjct  10   LLRRCKREGYTHGLRPPQMEALRAMCGALIPSLPVEGLHVQPQPGRGKDDLDRFFRASAA  69

Query  182  STGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLS---TQFPFLLRFP  352
                P +VA ++  R     +  + ++LW LSTRIGTL LCG+   S   + FP+  RF 
Sbjct  70   DGAIPDEVAEMVT-RCVWEGVLLMRIVLWVLSTRIGTLALCGRLCFSAGKSSFPYACRFA  128

Query  353  EISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++  ++RER++  W+ +   F ++  F   K L    F+T V++  DNPSWKAIG
Sbjct  129  DMPVERRERVLQRWSGARWLFPLKITFVIAKLLSHYAFYTMVNENSDNPSWKAIG  183



>ref|XP_006354463.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Solanum 
tuberosum]
Length=741

 Score =   162 bits (410),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 133/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +   E  +   L + G  V +       + ++CD V+VGSGCGGGV + VL
Sbjct  191   PLQKGIIETIYETESTIVKSLVEKGLKVTED-TKNNMYKVQCDVVIVGSGCGGGVAASVL  249

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKGNY+A+++ S LEGPS  +M+  GG+  T D  +++LAGSTVGGGSAV
Sbjct  250   ASSGQKVVVLEKGNYFAKSDYSSLEGPSQSQMYESGGIFSTLDGKVMILAGSTVGGGSAV  309

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  +++EW +   + +F +  Y  AMD VC ++ V  +C  E  QN +L+KG
Sbjct  310   NWSACIKTPDSIIQEWGDDKRISMFKTPEYVSAMDKVCERINVTEKCTQEGLQNQILQKG  369

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  + +N+  DHYCG C +
Sbjct  370   CERLGLEVEGVARNSSEDHYCGSCCY  395


 Score = 85.9 bits (211),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 81/152 (53%), Gaps = 1/152 (1%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  241
            S S++ETL+++C T LP +     +  +  + NF + S +    P +VA ++ +R     
Sbjct  23   SSSEIETLTSICETILPPLPLNSLQENNKKIQNFHKVSGSQYPIPDEVAEIVMKRAFFEA  82

Query  242  lnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFI  418
               +  LL  LSTRIG+LLLCG       +P++ +F +IS  KRE ++  W  +     +
Sbjct  83   RMLVRGLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWFNNRFFTPV  142

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            R  F  +K L L +FFT V +   NP+W  IG
Sbjct  143  RLAFVFVKFLCLYIFFTQVGEDSKNPAWDDIG  174



>ref|XP_009376994.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Pyrus x bretschneideri]
Length=749

 Score =   175 bits (444),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 138/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+  L  +  + N L + G  V         + ++CD +VVGSGCGGGV + VL
Sbjct  203   PLQKGIIETMLETDTTLLNSLAQKGFQVIHDCTKNI-YNVKCDVIVVGSGCGGGVAAAVL  261

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G+KV+VLEKGNY+  ++ S LE PS D+++  GG+L+T D  +VL AGSTVGGGSA+
Sbjct  262   ASSGHKVIVLEKGNYFTPSDYSSLEAPSHDQLYESGGILVTVDGKIVLQAGSTVGGGSAI  321

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP YVL+EW + H ++ FG   Y  AMDTVC ++GV   C +E FQN VLRKG
Sbjct  322   NWSACIKTPNYVLQEWNKDHKIKFFGGSEYLSAMDTVCERIGVIENCVEEGFQNQVLRKG  381

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+   HYCG C +
Sbjct  382   CENLGLGVDFVPRNSSEKHYCGSCGY  407


 Score = 72.8 bits (177),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 93/163 (57%), Gaps = 3/163 (2%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAINEALPE--TTDASVTNFFQTSAASTGTPHQVA  208
            ++   +   S ++M++L+++C   LP + E   E  T + +V +F++TSAA T  P +VA
Sbjct  18   DDRKYSHGFSSAEMQSLASICEALLPPLYEIKGEQPTINKAVQSFYKTSAAQTPIPDEVA  77

Query  209  WVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  388
             ++ +R     +  + ++LW L T++GTLLLCG       +PF+  F  +S +KRE+++ 
Sbjct  78   QLMVKRALIEAVVLVRVVLWILGTKLGTLLLCGSLCFGKTWPFVHNFSSLSLEKREKVLQ  137

Query  389  SWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             W     L  IR  F  +K L L +FF+ V +  +N  W+AIG
Sbjct  138  KWFKHRFLTPIRLAFVYIKFLCLYIFFSRVGENAENLIWQAIG  180



>ref|XP_006306477.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
 gb|EOA39375.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
Length=752

 Score =   167 bits (423),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 130/206 (63%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+   + E  +  R+   G  V + +    ++ IECDAV+VGSGCGGGV +  L
Sbjct  200   PLEKGIIETAEVDEMTIKQRMINKGLKVTEDRE-SDTYKIECDAVIVGSGCGGGVAAANL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPS  ++F    LLMT D     +AGSTVGGGS V
Sbjct  259   AKSGLKVVVLEKGNYFVPRDYSALEGPSTFELFESNSLLMTHDGRFRFMAGSTVGGGSVV  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NW+AS+ TP  ++ EW    G+ +F S+ Y  AMD VC ++GV  +   E FQN +LRKG
Sbjct  319   NWAASLNTPDAIIEEWSVQRGIAIFSSEKYKAAMDRVCKRIGVTEKIIREGFQNTILRKG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   V  +P+N+   HYCG C+F
Sbjct  379   CEKLGLDVTTVPRNSTDKHYCGSCSF  404


 Score = 80.9 bits (198),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 91/169 (54%), Gaps = 9/169 (5%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGT  193
            ++   +   S S ++ LSA+C   LP +       +  L      ++ +FF++S  S   
Sbjct  15   KHGNVSHGFSQSDLQALSAICEAILPPVPLQSLDLDMKLKVLRSDALLSFFKSSPGSHIR  74

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ-FPFLLRFPEISQKK  370
            P +VA ++  +     +  + ++L  L+ R+GTLLLCG  SL  + +PFLL+F +IS +K
Sbjct  75   PDEVAELLATKAIPVTVKVVRVVLRILTFRLGTLLLCGLVSLDKENWPFLLKFSDISLEK  134

Query  371  RERIVHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            RE+++  W T       R  F  +KA+ L  +FT  ++  +NP+W AIG
Sbjct  135  REKVLQRWNTQWYNPLARLGFMMIKAIFLFYYFTWTNENTENPAWDAIG  183



>ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
 sp|Q9LW56.1|FAO3_ARATH RecName: Full=Long-chain-alcohol oxidase FAO3; AltName: Full=Long-chain 
fatty alcohol oxidase 3 [Arabidopsis thaliana]
 gb|AAK32839.1|AF361827_1 AT3g23410/MLM24_23 [Arabidopsis thaliana]
 dbj|BAB02285.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO11629.1| At3g23410/MLM24_23 [Arabidopsis thaliana]
 gb|AEE76762.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
Length=746

 Score =   165 bits (417),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 132/206 (64%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +   E+ +   L   G   A       +  I+CD VVVGSG GGGV + VL
Sbjct  193   PLEKGIVETMEETEQTLLESLAHKGLE-AVLDTEHDAIRIKCDVVVVGSGSGGGVAASVL  251

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKG+Y+  +     EGP +DK++  GG+L + D   ++LAG+TVGGGSAV
Sbjct  252   AKSGLKVVVLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSFMVLAGATVGGGSAV  311

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   + LFG+  Y  AM+ V  +MGV  +CE ESFQN +LRKG
Sbjct  312   NWSACIKTPKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEKCELESFQNQILRKG  371

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L + V N+P+N+   HYCG C +
Sbjct  372   CENLGFNVENVPRNSSESHYCGSCGY  397


 Score = 82.8 bits (203),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 92/164 (56%), Gaps = 15/164 (9%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAIN---EALPETTD-----ASVTNFFQTSAASTGTPHQVAWV  214
            ++ ++ME+L++ C   LP++    E L    D      ++ +F+ TS + T    Q   +
Sbjct  15   ITVAEMESLASFCEAVLPSVQPPPEELSGEGDNHRNKEALRSFYSTSGSKTPVLRQSIEL  74

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH--  388
            + +R       +  L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S +KRER++   
Sbjct  75   VTKRGTIEAYIATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQ  134

Query  389  --SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              +W    L  IR  F  +K   L  FF+ V+  G+NP+W+AIG
Sbjct  135  FKNWI---LTPIRAAFVYIKVAFLFCFFSRVNPNGENPAWEAIG  175



>ref|XP_006296686.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
 gb|EOA29584.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
Length=744

 Score =   168 bits (426),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 134/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +N  EE +   L +  C          +  I+CDAVVVGSG GGGV + VL
Sbjct  191   PLEKGIVETMNETEETLLESLAR-KCLQTDHDVDNDAIRIKCDAVVVGSGSGGGVAASVL  249

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKG+YY  +     EGP MDK++  GG+L + D ++++LAG+TVGGGSAV
Sbjct  250   AKSGLKVVVLEKGSYYTPSEYLPFEGPGMDKLYENGGILPSVDGNIMVLAGATVGGGSAV  309

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   +  FG+  Y  AM+ V  +MGV  +CE ES QN VLRKG
Sbjct  310   NWSACIKTPKTVLQEWSEDQKIPFFGTKEYVLAMEAVWERMGVTEKCEMESLQNQVLRKG  369

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L + V N+P+N+   HYCG C +
Sbjct  370   CENLGFNVENVPRNSSEKHYCGSCGY  395


 Score = 79.3 bits (194),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 92/175 (53%), Gaps = 15/175 (9%)
 Frame = +2

Query  23   HRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDAS-------VTNFFQTSAA  181
            HR +      + ++ ++METL++ C   LP +     E +  S       + +F+ TS +
Sbjct  4    HR-IAGKYGLRDITAAEMETLASFCEAVLPPVPPPPEEISGDSNHRNKEALRSFYSTSGS  62

Query  182  STGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEIS  361
             T    Q   +I +R          L+L+ L+TRIGTLL+CG   L +++PF+ +F E+S
Sbjct  63   QTPVLRQSIELITKRGTIEAYLVTRLILFLLATRIGTLLICGTECLVSRWPFVEKFSELS  122

Query  362  QKKRERIVH----SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +KRER++     +W    L  +R  F  +K  +L  FF+ V   G+N +W+AIG
Sbjct  123  LEKRERVLQKQFRNWF---LTPVRAGFVYIKVAILFCFFSRVSPNGENSAWEAIG  174



>ref|XP_002883430.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59689.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
Length=743

 Score =   164 bits (416),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +   E+ +   L + G   A       +  I+CDAVVVGSG GGGV + VL
Sbjct  192   PLEKGIVETMEETEQTLLELLAQKGLE-ADLDTVHDAIRIKCDAVVVGSGSGGGVAASVL  250

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKG+Y+  ++    EGP +DK++  GG+L + D ++++LAG+TVGGGSAV
Sbjct  251   AKSGLKVVVLEKGSYFTPSDYRPFEGPGLDKLYENGGILPSVDGNLMVLAGATVGGGSAV  310

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   + LF +  Y  AM+ V  +MGV  +CE ESFQN VLRKG
Sbjct  311   NWSACIKTPKSVLQEWSEDQNIPLFATKEYVSAMEVVWERMGVTDKCEMESFQNQVLRKG  370

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V N+P+N+   HYCG C +
Sbjct  371   CQNLGVNVENVPRNSSESHYCGSCGY  396


 Score = 82.8 bits (203),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 92/173 (53%), Gaps = 14/173 (8%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAAST  187
            K+      + ++ ++ME+L++ C   LP +       +E        ++ +F+ TS + T
Sbjct  5    KVAGKFGLRDITEAEMESLASFCEAVLPPVLPPEEVSSEGDNHRNKEALRSFYSTSGSQT  64

Query  188  GTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  367
                Q   +I +R       +  L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S +
Sbjct  65   PVLRQSIELITKRGTIEAYLATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLE  124

Query  368  KRERIVH----SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            KRER++     +W    L  IR  F  +K   L  FF+ V   G+NP+W+AIG
Sbjct  125  KRERVLQKQFRNWF---LTPIRAAFVYIKVAFLFCFFSRVTPDGENPAWEAIG  174



>gb|EYU18303.1| hypothetical protein MIMGU_mgv1a001896mg [Erythranthe guttata]
Length=742

 Score =   150 bits (380),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 127/206 (62%), Gaps = 1/206 (0%)
 Frame = +3

Query  606   PLYKGIIDLNL-PEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+  L  +  +   L   G           ++ ++CDAV+VGSGCGGGV + VL
Sbjct  199   PLDKGIIETRLETDSSLAAALAGKGLKPTLNPASRDTYTVKCDAVIVGSGCGGGVAAAVL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+VLEKG+Y+   + S LEGPS+D+++  GG+L T D   +LLAGSTVGGGSAV
Sbjct  259   AAAGLKVVVLEKGDYFTAGDYSSLEGPSLDRLYESGGILSTLDGKTMLLAGSTVGGGSAV  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA  KTP +++ +W     L LF    Y  AMD VC ++GV   C  E FQN +LR+G
Sbjct  319   NWSACFKTPDHIINDWAHGQNLPLFSGPEYLDAMDKVCDRIGVTVGCTKEGFQNQILRQG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L      +P+N+   HYCG C +
Sbjct  379   CENLGLKADPVPRNSSESHYCGSCCY  404


 Score = 96.3 bits (238),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 91/156 (58%), Gaps = 7/156 (4%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI-----NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  226
            S SQ++TL+++C   LP       +E +    D  V  F++ SA+    P +VA ++ +R
Sbjct  25   SSSQIQTLTSICEVLLPPTPLNNPHENINPQNDV-VQAFYKASASQYPVPDEVAELVMKR  83

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS-  403
                    ++ ++  LSTR+GTLL+CG   +S ++PFL +F EI  + RE++V  W T+ 
Sbjct  84   AFFEAKILVIAIVRILSTRVGTLLICGSSGVSKKWPFLKKFSEIPLENREKVVQKWFTNW  143

Query  404  SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
             L  +R  F  +K LVLLVFFT V +   NP+WKA+
Sbjct  144  LLTPVRLAFVFLKFLVLLVFFTQVGEDSSNPAWKAM  179



>ref|XP_010532671.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=741

 Score =   163 bits (412),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 133/211 (63%), Gaps = 12/211 (6%)
 Frame = +3

Query  606   PLYKGII------DLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  767
             PL KG++      D  LPE      L++ G  V       P   I+CD V++GSG GGGV
Sbjct  192   PLEKGMVETVKETDSTLPES-----LSEKGLEVTSGSNHDP-IKIKCDVVIIGSGSGGGV  245

Query  768   isgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  947
              + VLA++  KV++LEKG Y+A +  S  EG   D+++  GG+L T D + +++AG+TVG
Sbjct  246   AAAVLASSDLKVVILEKGRYFAPSEYSPFEGHGFDQLYESGGVLPTLDGNAMIIAGATVG  305

Query  948   GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNM  1127
             GGSAV+WSA IKTP  VL+EW + H +  FG+  Y  AMD VC ++GV   C +ESFQN 
Sbjct  306   GGSAVSWSACIKTPESVLQEWVKDHRIPFFGTQEYVSAMDAVCKRIGVTYRCNEESFQNQ  365

Query  1128  VLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             VLRKGC  L   V N+P+N+  +HYCG C +
Sbjct  366   VLRKGCHNLGLKVENVPRNSSENHYCGSCCY  396


 Score = 84.3 bits (207),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 88/154 (57%), Gaps = 7/154 (5%)
 Frame = +2

Query  71   QMETLSALCNTFLPAINEALPETTD------ASVTNFFQTSAASTGTPHQVAWVINQRMK  232
            +ME+L+A+C T LP ++     T +       ++ +F+  S + +   HQ A +I +R  
Sbjct  20   EMESLAAVCETILPPLSPEYSNTDEDDHPNKEALRSFYSGSGSQSHVLHQAAELITKRGL  79

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-L  409
               +  + L+L  LS+R+GTL+LCG   L   +PF+ RF  +S +KRER++  W  S  L
Sbjct  80   IEVVLVMRLVLVLLSSRLGTLVLCGTHCLVPNWPFVERFGSLSLEKRERVLQKWFRSKIL  139

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
              IR  F  +K + L  FF+ V+  G+NP+W+AI
Sbjct  140  AAIRVAFVHIKIVFLFCFFSWVNTNGENPAWEAI  173



>ref|XP_010529119.1| PREDICTED: long-chain-alcohol oxidase FAO3-like, partial [Tarenaya 
hassleriana]
Length=660

 Score =   163 bits (412),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 133/211 (63%), Gaps = 12/211 (6%)
 Frame = +3

Query  606   PLYKGII------DLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  767
             PL KG++      D  LPE      L++ G  V       P   I+CD V++GSG GGGV
Sbjct  192   PLEKGMVETVKETDSTLPES-----LSEKGLEVTSGSNHDP-IKIKCDVVIIGSGSGGGV  245

Query  768   isgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  947
              + VLA++  KV++LEKG Y+A +  S  EG   D+++  GG+L T D + +++AG+TVG
Sbjct  246   AAAVLASSDLKVVILEKGRYFAPSEYSPFEGHGFDQLYESGGVLPTLDGNAMIIAGATVG  305

Query  948   GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNM  1127
             GGSAV+WSA IKTP  VL+EW + H +  FG+  Y  AMD VC ++GV   C +ESFQN 
Sbjct  306   GGSAVSWSACIKTPESVLQEWVKDHRIPFFGTQEYVSAMDAVCKRIGVTYRCNEESFQNQ  365

Query  1128  VLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             VLRKGC  L   V N+P+N+  +HYCG C +
Sbjct  366   VLRKGCHNLGLKVENVPRNSSENHYCGSCCY  396


 Score = 84.0 bits (206),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 88/154 (57%), Gaps = 7/154 (5%)
 Frame = +2

Query  71   QMETLSALCNTFLPAINEALPETTD------ASVTNFFQTSAASTGTPHQVAWVINQRMK  232
            +ME+L+A+C T LP ++     T +       ++ +F+  S + +   HQ A +I +R  
Sbjct  20   EMESLAAVCETILPPLSPEYSNTDEDDHPNKEALRSFYSGSGSQSHVLHQAAELITKRGL  79

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-L  409
               +  + L+L  LS+R+GTL+LCG   L   +PF+ RF  +S +KRER++  W  S  L
Sbjct  80   IEVVLVMRLVLVLLSSRLGTLVLCGTHCLVPNWPFVERFGSLSLEKRERVLQKWFRSKIL  139

Query  410  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
              IR  F  +K + L  FF+ V+  G+NP+W+AI
Sbjct  140  AAIRVAFVHIKIVFLFCFFSWVNTNGENPAWEAI  173



>gb|KJB10007.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=665

 Score =   177 bits (448),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 135/203 (67%), Gaps = 2/203 (1%)
 Frame = +3

Query  615   KGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATA  791
             KGII+    ++  F   LT+ G  V +  P    F I+CD V+VGSGCGGGV + VLA++
Sbjct  121   KGIIETMHEDDSTFVQSLTEKGLQVTE-DPDHNVFNIKCDVVIVGSGCGGGVAAAVLASS  179

Query  792   GYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWS  971
             G KV+V+EKGNY+A T+ + LEGPSM +++  GG L T +   +++AGSTVGGGSA+NWS
Sbjct  180   GQKVVVIEKGNYFATTDYTSLEGPSMSELYEYGGFLTTTNGKFMIMAGSTVGGGSAINWS  239

Query  972   ASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRE  1151
             ASIKTP  VL+EW   H + LFGS  Y  AMD V  ++GV   C +E  QN VLRKGC  
Sbjct  240   ASIKTPNNVLKEWSLDHKIPLFGSSEYENAMDAVYQRLGVTENCTEEGLQNQVLRKGCEN  299

Query  1152  LCYPVVNIPQNAPSDHYCGWCTF  1220
             L   V  +P+N+P DHYCG C  
Sbjct  300   LGLKVEAVPRNSPEDHYCGSCNL  322


 Score = 70.1 bits (170),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = +2

Query  275  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI--RNFFTAMKAL  448
            S R+G LLLCG      ++PF+ +F E+  ++RE+I+  W+++    +  R  F  +K  
Sbjct  23   SFRLGALLLCGWDCCDWKWPFIHKFSELPVERREKILMKWSSNGHHRLPLRAVFALIKTY  82

Query  449  VLLVFFTSVDDKGDNPSWKAIG  514
             L +FF+  D+K +NPSWKAIG
Sbjct  83   CLFIFFSMTDEKSENPSWKAIG  104



>ref|XP_006412936.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54389.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=756

 Score =   187 bits (476),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 135/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  GII+     +  +   L + G  VA+    G    I CDAV+VGSG GGGV +  L
Sbjct  203   PLEAGIIETKHETDITITQSLIEKGVHVARDDDNGV-HRIRCDAVIVGSGSGGGVAAANL  261

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+A  + S LEGPSM +++  GGL+ T D   ++LAGSTVGGG+AV
Sbjct  262   AKAGLKVLVLEKGNYFAAQDYSALEGPSMQELYEKGGLMTTVDGKFMILAGSTVGGGTAV  321

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   +E FGS  Y  AMD V  ++GV   C  E FQN VLR+G
Sbjct  322   NWSASIRTPDHVLQEWSERSKIEFFGSQEYQSAMDEVTRRIGVTERCVKEGFQNQVLREG  381

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   VV++P+N+P DHYCG C +
Sbjct  382   CERLGLKVVSVPRNSPEDHYCGSCGY  407


 Score = 58.9 bits (141),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 79/165 (48%), Gaps = 3/165 (2%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQV  205
            +K +        S SQ+++L+ +C T LP           A + +F   S A      +V
Sbjct  18   KKRQGGYYNHGFSSSQIQSLAVICQTLLPPPPPVTTTEQQA-LDSFNVASRAQPPFSDEV  76

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
            A +I +  +   +  L ++L  LS R GTLLLCG   L   +PF+ +F E+   KRE ++
Sbjct  77   AEMIVKNGRSQAVKILRIILTILSFRFGTLLLCGSLCLDKDWPFVHKFSELPLDKREEVL  136

Query  386  HSWATSS--LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              W+  S  L  +R  F   K   L  FF+  D+   NP+ +AIG
Sbjct  137  RKWSRQSGFLLPLRITFFLTKFYTLFYFFSQTDENLKNPALEAIG  181



>ref|XP_008382898.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2 
[Malus domestica]
Length=674

 Score =   172 bits (437),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+     +      LTK G  +A          I+CD V+VGSGCGGGV + VL
Sbjct  125   PLEKGIIETAYESDSTLVESLTKKGLDLADD-AVNNIHKIKCDVVIVGSGCGGGVAAAVL  183

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKGNY+   + S LEGPSM++++  GG+L + D  +++LAGSTVGGGSAV
Sbjct  184   AQSGQKVVVLEKGNYFVPKDYSSLEGPSMNELYESGGILSSVDGMVMILAGSTVGGGSAV  243

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  VLR+W   H + L+ S+ Y  AMD VC ++GV   C +E+F N +LRKG
Sbjct  244   NWSASIKTPDNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTESCTEENFPNQILRKG  303

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P N+ +DHYCG+C +
Sbjct  304   CENLGLKVDAVPXNSSADHYCGFCNY  329


 Score = 73.6 bits (179),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  275  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  451
            S R+GT LLCGK     ++PF+ +F E+S  KRE+++  W+   L   IR  F  +K   
Sbjct  28   SLRLGTFLLCGKCCFDWKWPFIHKFAEMSLDKREQVLKKWSRQKLVITIRLMFMVVKMFC  87

Query  452  LLVFFTSVDDKGDNPSWKAIGVLWSRPFHF*KT  550
               FF+ VD+   NP+WKAIG    R     KT
Sbjct  88   FYTFFSRVDENSRNPAWKAIGYELDRKEKLIKT  120



>gb|EEC67160.1| hypothetical protein OsI_34014 [Oryza sativa Indica Group]
Length=710

 Score =   170 bits (430),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 134/205 (65%), Gaps = 2/205 (1%)
 Frame = +3

Query  609   LYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLA  785
             L  G+++   L +  +   L   G SV +P        + CDAV+VGSGCGGGV + VLA
Sbjct  213   LDNGVVETRALTDTTLLRSLAAKGLSV-RPGASDEHHTVRCDAVIVGSGCGGGVAAAVLA  271

Query  786   TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVN  965
             +AGYKV+V+EKG+Y+ + + S +EGPSM+++F  GG+  T ++  ++  G+TVGGGSAVN
Sbjct  272   SAGYKVVVVEKGDYFTKEDYSSIEGPSMERLFERGGVFCTSNVTTMIFTGATVGGGSAVN  331

Query  966   WSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGC  1145
             WSASI+TP  V++EW   HGL +F S  Y +AMD VC ++GV   C +E FQN V+R+GC
Sbjct  332   WSASIRTPAGVMQEWSREHGLAVFASPGYARAMDAVCERLGVTDACREEGFQNKVVRRGC  391

Query  1146  RELCYPVVNIPQNAPSDHYCGWCTF  1220
               L      +P+N+   H+CG C F
Sbjct  392   DGLGLRADAVPRNSSEGHFCGSCNF  416


 Score = 76.3 bits (186),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 87/172 (51%), Gaps = 14/172 (8%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAI------NEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  220
            + P+QME L A+C   +P++       E      D  +  F+  SAA +  P +VA ++ 
Sbjct  21   MHPAQMEALRAMCGALIPSLPVDADGGEGGRRPGDKDLERFYLASAADSSIPDEVAELLV  80

Query  221  QRMKHPKlnslllllwflSTRIGTLLLCGKGSLST----QFPFL--LRFPEISQKKRERI  382
             R     +    ++LW LSTR GTLLLCG+ S++      FPF+   RF ++   +RE  
Sbjct  81   TRCIWEAVALTWVVLWALSTRAGTLLLCGRDSVAAVDGGGFPFVSVRRFADMPAARREAA  140

Query  383  VHSWATSSLQF--IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            +  W+ +   F  +R  F   K L   VF++ V++  +NP WKAIG     P
Sbjct  141  LRRWSGARWLFFPLRIAFAIAKILCHYVFYSMVNENSENPYWKAIGYRVEEP  192



>gb|KHG12235.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=748

 Score =   170 bits (430),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 140/211 (66%), Gaps = 11/211 (5%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR------LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  767
             PL +GI++      HV +       LT+ G  V +  P   +  I+CDAV+VGSGCGGGV
Sbjct  200   PLQQGIVETM----HVIDSIDLHKLLTEKGLQVTQ-DPHKNAIKIKCDAVIVGSGCGGGV  254

Query  768   isgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  947
              +  LA++G KV+VLEKG+Y+   + S  EGPSM+K++  GG L + D    +LAGSTVG
Sbjct  255   AAATLASSGLKVVVLEKGSYFGPADYSPFEGPSMEKLYELGGSLPSIDGQFAILAGSTVG  314

Query  948   GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNM  1127
             GGSAVNWSA IKTP  VL+EW +   + +FGS+ Y  AMD VC ++GV  +CE+E FQN+
Sbjct  315   GGSAVNWSACIKTPESVLKEWTDECKIPVFGSNEYVSAMDIVCERIGVTEDCEEEGFQNL  374

Query  1128  VLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             VL KGC+ L + +  +P+N+ S HYCG C F
Sbjct  375   VLCKGCKNLGFDIEKVPRNSSSRHYCGSCGF  405


 Score = 75.9 bits (185),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 90/177 (51%), Gaps = 20/177 (11%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAAS  184
             ++E        S +++ TL+A+     P++            +T   +V +F +TSA+ 
Sbjct  16   EEIEGKKYDHGFSSAEVNTLAAIAEALFPSLPPSSCCFERRENQTISKAVRSFMETSASQ  75

Query  185  TGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  364
            +  P + A ++ +R+    +  + ++L  LST++GTLLLCG      ++P++  F  +  
Sbjct  76   SPFPDEAAEMLWKRLFIECVVVVRVVLLLLSTKVGTLLLCGSHCWGKEWPYINGFTSMPL  135

Query  365  KKRERIVHSWATSSLQFIRNFFT-------AMKALVLLVFFTSVDDKGDNPSWKAIG  514
             KRE+++ +W      F   FFT         K  +L + F+ VD+ G+NP+W+AIG
Sbjct  136  AKREQVLQAW------FKHRFFTPFRVAFLYFKVAILFIIFSRVDENGENPAWEAIG  186



>emb|CDY51703.1| BnaA03g58930D [Brassica napus]
Length=737

 Score =   179 bits (453),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 133/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+  N  +  +   LT+ G  VA+         I CD V+VGSG GGGV +  L
Sbjct  190   PLEKGIIETKNESDVTIRQSLTQKGVHVARDDNDNI-HRIRCDVVIVGSGSGGGVAAANL  248

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+   + S LEGPSM +++  G L+ T D   ++LAGSTVGGG+AV
Sbjct  249   AKAGLKVLVLEKGNYFTSRDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTVGGGTAV  308

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   +E FGS  Y  AMD V  ++GV   C  E  QN VLR+G
Sbjct  309   NWSASIRTPDHVLKEWSEESKIEFFGSQEYQLAMDEVVRRLGVTERCVKEGLQNQVLREG  368

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   VV++P+N+P DHYCG C +
Sbjct  369   CERLGLEVVSVPRNSPEDHYCGSCGY  394


 Score = 67.0 bits (162),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 76/153 (50%), Gaps = 2/153 (1%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  241
            S SQ++TLS +C T LP            +V +F   S +      +VA +I +  +   
Sbjct  21   SISQIQTLSFICQTLLPPPPPPESTAEQEAVDSFNVASGSQPPFTDEVAEMIVKNGRSEA  80

Query  242  lnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF--  415
            +  L ++L  LS R GTL LCG   L+  +PF+L+F ++   KRE I+  W+  S  F  
Sbjct  81   VKVLRIILTILSYRFGTLFLCGSLCLAKDWPFVLKFSDLPLDKREEILRMWSRQSGLFLP  140

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +R  F   K   L  FF+  D    NP+ +AIG
Sbjct  141  LRITFFLAKFYTLFSFFSQRDQNMKNPALEAIG  173



>ref|XP_009102621.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Brassica rapa]
Length=745

 Score =   165 bits (417),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +   E+ +   LT+ G    +      +  I+CDAVVVGSG GGGV + VL
Sbjct  192   PLEKGVVETMKETEQTLLESLTQKGL---EADTDHDAIRIKCDAVVVGSGSGGGVAASVL  248

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+V+EKG+YY  ++    EG  M+K++  GG+L + D  +++LAG+TVGGGSAV
Sbjct  249   AKAGLKVIVMEKGSYYTESDYPPFEGHGMEKLYENGGILPSIDGCLMILAGATVGGGSAV  308

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E H + LFG+  Y  AMD V  +MGV   CE E FQN VLRKG
Sbjct  309   NWSACIKTPKSVLQEWSEDHKIPLFGTKEYVSAMDLVWKRMGVTETCEKEGFQNQVLRKG  368

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V N+ +N+   HYCG C +
Sbjct  369   CENLGINVQNVARNSSEKHYCGSCGY  394


 Score = 80.5 bits (197),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 90/169 (53%), Gaps = 14/169 (8%)
 Frame = +2

Query  41   NTATKTLSPSQMETLSALCNTFLPAI---NEALPET----TDASVTNFFQTSAASTGTPH  199
            N   + ++ ++ME+L++ C   LP +    E L E        ++ +F+ T  + T    
Sbjct  9    NFGHREVTAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVAR  68

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            Q   +I +R       +  L+L+ L+TR+GTLL+CG   L + +PF+ +F E++ +KRER
Sbjct  69   QTIDLIIKRGTMEAYLATRLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELTLEKRER  128

Query  380  IVH----SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++     +W    L  IR  F  +K   L  FF+ V   G+NP+W+AIG
Sbjct  129  VLQKQFRNWF---LTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIG  174



>emb|CDX77517.1| BnaA07g06550D [Brassica napus]
Length=540

 Score =   164 bits (415),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +   E+ +   LT+ G    +      +  I+CDAVVVGSG GGGV + VL
Sbjct  192   PLEKGVVETMKETEQTLLESLTQKGL---EADTDHDAIRIKCDAVVVGSGSGGGVAASVL  248

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+V+EKG+YY  ++    EG  M+K++  GG+L + D  +++LAG+TVGGGSAV
Sbjct  249   AKAGLKVIVMEKGSYYTESDYPPFEGHGMEKLYENGGILPSIDGCLMILAGATVGGGSAV  308

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E H + LFG+  Y  AMD V  +MGV   CE E FQN VLRKG
Sbjct  309   NWSACIKTPKSVLQEWSEDHKIPLFGTKEYVSAMDLVWKRMGVTETCEKEGFQNQVLRKG  368

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V N+ +N+   HYCG C +
Sbjct  369   CENLGINVQNVARNSSEKHYCGSCGY  394


 Score = 80.9 bits (198),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 89/166 (54%), Gaps = 8/166 (5%)
 Frame = +2

Query  41   NTATKTLSPSQMETLSALCNTFLPAI---NEALPET----TDASVTNFFQTSAASTGTPH  199
            N   + ++ ++ME+L++ C   LP +    E L E        ++ +F+ T  + T    
Sbjct  9    NFGHREVTAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVAR  68

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            Q   +I +R       +  L+L+ L+TR+GTLL+CG   L + +PF+ +F E++ +KRER
Sbjct  69   QTIDLIIKRGTMEAYLATRLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELTLEKRER  128

Query  380  IVHS-WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++   +    L  IR  F  +K   L  FF+ V   G+NP+W+AIG
Sbjct  129  VLQKQFRNWFLTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIG  174



>ref|XP_002464495.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
 gb|EER91493.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
Length=774

 Score =   171 bits (432),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 132/205 (64%), Gaps = 2/205 (1%)
 Frame = +3

Query  606   PLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSF-VIECDAvvvgsgcgggvisgv  779
             PL  GI++   L +  +   L   G  V    PP  ++  + CD V+VGSGCGGGV + V
Sbjct  220   PLDNGIVETKALDDTALLTSLMARGLEVKPAAPPANAYHTVRCDVVIVGSGCGGGVAAAV  279

Query  780   LATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSA  959
             LA+AG+KV+V+EKG+Y+   + S +EGPSM++++  GG+  T ++  +L  G+TVGGGSA
Sbjct  280   LASAGHKVVVIEKGDYFTAEDYSSVEGPSMERLYEKGGIFCTTNVTTILFTGTTVGGGSA  339

Query  960   VNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRK  1139
             +NWSASI+TP  V +EW   HGL +F S  Y +AMD VC ++ V   C DE FQN V+R+
Sbjct  340   INWSASIRTPEEVRQEWAREHGLPVFASPGYVQAMDAVCARLAVTDGCRDEGFQNKVVRR  399

Query  1140  GCRELCYPVVNIPQNAPSDHYCGWC  1214
             GC  L      +P+N+  DH+CG C
Sbjct  400   GCEALALRADAVPRNSSEDHFCGSC  424


 Score = 74.3 bits (181),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 95/183 (52%), Gaps = 19/183 (10%)
 Frame = +2

Query  14   YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASV-------------  154
            + L R       T  L  +QME L A+C   +P++   LP  T+ S+             
Sbjct  18   HPLLRGCRRERYTHGLHLAQMEALRAMCGALIPSL--PLPPVTERSLHGDSSDGGERKDL  75

Query  155  TNFFQTSAASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLST-QF  331
              F+  SAA    P +VA ++  R     +  + ++LW LST++GTL LCG+  +S  +F
Sbjct  76   ERFYLASAADGTIPEEVAELVT-RCVWEAVVLVNVVLWILSTKVGTLALCGRLCISGGKF  134

Query  332  PFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGD-NPSWK  505
            P++ +F ++  ++RE+ +  W  +   F ++  F  +K L    F+T++++  D NPSWK
Sbjct  135  PYVRKFADMPVERREQALTQWNRTRWLFPLKITFVVVKILSHYAFYTTINENSDDNPSWK  194

Query  506  AIG  514
            AIG
Sbjct  195  AIG  197



>ref|XP_006283182.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
 gb|EOA16080.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
Length=754

 Score =   172 bits (436),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 135/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +GI++ ++  +  +   LT+ G  VAK         I CDAVVVGSG GGGV +  L
Sbjct  203   PLQRGIVETMHESDITITQTLTEKGVYVAKDDGENV-HRIRCDAVVVGSGSGGGVAAANL  261

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+A  + S LEGPSM +++  GG L + D   ++LAGS VGGG+A+
Sbjct  262   AKAGLKVLVLEKGNYFAAQDYSGLEGPSMLELYEKGGFLTSVDGKFMILAGSAVGGGTAI  321

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   ++ FGS  Y  AMD V  ++GV  +C  + FQN VLRKG
Sbjct  322   NWSASIRTPDHVLQEWSEESKIKFFGSQEYKTAMDEVTTRIGVTDKCVKDGFQNQVLRKG  381

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+  DHYCG C +
Sbjct  382   CERLGLQVESVPRNSHEDHYCGLCGY  407


 Score = 72.8 bits (177),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 82/156 (53%), Gaps = 15/156 (10%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTP--HQVAWVINQRMKH  235
            SPSQ+ +L+A+C T LP         +D    + F   A+ST  P   +VA +I +  + 
Sbjct  36   SPSQIHSLAAICQTLLPP--------SDQQSFDSFNV-ASSTQPPFTDEVAEMIVKNGRS  86

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---  406
              +  L ++L  LS R GTLLLCG   L   +PF+L+F E+   +RE I+  W+  S   
Sbjct  87   EAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRREEILRKWSRKSGFL  146

Query  407  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            L F   FF + K   L  FF+  D+   NP+ +AIG
Sbjct  147  LPFRITFFLS-KFYTLFYFFSQTDENQKNPALEAIG  181



>gb|KJB38384.1| hypothetical protein B456_006G252500 [Gossypium raimondii]
Length=748

 Score =   167 bits (423),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 138/211 (65%), Gaps = 11/211 (5%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR------LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  767
             PL +GI++      HV +       LT+ G  V +  P   +  I+CDAV+VGSGCGGGV
Sbjct  200   PLQQGIVETM----HVIDSIDLHKLLTEKGLQVTQ-DPHKNAIKIKCDAVIVGSGCGGGV  254

Query  768   isgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  947
              +  LA++G KV+VLEKG Y+   + S  EGPSM+K++  GG L + D    +LAGSTVG
Sbjct  255   AAATLASSGLKVVVLEKGCYFGPADYSPFEGPSMEKLYELGGSLPSIDGQFAILAGSTVG  314

Query  948   GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNM  1127
             GGSAVNWSA IKTP  VL+EW +   + +FGS+ Y  AMD VC ++GV  +CE+E FQN 
Sbjct  315   GGSAVNWSACIKTPESVLKEWTDECKIPVFGSNEYVSAMDIVCERIGVTEDCEEEGFQNQ  374

Query  1128  VLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             VL KGC+ L + +  +P+N+ S HYCG C F
Sbjct  375   VLCKGCKNLGFDIEKVPRNSSSRHYCGSCGF  405


 Score = 77.4 bits (189),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 90/177 (51%), Gaps = 20/177 (11%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAAS  184
             ++E        S +++ TL+A+     P++            +T   +V +F +TSA+ 
Sbjct  16   EEIEGKKYDHGFSSAEVNTLAAIAEALFPSLPPSSCCFERRENQTISKAVRSFMETSASQ  75

Query  185  TGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  364
            + TP + A ++ +R+    +  + ++L  LST++GTLLLCG      ++P++  F  +  
Sbjct  76   SPTPDEAAEMLWKRLFIECVVVVRVVLLLLSTKVGTLLLCGSHCWGKEWPYINGFTSMPL  135

Query  365  KKRERIVHSWATSSLQFIRNFFT-------AMKALVLLVFFTSVDDKGDNPSWKAIG  514
             KRE+++ +W      F   FFT         K  +L   F+ VD+ G+NP+W+AIG
Sbjct  136  AKREQVLQAW------FKHRFFTPFRVAFLYFKVAILFTIFSRVDENGENPAWEAIG  186



>gb|KFK29401.1| hypothetical protein AALP_AA7G128800 [Arabis alpina]
Length=745

 Score =   172 bits (437),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 132/206 (64%), Gaps = 4/206 (2%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  GII+     +    + L + G  VA+         I CDAVVVGSG GGGV +  L
Sbjct  192   PLESGIIETKHENDITITKSLIEKGLHVARDDNV---HRIRCDAVVVGSGSGGGVAAANL  248

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG+KV+VLEKGNY+A  + S LE PSM +++   GLL T D   ++LAGSTVGGG+AV
Sbjct  249   AKAGFKVVVLEKGNYFAAQDYSGLEAPSMLELYEKSGLLTTIDGKFMILAGSTVGGGTAV  308

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   L+ FGS  Y  AMD V  ++GV   C  + FQN +LRKG
Sbjct  309   NWSASIRTPDHVLQEWSEESKLKFFGSQEYQSAMDEVTRRIGVTERCVKDGFQNQILRKG  368

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+P DHYCG C +
Sbjct  369   CERLGLEVDSVPRNSPDDHYCGSCGY  394


 Score = 72.0 bits (175),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 83/168 (49%), Gaps = 10/168 (6%)
 Frame = +2

Query  20   LHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPH  199
            L  K      +   S SQ+++L+ +C T LP      P +  A   +F   S +      
Sbjct  13   LRSKKREGGYSHGFSHSQIQSLAVICQTLLP------PPSQQAINDSFKVASGSQPPFTD  66

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            +VA +I +  +   +  L ++L  LS R+GTLLLCG   L   +PF+L+F ++    RE 
Sbjct  67   EVADMIVKNGRGEAVKVLRIILMILSFRLGTLLLCGSLCLDKNWPFVLKFSQLPLDTREE  126

Query  380  IVHSWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            I+  W+T S   L F   FF A K   L  FF+  D+   NP+ +AIG
Sbjct  127  ILRKWSTQSGFLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIG  173



>ref|XP_004982884.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=764

 Score =   155 bits (392),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 129/204 (63%), Gaps = 2/204 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  G+++  +L +  +   L   G +V K    GP   ++CD V+VGSGCGGGV + VL
Sbjct  214   PLDSGVVETRSLDDAALLRSLMDKGLAV-KADVSGPHHTVQCDVVIVGSGCGGGVAAAVL  272

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG+KV+V+EKG+Y+   + S +EGPSM++++  GG+  T +   ++  G+TVGGGSA+
Sbjct  273   AAAGHKVVVVEKGDYFTAEDYSSIEGPSMERLYEKGGIFCTSNASTIMFTGATVGGGSAI  332

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +V +EW   HGL +FGS  Y  AMD VC ++ V   C +E FQN  LR G
Sbjct  333   NWSASIRTPEWVTQEWAREHGLPVFGSPEYAHAMDAVCTRLAVTSGCREEGFQNKALRNG  392

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C  L      +P+N    H+CG C
Sbjct  393   CEALGLRADAVPRNTSEGHFCGSC  416


 Score = 89.0 bits (219),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 94/173 (54%), Gaps = 9/173 (5%)
 Frame = +2

Query  20   LHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDA-------SVTNFFQTSA  178
            L R+ +    T  L P QME L A+C   +P++    P   D         V  F++ SA
Sbjct  19   LLRRCKRERYTHGLRPPQMEALRAMCGALIPSLPVEGPFHGDKHGGGNKDDVERFYRASA  78

Query  179  ASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEI  358
            A    P +VA +     +   +  + ++LW LST++GT +LCG   +S++FP++ +F ++
Sbjct  79   ADGAIPDEVAEMATGCARE-AMLLVRVILWMLSTKVGTFVLCGWLCVSSRFPYVFKFADM  137

Query  359  SQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              ++RE ++  W+ +   F ++  F  +K L    F+T++++  DNPSWKAIG
Sbjct  138  PLERREEVLKWWSKTRWLFPLKVTFVLVKILSHYSFYTTINEHSDNPSWKAIG  190



>ref|XP_009610950.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Nicotiana tomentosiformis]
Length=742

 Score =   164 bits (414),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +   E  V   L + G  V +       + ++CD V+VGSGCGGGV + VL
Sbjct  192   PLEKGIVETIYETESTVVKSLVQKGLKVIED-TKNNMYKVQCDVVIVGSGCGGGVAASVL  250

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKGNYY +++ S LEGPSM++M+  GG+L T +  ++++AGSTVGGGSA+
Sbjct  251   ASSGNKVIVLEKGNYYTKSDYSSLEGPSMNQMYESGGILSTLNAKIMIMAGSTVGGGSAI  310

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA +KTP  V++EW +   L +F S  Y   MD VC ++GV   C  E  QN +LRKG
Sbjct  311   NWSACLKTPDSVIQEWGDDKRLPIFQSPEYVSVMDKVCERIGVTENCTQEGLQNQILRKG  370

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  + +N+  +HYCG C +
Sbjct  371   CENLGLEVEGVARNSSENHYCGSCCY  396


 Score = 80.9 bits (198),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 83/154 (54%), Gaps = 4/154 (3%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  235
            S S+METL+++C T LP +  NE +PE    ++    + S +    P + A V+ +R   
Sbjct  23   SSSEMETLTSICETILPPLPQNE-IPENNSQNIQYLHRASGSQYPIPDECAEVVMKRGFS  81

Query  236  PKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQ  412
              +  L  LL  LSTR GTLLLCG      ++P++ +F +I  +KRE ++  W  +  L 
Sbjct  82   EAIILLRGLLRILSTRFGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQKWFKNRFLT  141

Query  413  FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +R  F  +K L L +FFT V +   N +W  IG
Sbjct  142  PVRLAFLFIKFLSLYIFFTQVGEDSKNQAWDDIG  175



>gb|KDP26499.1| hypothetical protein JCGZ_17657 [Jatropha curcas]
Length=659

 Score =   175 bits (444),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++L N  +  +   L + G  V +         I+CD V+VGSGCGGGV + VL
Sbjct  116   PLQKGIVELANEDDSTILQSLIEKGLEVTEDSEHKIC-KIKCDVVIVGSGCGGGVAAAVL  174

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KVLVLEKGNY+   + S LEGPSM +++  GG+L T +  +++LAGSTVGGGSA+
Sbjct  175   ASSGLKVLVLEKGNYFVAEDYSSLEGPSMAELYESGGILSTLNGKVMILAGSTVGGGSAI  234

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP YVLREW   H +  +GS  Y  AMD V  ++GV   C +ESFQN VLRKG
Sbjct  235   NWSACIRTPDYVLREWSLDHKIRFYGSSDYQYAMDAVSKRIGVTDNCLNESFQNQVLRKG  294

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++ +N+ +DHYCG C F
Sbjct  295   CENLGLKVESVARNSSADHYCGSCNF  320


 Score = 68.6 bits (166),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  281  RIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLL  457
            R+GTLLLCG       +PF  +F E+S KKRE I+  W+     F +R  F A++   L 
Sbjct  23   RLGTLLLCGFICFDWNWPFFHKFSELSVKKREEILLKWSRQKYIFPLRAAFVAVRIFCLY  82

Query  458  VFFTSVDDKGDNPSWKAIG  514
             FF+  D+  +NP+W+AIG
Sbjct  83   TFFSRTDENSENPAWEAIG  101



>emb|CDX94858.1| BnaC03g43300D [Brassica napus]
Length=741

 Score =   162 bits (411),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +   E+ +   L ++G    + +    +  I+CDAVVVGSG GGGV + VL
Sbjct  193   PLEKGMVETMQETEQTLLESLAQMGL---EAETDHDTIRIKCDAVVVGSGSGGGVAASVL  249

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+V+EKG+YY  +     EGP MDK++  GG+L T D +M++LAG+TVGGGSAV
Sbjct  250   AKAGLKVVVMEKGSYYTPSTYPSTEGPGMDKLYENGGILPTIDGNMMVLAGATVGGGSAV  309

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   + L+ +  Y  AM+ V  +MGV   CE E FQN VLRKG
Sbjct  310   NWSACIKTPKSVLQEWSEDRNIPLYATKEYVSAMELVWERMGVTETCELEGFQNQVLRKG  369

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V N+ +N+   HYCG C +
Sbjct  370   CENLGINVENVARNSSERHYCGSCGY  395


 Score = 80.1 bits (196),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 94/179 (53%), Gaps = 23/179 (13%)
 Frame = +2

Query  32   MENNTATKT-----LSPSQMETLSALCNTFLPAINEALPETTDA---------SVTNFFQ  169
            M N+T T       ++ ++ME+L + C   LP ++   PE   A         ++ +FF 
Sbjct  2    MGNHTDTGNFGHLGITTAEMESLGSFCEAVLPPVSP--PEEYSAGDDHCRNKEALRSFFS  59

Query  170  TSAASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRF  349
            TS + T    +   +I +R          L+L+ L+TR+GTLL+CG   L +++PF+ +F
Sbjct  60   TSGSRTPVVRESIELITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKF  119

Query  350  PEISQKKRERIVH----SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             E+S +KRER++     +W    L  IR  F  +K   L  FF+ V   G+NP+W+AIG
Sbjct  120  SELSLEKRERVLQKQFRNWI---LTPIRAAFVYIKVAFLFCFFSWVSPNGENPAWEAIG  175



>ref|XP_006418179.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
 gb|ESQ36532.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
Length=763

 Score =   164 bits (414),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 130/206 (63%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+    +E  +  RL   G  V + K    S+ IECDAVVVGSGCGGGV +  L
Sbjct  208   PLEKGIIETAKEDEMSIKQRLINKGLIVTEDKE-SDSYKIECDAVVVGSGCGGGVAAANL  266

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G +V++LEKGNY+   + S LEGPS  ++F    LLMT D     +AGSTVGGGS V
Sbjct  267   AKSGLRVVILEKGNYFVPRDYSALEGPSTFELFEAHSLLMTHDGRFRFMAGSTVGGGSVV  326

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NW+AS+KTP  ++ EW    G+ +F  + Y  AM+ VC ++GV  +   E FQN +LRKG
Sbjct  327   NWAASLKTPDAIINEWSVDRGIAIFAREEYTAAMERVCKRIGVTEKIIKEGFQNQILRKG  386

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   V  +P+N+   HYCG C+F
Sbjct  387   CEKLGLDVTVVPRNSSEKHYCGSCSF  412


 Score = 78.6 bits (192),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 90/165 (55%), Gaps = 10/165 (6%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGT-PHQV  205
            T   S S ++ LSA+C   +P +       +  L    + ++ +FF++S+  +   P +V
Sbjct  27   THGFSRSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFKSSSDQSHVRPDEV  86

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ-FPFLLRFPEISQKKRERI  382
            A V+  +     +  + ++L  L+ R+GTLLLCG   L  + +PFLL+F +IS  KRE++
Sbjct  87   AEVMATKAMPVTVKVVRIVLRLLTFRLGTLLLCGFVCLDKKNWPFLLKFSDISLDKREKV  146

Query  383  VHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +  W+T      +R  F  +KA+ L  +FT  ++  + P+W AIG
Sbjct  147  LQKWSTQWYNPLVRIAFMMIKAIFLFYYFTWTNENSETPAWDAIG  191



>ref|XP_010447958.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=750

 Score =   171 bits (432),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 129/206 (63%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPS-FVIECDAvvvgsgcgggvisgvL  782
             PL  GII+  L E  +    T +G  V   +    +   I CD V+VGSG GGGV +  L
Sbjct  200   PLESGIIE-TLHESDITITQTLIGKGVHAARDDDENVHRIRCDVVIVGSGSGGGVAAANL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+   + S LEGPSM +++  GG L T D   ++LAGS VGGG+A+
Sbjct  259   AKAGLKVLVLEKGNYFTAQDYSGLEGPSMLELYEKGGFLTTVDGKFMVLAGSAVGGGTAI  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP YVL EW E   ++ FGS  Y  AMD V  ++GV  +C  E FQN VLRKG
Sbjct  319   NWSASIRTPDYVLEEWSEGSKIKFFGSKEYKTAMDEVTTRIGVTEKCVKEGFQNQVLRKG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+  DHYCG C +
Sbjct  379   CERLGLKVESVPRNSREDHYCGLCGY  404


 Score = 71.6 bits (174),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 81/165 (49%), Gaps = 11/165 (7%)
 Frame = +2

Query  29   KMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVA  208
            + E        SPSQ+++L+ +C T LP        +   S  +F   S+       +VA
Sbjct  20   RGEEEGYNHGFSPSQIQSLAVICQTLLPP-------SGKQSFDSFNVVSSTQPPFTDEVA  72

Query  209  WVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  388
             +I +  +   +  L ++L  LS R GTLLLCG   L   +PF+L+F E+   +RE I+ 
Sbjct  73   EMIVKNGRSEAVKVLRIILMVLSFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRREEILR  132

Query  389  SWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             W+  S   L F   FF A K   L  FF+  D+   NP+ +AIG
Sbjct  133  KWSRQSGFLLPFRITFFLA-KFYTLFYFFSHTDENLKNPALEAIG  176



>ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
 gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
Length=729

 Score =   155 bits (391),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 135/206 (66%), Gaps = 13/206 (6%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+     +H +   L + G  V++ K     + ++CD V+VGSGCGGGV + VL
Sbjct  188   PLEKGLIETMHETDHTLMQSLAEKGLEVSEDKLQNL-YKVKCDVVIVGSGCGGGVAAAVL  246

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKG Y+   + S LEGPSMD+++  GG+L + D  M++LAGSTVGGGSA+
Sbjct  247   ANSGQKVIVLEKGEYFVSHDYSSLEGPSMDELYESGGILSSLDGKMMILAGSTVGGGSAI  306

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP  VLRE  +           Y  AMD+VC ++GV  +C+ ESFQN VL +G
Sbjct  307   NWSACIRTPDSVLRECSD-----------YQSAMDSVCRRIGVTEKCKKESFQNRVLIQG  355

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C ++ + V ++  N+ +DHYCG C +
Sbjct  356   CEKMGFKVESVATNSSADHYCGSCCY  381


 Score = 87.0 bits (214),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 90/155 (58%), Gaps = 8/155 (5%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMK  232
            LS SQM  ++++CNT  P++  N    ET+      +  TSA+     H+ A ++++R+ 
Sbjct  24   LSTSQMHVMASICNTLFPSLPLNPLTNETSQPLSPCYNNTSAS-----HEAAELLHKRVV  78

Query  233  HPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  412
               L+ +  +LW LS R+GTLL+CG+  L  ++PF+ +F EIS +KRE I+ +W+     
Sbjct  79   PEALSLVGWVLWMLSFRLGTLLICGRLCLDWKWPFIHKFSEISLEKREEILRNWSREKRW  138

Query  413  F-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              +R  F  +K +    FF+  D+ G NP WKAIG
Sbjct  139  VPLRLVFVLIKLIFFCTFFSRSDENGHNPVWKAIG  173



>emb|CDX85097.1| BnaC07g08090D [Brassica napus]
Length=743

 Score =   159 bits (402),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 132/206 (64%), Gaps = 4/206 (2%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +   E+ +   LT+ G    +      +  I+CDAVVVGSG GGGV + VL
Sbjct  192   PLEKGVVETMKETEQTLLESLTQKGL---ESDTDHDAIRIKCDAVVVGSGSGGGVAASVL  248

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+V+EKG+Y   ++    EG  M+K++  GG+L + D  +++LAG+TVGGGSAV
Sbjct  249   AKAGLKVVVMEKGSYCTESDYPPFEGHGMEKLYENGGILPSIDGCLMILAGATVGGGSAV  308

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E H + LFG+  Y  AMD +  +MGV   CE E FQN VLRKG
Sbjct  309   NWSACIKTPKSVLQEWSEDHKIPLFGTKEYVSAMDLMWKRMGVTETCEKEGFQNQVLRKG  368

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V N+ +N+   HYCG C +
Sbjct  369   CENLGINVQNVARNSSEKHYCGSCGY  394


 Score = 82.4 bits (202),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 90/169 (53%), Gaps = 14/169 (8%)
 Frame = +2

Query  41   NTATKTLSPSQMETLSALCNTFLPAI---NEALPET----TDASVTNFFQTSAASTGTPH  199
            N   + ++ ++ME+L++ C   LP +    E L E        ++ +F+ T  + T    
Sbjct  9    NFGQREITAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVAR  68

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  379
            Q   +I +R       +  L+L+ L+TR+GTLL+CG   L + +PF+ +F E+S +KRER
Sbjct  69   QTIDLIIKRGTMEAYLAARLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELSLEKRER  128

Query  380  IVH----SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ++     +W    L  IR  F  +K   L  FF+ V   G+NP+W+AIG
Sbjct  129  VLQKQFRNWF---LTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIG  174



>ref|XP_010532673.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=770

 Score =   164 bits (414),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 134/211 (64%), Gaps = 12/211 (6%)
 Frame = +3

Query  606   PLYKGIIDL------NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  767
             PL KG++D        LPE     R  +LG +         +  I+CDAV++GSG GGGV
Sbjct  222   PLEKGMVDTMKETDSTLPETI---RQKELGVTFGSKHD---TIEIKCDAVIIGSGSGGGV  275

Query  768   isgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  947
              + VLA AG KV+VLEKG+Y+  +  S  EGP + +++  GG+L T D ++++LAG+TVG
Sbjct  276   AAAVLANAGLKVVVLEKGSYFVSSEYSPFEGPGLSELYESGGILPTVDGNLMILAGATVG  335

Query  948   GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNM  1127
             GGS VN+SASIKTP  VLREW E H + LFG+  Y  AMD V  ++ V  +C  ESFQN 
Sbjct  336   GGSVVNYSASIKTPESVLREWAEDHKIPLFGTQEYVSAMDVVWKRISVTEKCRQESFQNQ  395

Query  1128  VLRKGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             VLRKGC  L   V N+P+N+  +H CG C +
Sbjct  396   VLRKGCLNLGLKVENVPRNSSENHCCGSCCY  426


 Score = 77.8 bits (190),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 90/164 (55%), Gaps = 14/164 (9%)
 Frame = +2

Query  53   KTLSPSQMETLSALCNTFLPAINEALPETTDA----------SVTNFFQTSAASTGTPHQ  202
            +  + ++ME+L+A+C+T LP ++   PE +            ++ +F   SA+     HQ
Sbjct  43   RGFTAAEMESLAAVCDTILPPLS---PEDSAGGGEDDHPNKEALRSFCSASASQPLFLHQ  99

Query  203  VAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  382
               ++ +R     +  + L+L  LS+R GTLLLCG   L   +PF+ RF  +S +KRER+
Sbjct  100  TVELMLKRGFIEAVLVVRLVLLLLSSRFGTLLLCGTHCLVPNWPFVERFGSLSLEKRERV  159

Query  383  VHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            +  W  + L F IR  F  +K + L  FF+ +   GDNP+W+AI
Sbjct  160  LQKWFRNRLLFPIRVAFIFIKVIFLFCFFSWIGPNGDNPAWEAI  203



>ref|XP_007132926.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
 gb|ESW04920.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
Length=755

 Score =   167 bits (423),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG I+ ++  +  +   L K G +V           ++CDAVVVGSGCGGGV + VL
Sbjct  200   PLEKGTIETMHESDSTLQQSLAKKGLNVTLDFKSNI-LKVKCDAVVVGSGCGGGVAAAVL  258

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             ++AG+KV+VLEKGNY++  + S LEGPSM +++  GG+L + D  +++LAGSTVGGGSAV
Sbjct  259   SSAGHKVVVLEKGNYFSPQDYSSLEGPSMKQLYETGGILASADSRVLILAGSTVGGGSAV  318

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL++W E H L  F S  Y  AM+TVC ++GV   C  E FQN VLRKG
Sbjct  319   NWSACIKTPHKVLKDWSEGHKLPFFSSQEYLSAMETVCERIGVTENCTQEGFQNQVLRKG  378

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V  + +N+  +HYCG C +
Sbjct  379   CQNLGLKVDYVARNSSGNHYCGSCGY  404


 Score = 73.9 bits (180),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 90/162 (56%), Gaps = 12/162 (7%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI----------NEALPETTDASVTNFFQTSAASTGTPHQVAW  211
            S ++ME+L+++C   LP +          ++A  + T   + +F   S +    PH+VA 
Sbjct  23   SAAEMESLASMCEVVLPPLPMDAFKSRKEDQAGDDDTKL-LQSFCDISGSRYPIPHEVAE  81

Query  212  VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  391
            ++        L  + ++LW L+TR+GTLLLCG   L  ++P++  F  +S +KRE+IV  
Sbjct  82   LLTNTSLIEALILVRVVLWMLATRLGTLLLCGFLCLGEKWPYINNFSNMSLEKREKIVQK  141

Query  392  WATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            W     L  IR  F  +K L L  FF+ VD+ GDNP+WKAIG
Sbjct  142  WLKHRFLTPIRLAFVYVKVLCLYSFFSMVDENGDNPAWKAIG  183



>ref|NP_001176205.1| Os10g0474966 [Oryza sativa Japonica Group]
 dbj|BAH94933.1| Os10g0474966 [Oryza sativa Japonica Group]
Length=760

 Score =   160 bits (404),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 131/206 (64%), Gaps = 3/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  G+++    +++   R L + G +V           ++CDAVVVGSGCGGGV + VL
Sbjct  219   PLEDGVVETRRMDDNALLRSLVEKGLAV--KTGTAAHHTVQCDAVVVGSGCGGGVAAAVL  276

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+ GYKV+V+EKG+Y+A  + + LEGPSM++++  GG+  T ++  +L  G+TVGGGSAV
Sbjct  277   ASKGYKVVVVEKGDYFATEDYTSLEGPSMERLYEKGGVFGTSNVTTILFTGATVGGGSAV  336

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP  +  EW   HGL +F S  Y +AMD VC ++ V   CE+E FQN VLR+G
Sbjct  337   NWSACIRTPAEIREEWSREHGLPVFASTAYAQAMDAVCDRIRVTGGCEEEGFQNRVLRRG  396

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L      +P+N+   H+CG C  
Sbjct  397   CDALGMRADAVPRNSSEGHFCGSCNL  422


 Score = 81.3 bits (199),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 87/172 (51%), Gaps = 17/172 (10%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEALPETT----------DASVTNFFQTSAASTGTPH  199
            T  L  +QME L A+C  F+P++ EA               D  +  F+  SAA    P 
Sbjct  25   THGLGAAQMEALRAICGAFIPSLPEAAAALAEADDEGRGGGDKDLERFYLASAADAAVPD  84

Query  200  QVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ------FPFLLRFPEIS  361
            +VA ++  R     +  + ++LW L+TR GTL LCG  +           P + RF ++ 
Sbjct  85   EVAELMVNRCAWEAVALVTVVLWLLATRAGTLALCGAAACVASSAAGGWLPSVRRFADLP  144

Query  362  QKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             ++RE  +  W+++   F ++  FT +K +   VF+T +D+K  NPSWKAIG
Sbjct  145  PERREAALRRWSSARWLFPLKITFTVIKIICHFVFYTKLDEKSRNPSWKAIG  196



>gb|EPS58840.1| hypothetical protein M569_15969, partial [Genlisea aurea]
Length=668

 Score =   162 bits (410),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +GI++  L  E  F + L + G + A P     ++ +ECDAVVVGSGCGGGV + VL
Sbjct  122   PLERGIVEGRLETESSFVDSLAEKGLT-ATPSERENAYRVECDAVVVGSGCGGGVAAAVL  180

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG+KV+VLEKG+Y+A  + S LEGPS+ +++  GG+  + +  +++LAG+TVGGGSAV
Sbjct  181   ARAGHKVVVLEKGDYFAADDYSGLEGPSLRQLYESGGVFSSLEGKLMILAGATVGGGSAV  240

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTPP VL +W   + L LF S  Y  AMD +  ++GV + C  ESFQN VLRKG
Sbjct  241   NWSACIKTPPEVLNQWANDYKLPLFTSPGYASAMDEIWSRIGVTQNCAAESFQNKVLRKG  300

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L     ++  N+  +H+CG C +
Sbjct  301   CEALGLKSESVATNSSENHFCGSCCY  326


 Score = 79.0 bits (193),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +2

Query  275  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW-ATSSLQFIRNFFTAMKALV  451
            STR+G+LL+CG+  L  ++P++ RF EI  + RE IV  W     L  IR  F  +K L+
Sbjct  24   STRLGSLLICGRLCLVGKWPYVRRFSEIGVEDREEIVRRWFGNWFLTPIRVAFVFLKLLI  83

Query  452  LLVFFTSVDDKGDNPSWKAIG  514
            LLVFF+ VD+   NP+WKAIG
Sbjct  84   LLVFFSRVDENSQNPAWKAIG  104



>gb|EPS66779.1| hypothetical protein M569_07992, partial [Genlisea aurea]
Length=724

 Score =   169 bits (427),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 137/206 (67%), Gaps = 6/206 (3%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFV-IECDAvvvgsgcgggvisgvL  782
             PL  GII     E    + L + G  V   +     ++ ++CD VVVGSGCGG V + +L
Sbjct  184   PLQNGII-----ETITESSLRQKGLRVITEEDDDDDYLNVDCDVVVVGSGCGGSVAAAIL  238

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G+KV+VLEKG+Y+A  + S LEGPS+ +++  G +L T   +++++AGSTVGGGSA+
Sbjct  239   AKSGHKVVVLEKGHYFAAQDYSGLEGPSLSELYESGAVLSTLGGELMIMAGSTVGGGSAI  298

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP ++L EW + H L L+ +  Y  AMD VC ++GV   C++E FQN VLR+G
Sbjct  299   NWSACIRTPDHILDEWSKTHNLPLYRTREYQSAMDAVCERIGVTDACDEEGFQNQVLRRG  358

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+PSDHYCG C +
Sbjct  359   CESLGLKVDSVPRNSPSDHYCGSCGY  384


 Score = 72.4 bits (176),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 94/184 (51%), Gaps = 23/184 (13%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAI----NEALPETTDASVTNFFQTSAASTGT  193
            +K     ++   S SQ+++L+A+C T +P +    N+A P ++      FF + + S   
Sbjct  8    KKQPRRRSSHGFSSSQIQSLAAICQTLIPPLADHGNKAAPHSS------FFDSPSGS---  58

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFP-FLLRFPEISQKK  370
              +VA ++ +R     +  + L+LW LSTR+GTLLLCG   L  + P FL  F E+   K
Sbjct  59   -EEVAELLVKRGVPQAVFVVGLVLWVLSTRLGTLLLCGFTCLDWRSPPFLPTFSELQLSK  117

Query  371  RERIVHSWATSSLQFI--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG------VLWS  526
            RE ++  W+     F+  R  F  +K +    FF+  D+   NP+W++IG      V+  
Sbjct  118  REAVLQRWSRQGGTFLPLRITFLLVKIMSFFTFFSRTDENSQNPAWESIGYHIETPVVVE  177

Query  527  RPFH  538
            RP  
Sbjct  178  RPLQ  181



>ref|XP_006406028.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
 gb|ESQ47481.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
Length=746

 Score =   161 bits (407),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 131/206 (64%), Gaps = 4/206 (2%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +   E+ +   L + G    +      +  I+CDAVVVGSG GGGV + VL
Sbjct  194   PLEKGIVETMKETEQTLLESLAQKGL---EADADHDAITIKCDAVVVGSGSGGGVAASVL  250

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+V+EKG+Y+  ++    EGP MDK++  GG+L + D ++++LAGSTVGGGSAV
Sbjct  251   AKSGLKVVVMEKGSYFTESDYPPFEGPGMDKLYENGGILPSVDGNVMILAGSTVGGGSAV  310

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL EW E   + LF +  Y  AM+ V  ++GV   CE E FQN +LRKG
Sbjct  311   NWSACIKTPKSVLHEWSEDQKIPLFATKEYVSAMELVWKRIGVTERCEKEGFQNQILRKG  370

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V N+ +N+   HYCG C +
Sbjct  371   CENLGINVENVARNSSEKHYCGSCGY  396


 Score = 79.3 bits (194),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 86/174 (49%), Gaps = 21/174 (12%)
 Frame = +2

Query  38   NNTATKTLSPSQMETLSALCNTFLPAINEALPE--------TTDASVTNFFQTSAASTGT  193
             N   + ++ ++ME L + C   LP +     E            ++ +F+ TS + T  
Sbjct  9    GNFGHRDVTVAEMEALVSFCEAVLPPVPPPPEEFSGEDDHHRNKEALRSFYSTSGSQTPV  68

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
              Q   +I +R          L+L+ L+TR+GTLL+CG+  L T++PF+ +F E+S +KR
Sbjct  69   VRQTIELITKRGTIEAYLITRLVLFLLATRLGTLLICGRECLVTKWPFVEKFSELSLEKR  128

Query  374  ERIVHSWATSSLQF-------IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            ER+         QF       IR  F  +K   L  FF+ V   G+NPSW+AIG
Sbjct  129  ERVFQK------QFKNWFFTPIRAAFVYIKVAFLFCFFSRVSPNGENPSWEAIG  176



>ref|NP_001142399.1| uncharacterized protein LOC100274574 [Zea mays]
 gb|ACN25897.1| unknown [Zea mays]
 tpg|DAA49653.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=675

 Score =   171 bits (432),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 135/206 (66%), Gaps = 1/206 (0%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  G+++  L +++   R L   G +V           ++CDAV+VGSGCGGGV + VL
Sbjct  122   PLDVGVVETRLLDDNKLLRSLVGRGLTVKPASSDANHHTVQCDAVIVGSGCGGGVAAAVL  181

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AGYKV+V+EKG+Y+   + S +EGPSM+++F  GG+  T ++  ++  G+TVGGGSAV
Sbjct  182   ASAGYKVVVVEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNVTTMIFTGATVGGGSAV  241

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP  V +EW   HGL +F S  Y +AMD VC ++GV   C++E FQN V+R+G
Sbjct  242   NWSASIRTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDGCQEEGFQNKVVRRG  301

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L      +P+N+   H+CG C F
Sbjct  302   CEALGLCADAVPRNSSDAHFCGSCNF  327


 Score = 69.3 bits (168),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query  275  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  451
            STR GTLLLCG+ SL   FP++ RF +++ ++RE  +  W      F +R  F  +K L 
Sbjct  21   STRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRWNRVRWLFPLRIAFAIVKILC  80

Query  452  LLVFFTSVDDKGDNPSWKAIGVLWSRP  532
              VF+  V++  +NP WKAIG     P
Sbjct  81   HYVFYAMVNENSENPYWKAIGYSVDEP  107



>emb|CDP03771.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   156 bits (395),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ L   +  +   L + G  V + +P    + I+CD V+VGSGCGGGV + +L
Sbjct  207   PLEKGVIETLYENDSTLKTSLIQKGLFV-EEEPNEDLYKIKCDVVIVGSGCGGGVAAAIL  265

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G+KVLVLEKG+Y+   + S LEGPS ++++L G  L T D  ++LLAGSTVGGG+AV
Sbjct  266   AASGHKVLVLEKGHYFVPEDYSGLEGPSFEELYLSGAKLTTVDGKVLLLAGSTVGGGTAV  325

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP +VL+EW     +  +G+  Y  AMD V  ++GV + C  ESFQN ++++G
Sbjct  326   NWSASIKTPDHVLKEWSVDRKIPFYGTSAYQSAMDEVFKRIGVTKNCTVESFQNEIIKQG  385

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L      + +N+  +HYCG C +
Sbjct  386   CEKLGLEAGQVARNSSENHYCGSCGY  411


 Score = 83.2 bits (204),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 95/162 (59%), Gaps = 11/162 (7%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAIN---EALPET-------TDASVTNFFQTSAASTGTPHQVAW  211
            SPSQ++ LSA+C  FLP+++   +A+  +        +A++  +++ S + +  P +VA 
Sbjct  29   SPSQIQALSAVCEAFLPSLSPPSDAISHSQGDPQLHNEAALEYYYKASGSQSPFPDEVAE  88

Query  212  VINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  391
            ++ +R     L+ + L+L  LSTR+GTLL+CG   L+ ++PF+ RF E+  KKRE I+  
Sbjct  89   ILVKRGLPEGLSVVKLVLKLLSTRLGTLLVCGLICLNWKWPFVHRFSELPVKKRETILQK  148

Query  392  WATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            W+T +    +R  F  +K +   VFF+  D+   + +  AIG
Sbjct  149  WSTETFLIPLRIVFLMIKIMCCYVFFSWTDENYKSRTLDAIG  190



>ref|XP_010532672.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=746

 Score =   166 bits (420),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +   +  +   L++ G  V       P   I+CDAV+VGSG GGGV + VL
Sbjct  193   PLEKGMVETVKETDSTLPKSLSEKGLEVMSGSNHDP-IKIKCDAVIVGSGSGGGVAAAVL  251

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A+AG KV+VLEKG Y+A +  S  EG   D+++  GG+L T D ++++LAG+TVGGGSAV
Sbjct  252   ASAGLKVVVLEKGTYFAPSEYSPFEGHGFDQLYESGGVLPTVDGNVMILAGATVGGGSAV  311

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E H + LFG+  Y  AM+ V  ++GV  +C  ESFQN VLRKG
Sbjct  312   NWSACIKTPEPVLQEWSEDHKIPLFGTQEYGSAMEVVWKRIGVTEKCRQESFQNQVLRKG  371

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V N+P+N+  +HYCG C +
Sbjct  372   CLNLGLKVENVPRNSSENHYCGSCCY  397


 Score = 73.6 bits (179),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 92/161 (57%), Gaps = 7/161 (4%)
 Frame = +2

Query  53   KTLSPSQMETLSALCNTFLPAIN-EALPETTD-----ASVTNFFQTSAASTGTPHQVAWV  214
            +  + ++ME+L+A+C T LP ++ E  P+  D      ++ +F+  S + +   HQ   +
Sbjct  15   RGFTAAEMESLAAVCETLLPPLSPEYSPDGEDDHPNKEALRSFYSDSGSKSHVLHQGVEL  74

Query  215  INQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  394
            I +R     +  + L+L  LS+R+GTLLLCG   L   +PF+ RF  +S +KRER++  W
Sbjct  75   ITRRGLIEAVLVVRLVLLLLSSRLGTLLLCGTHCLVPNWPFVERFGSLSLEKRERVLQKW  134

Query  395  ATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              + L   IR  F  +K + L  FF+ V   G+NP+W+AIG
Sbjct  135  FRNRLLAPIRLAFVYIKVVFLYCFFSWVGPNGENPAWEAIG  175



>ref|XP_010433200.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Camelina sativa]
Length=748

 Score =   169 bits (427),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 130/206 (63%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  GII+ L+  +  +   L + G   A+         I CD VVVGSG GGGV +  L
Sbjct  198   PLESGIIETLHESDITITQSLIEKGVHAARDDDENV-HRIRCDVVVVGSGSGGGVAAANL  256

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+   + S LEGPSM +++  GG L T D   ++LAGS VGGG+A+
Sbjct  257   AKAGLKVLVLEKGNYFTAQDYSGLEGPSMLELYEKGGFLTTVDGKFMVLAGSAVGGGTAI  316

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   ++ FGS  Y  AMD V  ++GV  +C  + FQN VLRKG
Sbjct  317   NWSASIRTPDHVLQEWSEGSKIKFFGSQEYKTAMDQVTTRIGVTEKCVKDGFQNQVLRKG  376

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+  DHYCG C +
Sbjct  377   CERLGLQVESVPRNSSEDHYCGLCGY  402


 Score = 70.9 bits (172),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 81/166 (49%), Gaps = 11/166 (7%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQV  205
            ++ E        SPSQ+++L+ +C T LP        +   S  +F   S+       +V
Sbjct  18   KREEEEGYNHGFSPSQIQSLAVICQTLLPP-------SPKQSFDSFNVVSSTQPPFTDEV  70

Query  206  AWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  385
            A +I +  +   +  L ++L  LS R GTLLLCG       +PF+L+F E+   +RE I+
Sbjct  71   AEMIVKNGRSEAVKVLRIILMVLSFRFGTLLLCGSLCFDKSWPFVLKFSELPLDRREEIL  130

Query  386  HSWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
              W+  S   L F   FF A K   L  FF+  D+   NP+ +AIG
Sbjct  131  RKWSRQSGYLLPFRITFFLA-KFYTLFYFFSHTDENMKNPALEAIG  175



>gb|AAP54248.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=784

 Score =   164 bits (414),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 132/208 (63%), Gaps = 3/208 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSV--AKPKPPGPSFVIECDAvvvgsgcgggvisg  776
             PL  G+++   L +  +   L + G ++      P      + CDAVVVGSGCGGGV + 
Sbjct  218   PLDNGVVETKQLDDNALLMSLAEKGLALKTGASSPSAHHHTVLCDAVVVGSGCGGGVAAA  277

Query  777   vLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGS  956
             VLA+AGYKV+V+EKG+Y+A  + S LEGP+M++++  GG+  T ++   + AG+TVGGGS
Sbjct  278   VLASAGYKVVVVEKGDYFAARDYSSLEGPTMERLYENGGVFSTANVTTTMFAGATVGGGS  337

Query  957   AVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLR  1136
             AVNWSA I+TP  VL+EW   HGL LFG   Y +AMD VC ++GV   C +E FQN  +R
Sbjct  338   AVNWSACIRTPANVLQEWSNDHGLPLFGGQGYVQAMDAVCARLGVTGRCREEGFQNKAVR  397

Query  1137  KGCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             +GC  L   V  + +N+   H+CG C  
Sbjct  398   RGCEALGLRVEAVSRNSSEGHFCGSCNL  425


 Score = 75.1 bits (183),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 81/159 (51%), Gaps = 4/159 (3%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAI----NEALPETTDASVTNFFQTSAASTGTPHQVAWVI  217
            T  L  +QM  L A+C   +PA+     +      D  V  F+  +AA +  P +VA + 
Sbjct  28   THGLGAAQMGALRAMCGALIPALPAEEEDGARGGGDMDVERFYLATAAESTVPDEVAELT  87

Query  218  NQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  397
              R        + ++LW L+TR+GTL LCG+  +S +FP++ RF ++  ++RE  +    
Sbjct  88   MTRCIWEAGVLVRIILWILATRVGTLALCGRRCVSGEFPYVRRFADMPVERREAALKRSR  147

Query  398  TSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +S      +  ++      ++ +  VD+  +NPSWKAIG
Sbjct  148  SSLPSSRSSATSSSTPRFQVLIYHIVDENLENPSWKAIG  186



>gb|KEH23950.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=737

 Score =   159 bits (402),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 133/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +G+++        +   L++ G  V + +     + I+CD V+VGSG GGGV + +L
Sbjct  191   PLQEGLVETTYETNSTLIQSLSEKGLEVTEDEEQNV-YKIKCDVVIVGSGSGGGVAAAIL  249

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G+KV++LEKG Y+   + S LE  +M++++  GG++ T D  M++LAGSTVGGGSA+
Sbjct  250   ANSGHKVIILEKGEYFVSQDYSSLESSAMNELYESGGIMPTLDGKMMILAGSTVGGGSAI  309

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NW+A ++TP  V +EW E + L LF S  Y  AMD+VC ++GV  +C  +SFQN VLRKG
Sbjct  310   NWAACVRTPDSVKKEWSEKYKLPLFTSSDYQSAMDSVCRRIGVTDKCNKQSFQNQVLRKG  369

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  +   V ++  NA  DHYCG C +
Sbjct  370   CERIGLKVESVAVNASEDHYCGSCCY  395


 Score = 78.6 bits (192),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 83/152 (55%), Gaps = 3/152 (2%)
 Frame = +2

Query  68   SQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVA-WVINQRMKHPKl  244
            SQM  L+++C+T  P+I      + D ++++F+ TS +    P + A  V+  +   P+ 
Sbjct  25   SQMHVLASICDTLFPSIPLNKEVSQDENLSSFYSTSGSQFPFPDEAAELVLLFKKSAPEA  84

Query  245  nslllllw-flSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFI  418
              L+  +   LS ++GTL LCG   L  ++PF+L+F EIS +KRE I+  W+  +    +
Sbjct  85   IPLVRWILWILSFKLGTLFLCGTLCLHWKWPFVLKFSEISLEKREEILKKWSKENKWTPL  144

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            R  F  +K +     F+  D  G NP WKAIG
Sbjct  145  RAVFVLIKIVFFYTLFSRTDVNGHNPMWKAIG  176



>ref|XP_009137800.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Brassica rapa]
Length=744

 Score =   179 bits (454),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 133/206 (65%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+  N  +  +   LT+ G  VA+         I CD V+VGSG GGGV +  L
Sbjct  197   PLEKGIIETKNESDVTIRQSLTQKGVHVARDDNDNI-HRIRCDVVIVGSGSGGGVAAANL  255

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+   + S LEGPSM +++  G L+ T D   ++LAGSTVGGG+AV
Sbjct  256   AKAGLKVLVLEKGNYFTSRDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTVGGGTAV  315

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   +E FGS  Y  AMD V  ++GV   C  E  QN VLR+G
Sbjct  316   NWSASIRTPDHVLKEWSEESKIEFFGSQEYQLAMDEVVRRLGVTERCVKEGLQNQVLREG  375

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   VV++P+N+P DHYCG C +
Sbjct  376   CERLGLKVVSVPRNSPEDHYCGSCGY  401


 Score = 58.5 bits (140),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 76/153 (50%), Gaps = 3/153 (2%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  241
            S SQ++TLS +C T LP          +A V +F   S +      +VA +I +  +   
Sbjct  29   SISQIQTLSFICQTLLPPPPPETTAEQNA-VDSFNVASGSQPPFTDEVAEMIVKNGRSEA  87

Query  242  lnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF--  415
            +  L ++L  LS R GTL LCG   L+  +PF+ +F ++   KRE I+  W+  S  F  
Sbjct  88   VKVLRIILTILSYRFGTLFLCGSLCLAKDWPFVHKFSDLPLDKREEILRMWSRQSGLFLP  147

Query  416  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +R  F   K   L  FF+  D    NP+ +AIG
Sbjct  148  LRITFFLAKFYTLFSFFSQRDQNMKNPALEAIG  180



>gb|KFK39637.1| hypothetical protein AALP_AA3G269600 [Arabis alpina]
Length=744

 Score =   165 bits (417),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 134/204 (66%), Gaps = 4/204 (2%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +    + +   L + G  V        +  I+CDAV+VGSG GGGV + VL
Sbjct  193   PLEKGMVETMKETNQTLLESLAQKGLEVDHDTD---AIRIKCDAVIVGSGSGGGVAASVL  249

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+V+EKG+Y+   + +  EGPS++KM+  GG+L + D + ++LAG+TVGGGSAV
Sbjct  250   AKSGLKVVVMEKGSYFTPLDYTPFEGPSVEKMYENGGVLPSLDGNFMVLAGATVGGGSAV  309

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   + LF +  Y  AM+ VC ++GV  +CE ESFQN +LRKG
Sbjct  310   NWSACIKTPKSVLQEWSEDQKIPLFATKEYVSAMELVCKRIGVTEKCETESFQNQILRKG  369

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C  L   V N+P+N+   HYCG C
Sbjct  370   CENLGINVENVPRNSSERHYCGSC  393


 Score = 72.4 bits (176),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 86/163 (53%), Gaps = 15/163 (9%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI--------NEALPETTDASVTNFFQTSAASTGTPHQVAWVI  217
            + ++ME+L++ C   LP +         E        S+ +F+ TS + T    Q   +I
Sbjct  16   TATEMESLASFCEAVLPPVPPPPEELSGEDDHHRKKESLRSFYSTSGSQTPILRQTIELI  75

Query  218  NQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH---  388
             +R          L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S ++RER++    
Sbjct  76   VKRGTIEAYLMSRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLERRERVIQKQF  135

Query  389  -SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
             +W    L   R  F  +K+  L  FF+ V   G+NP+W+AIG
Sbjct  136  KNWL---LTPFRAAFVYLKSAFLFCFFSRVSSNGENPAWEAIG  175



>emb|CBI29206.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   198 bits (504),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 163/264 (62%), Gaps = 33/264 (13%)
 Frame = +3

Query  447   WFSSYSSL-RLMIRGI---------TQVG--------KQ*GYCGPDPSISekqkkqkhhd  572
             W  SY SL R++ R +         TQV         K  GYCGPDP      +  K   
Sbjct  145   WSLSYFSLIRMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDPDFKTLYRANKTAQ  204

Query  573   heddieeLLFGPLYKGIIDLNLPEEHVFN--RLTKLGCSVAKPKPPGPS----FVIECDA  734
                      +G   +G+I++  P E V    RL+    S+   K   P+     +I CDA
Sbjct  205   PNG------YG---RGLINVKRPREVVAEALRLSGFSISIHSRKHETPNSSSPLIIRCDA  255

Query  735   vvvgsgcgggvisgvLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDL  914
             VV+GSG GGGV +GVLA AGYKVLVLEKGNY AR+NLSLLEGP++D+M+L GG+L T D 
Sbjct  256   VVIGSGSGGGVAAGVLAKAGYKVLVLEKGNYCARSNLSLLEGPTLDQMYLYGGMLATDDT  315

Query  915   DMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQ  1094
              +++LAGSTVGGGS +NWSASI+TP +V +EWC+ H LELF S +Y +AMD VC KMGVQ
Sbjct  316   GVIILAGSTVGGGSTINWSASIRTPQHVRKEWCDQHELELFDSQLYKEAMDVVCEKMGVQ  375

Query  1095  RECEDESFQNMVLRKGCRELCYPV  1166
              E  +E   N VLR+GC+EL YP 
Sbjct  376   SEIYEEGLNNAVLRRGCQELGYPT  399


 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 102/158 (65%), Gaps = 1/158 (1%)
 Frame = +2

Query  59   LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  238
            LS  +ME+L A+ +TFLP++ EA      A V  F++TSA+  GTPH V  +I++R++HP
Sbjct  35   LSSREMESLIAISDTFLPSV-EAPHNAAHAYVDKFYRTSASMAGTPHIVGGLISERLEHP  93

Query  239  KlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  418
            KL    ++LW LST  GT ++CG  S+S+ FP+   FP++S  KR  IV SW+ S    I
Sbjct  94   KLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEIVLSWSLSYFSLI  153

Query  419  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGVLWSRP  532
            R  F ++K + LLVFFT VD+K +N +WKAIG     P
Sbjct  154  RMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDP  191



>ref|XP_010438427.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=745

 Score =   166 bits (421),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 130/206 (63%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  GI++ L+  +  +   L + G   A+         I CD ++VGSG GGGV +  L
Sbjct  195   PLESGIVETLHESDITITQTLIEKGVHAARDDDENV-HRIRCDVIIVGSGSGGGVAAANL  253

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KVLVLEKGNY+   + S LEGPSM +++  GG L T D   ++LAGS VGGG+A+
Sbjct  254   AKAGLKVLVLEKGNYFTAQDYSGLEGPSMLELYEKGGFLTTVDGKFMVLAGSAVGGGTAI  313

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASI+TP +VL+EW E   ++ FGS  Y  AMD V  ++GV  +C  + FQN VLRKG
Sbjct  314   NWSASIRTPDHVLQEWSEGSKIKFFGSQEYKTAMDEVKTRIGVTEKCVKDGFQNQVLRKG  373

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V ++P+N+  DHYCG C +
Sbjct  374   CERLGLKVESVPRNSREDHYCGLCGY  399


 Score = 70.9 bits (172),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 82/170 (48%), Gaps = 11/170 (6%)
 Frame = +2

Query  14   YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGT  193
            + L R  +        SPSQ+ +L+ +C T LP        +   S  +F   S+     
Sbjct  11   HRLLRSKKREGYNHGFSPSQIHSLAVICQTLLPP-------SGKQSFDSFNVVSSTQPPF  63

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  373
              +VA +I +  +   +  L ++L  LS R GTLLLCG   L   +PF+L+F E+   +R
Sbjct  64   TDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRR  123

Query  374  ERIVHSWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            E I+  W+  S   L F   FF A K   L  FF+  D+   NP+ +AIG
Sbjct  124  EEILKKWSRQSGYLLPFRITFFLA-KFYTLFYFFSHTDENLKNPALEAIG  172



>ref|XP_011080081.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Sesamum indicum]
Length=742

 Score =   162 bits (409),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 137/206 (67%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +N  E  +   L + G ++A+ +     + I+CD V++GSGCGGGV + VL
Sbjct  193   PLEKGIIEIMNEDELSLKKSLVQKGINIAEDENENV-YKIKCDVVIIGSGCGGGVAAAVL  251

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KVL+LEKG+Y+   + S LEGP+  +++  GG+L T D  ++++AG+ +GGGS++
Sbjct  252   AKSGQKVLILEKGHYFVPEDYSGLEGPAFSELYESGGMLTTTDGKIMVMAGTALGGGSSI  311

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA I+TP Y+L+EW   + + LFGS  Y  A+D VC ++GV   C  E FQN VLR+G
Sbjct  312   NWSACIRTPDYILKEWSTENKIHLFGSHEYQSAVDAVCERIGVTENCVQEGFQNQVLRRG  371

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V  +P+N+ + HYCG C +
Sbjct  372   CENLGLKVEPVPRNSSTYHYCGSCCY  397


 Score = 74.3 bits (181),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 88/149 (59%), Gaps = 1/149 (1%)
 Frame = +2

Query  71   QMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlns  250
            Q+++L+A+C T +P +     +  DA++ +    S   +  P +VA ++ +R     +  
Sbjct  28   QIQSLAAICQTLIPPLPLDDNDNDDANLLHQPNHSFYKSSGPDEVAELLVKRGIPAAVFI  87

Query  251  lllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNF  427
            + L+L FLS+R+GTLLLCG   L  ++PF+  F E++ KKRE I+  W+  +L   +R  
Sbjct  88   VSLVLKFLSSRLGTLLLCGWICLDWKWPFVHSFCELTLKKREAILQKWSRETLFLPLRIA  147

Query  428  FTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            F  +K + L VFF+  D+   NP+W+AIG
Sbjct  148  FLLLKIMCLFVFFSWTDENSSNPAWEAIG  176



>ref|XP_007035188.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
 gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
Length=655

 Score =   183 bits (465),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 144/206 (70%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+I+ ++  +  +   LT+ G  V +       + I+CDAV+VGSGCGGGV + +L
Sbjct  112   PLQKGMIETMHEKDSTLLQSLTQKGLQVTEDTERNV-YKIKCDAVIVGSGCGGGVAAAIL  170

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A++G KV+VLEKG+Y+A ++ S  EGPSMD+++  GG+L + D  M++LAGSTVGGGSA+
Sbjct  171   ASSGLKVVVLEKGSYFAPSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGSTVGGGSAI  230

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSASIKTP  +L+EW E   L LFGS  Y  AMD VC ++GV   C++E FQN +LRKG
Sbjct  231   NWSASIKTPKSILQEWAEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGFQNQILRKG  290

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C+ L   V N+P+N+   HYCG C F
Sbjct  291   CKNLGLEVENVPRNSSESHYCGSCGF  316


 Score = 52.0 bits (123),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +2

Query  275  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  451
            STR+GTLLLCG   L  ++P++  F  +  + RE+++  W  S L   +R  F  +K   
Sbjct  15   STRLGTLLLCGSLCLGDKWPYINYFSCMPLENREKVLQMWFKSWLFTLVRIAFIYLKVAC  74

Query  452  LLVFFTSVDDKGDNPSWKAIG  514
            L VFF+ V +  DNP+W+AIG
Sbjct  75   LYVFFSRVGENNDNPAWEAIG  95



>emb|CDX92985.1| BnaA03g37070D [Brassica napus]
Length=721

 Score =   159 bits (401),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 132/206 (64%), Gaps = 4/206 (2%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +   ++ +   L + G    + +    +  I+CDAVVVGSG GGGV + VL
Sbjct  173   PLQKGMVETMQETDQTLLESLAQKGL---EAETDHDTIRIKCDAVVVGSGSGGGVAASVL  229

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+V+EKG+YY  +     EGP MDK++  GG+L T D +M++LAG+TVGGGSAV
Sbjct  230   AKAGMKVVVMEKGSYYTPSTYPSTEGPGMDKLYENGGILPTIDGNMMVLAGATVGGGSAV  289

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   + L+ +  Y  AM+ V  ++GV   CE E FQN VLRKG
Sbjct  290   NWSACIKTPKSVLQEWSEDRKIPLYATKEYVSAMELVWKRIGVTERCELEGFQNQVLRKG  349

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V N+ +N+   HYCG C +
Sbjct  350   CENLGINVENVARNSSERHYCGSCGY  375


 Score = 77.0 bits (188),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 85/160 (53%), Gaps = 18/160 (11%)
 Frame = +2

Query  74   METLSALCNTFLPAINEALPET---------TDASVTNFFQTSAASTGTPHQVAWVINQR  226
            ME+L++ C   LP ++   PE             ++ +FF TS + T    +   +I +R
Sbjct  1    MESLASFCEAVLPPVSP--PEEYCGGDDHYRNKETLRSFFFTSGSRTPVVRESIELITKR  58

Query  227  MKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SW  394
                      L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S +KRER++     +W
Sbjct  59   GTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNW  118

Query  395  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
                L  IR  F  +K   L  FF+ V   G+NP+W+AIG
Sbjct  119  L---LTPIRAAFVYIKVAFLFCFFSRVSPNGENPAWEAIG  155



>emb|CAC87643.1| alcohol oxidase [Arabidopsis thaliana]
Length=678

 Score =   165 bits (418),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 132/206 (64%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGI++ +   E+ +   L   G   A       +  I+CD VVVGSG GGGV + VL
Sbjct  125   PLEKGIVETMEETEQTLLESLAHKGLE-AVLDTEHDAIRIKCDVVVVGSGSGGGVAASVL  183

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+VLEKG+Y+  +     EGP +DK++  GG+L + D   ++LAG+TVGGGSAV
Sbjct  184   AKSGLKVVVLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSFMVLAGATVGGGSAV  243

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   + LFG+  Y  AM+ V  +MGV  +CE ESFQN +LRKG
Sbjct  244   NWSACIKTPKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEKCELESFQNQILRKG  303

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L + V N+P+N+   HYCG C +
Sbjct  304   CENLGFNVENVPRNSSESHYCGSCGY  329


 Score = 70.1 bits (170),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 7/84 (8%)
 Frame = +2

Query  275  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH----SWATSSLQFIRNFFTAMK  442
            +TR+GTLL+CG   L +++PF+ +F E+S +KRER++     +W    L  IR  F  +K
Sbjct  27   ATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFKNWI---LTPIRAAFVYIK  83

Query  443  ALVLLVFFTSVDDKGDNPSWKAIG  514
               L  FF+ V+  G+NP+W+AIG
Sbjct  84   VAFLFCFFSRVNPNGENPAWEAIG  107



>emb|CDY18199.1| BnaC05g02220D [Brassica napus]
Length=752

 Score =   166 bits (421),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 128/205 (62%), Gaps = 0/205 (0%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLA  785
             PL KGII+    +E    +L        K      +F IECDAVV+GSGCGGGV +  LA
Sbjct  205   PLEKGIIETAKEDEATIKQLMISKGLKLKEDKESNTFKIECDAVVIGSGCGGGVAAANLA  264

Query  786   TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVN  965
              +G KV+V+EKGNY+   + S LEGPSM +MF   GLL+T D     +AG+T+GGGS VN
Sbjct  265   KSGLKVIVVEKGNYFVPQDYSTLEGPSMFEMFEANGLLVTHDGRFRFMAGATLGGGSVVN  324

Query  966   WSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGC  1145
             W+AS+KTP  ++ EW    G+  F  + Y  AM++VC ++GV      E FQN +LRKGC
Sbjct  325   WAASLKTPDAIIEEWSVDKGIATFAREGYTAAMESVCKRIGVTERVIREGFQNQILRKGC  384

Query  1146  RELCYPVVNIPQNAPSDHYCGWCTF  1220
              +L   V  +P+N+  +HYCG C+F
Sbjct  385   EKLGLDVTVVPRNSSEEHYCGSCSF  409


 Score = 68.6 bits (166),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 84/161 (52%), Gaps = 11/161 (7%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  220
            S S ++ LSA+C   +P +       +  L    + ++ +FF++S +    P +VA V+ 
Sbjct  29   SQSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFKSSGSHV-RPDEVAEVMA  87

Query  221  QRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ--FPFLLRFPEISQKKRERIVHSW  394
             +     +  + ++L  L+ R+GTLLLCG   L  +     LL+F +IS +KRE+++  W
Sbjct  88   TKAMPVTVTVVRIVLRLLTFRLGTLLLCGFVCLDKKNWSSLLLKFSDISLEKREKVLQKW  147

Query  395  ATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
                     R  F  +KA+ L  +FT  ++  +NP+W AIG
Sbjct  148  NKQWYNPLARIAFMMIKAIFLFYYFTWTNENTENPAWDAIG  188



>emb|CDX89850.1| BnaA10g02320D [Brassica napus]
Length=752

 Score =   166 bits (419),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 127/205 (62%), Gaps = 0/205 (0%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLA  785
             PL KGII+    +E    +L        K      +F IECDAVV+GSGCGGGV +  LA
Sbjct  205   PLEKGIIETAKEDEATIKQLMINKGLKLKEDKESNTFKIECDAVVIGSGCGGGVAAANLA  264

Query  786   TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVN  965
              +G KV+V+EKGNY+   + S LEGPSM +MF   GLLMT D     +AGST+GGGS VN
Sbjct  265   KSGLKVIVVEKGNYFVPQDYSTLEGPSMFEMFEANGLLMTHDGRFRFMAGSTLGGGSVVN  324

Query  966   WSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGC  1145
             W+AS+KTP  ++ EW    G+  F  + Y  AM++VC ++ V      E FQN +LRKGC
Sbjct  325   WAASLKTPDAIIEEWSVDRGIATFAREGYTAAMESVCKRICVTERVIREGFQNQILRKGC  384

Query  1146  RELCYPVVNIPQNAPSDHYCGWCTF  1220
              +L   V  +P+N+  +HYCG C+F
Sbjct  385   EKLGLDVTVVPRNSSEEHYCGSCSF  409


 Score = 68.6 bits (166),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 11/170 (6%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGT  193
            +  T +   S S ++ LSA+C   +P +       +  L    + ++ +FF++S +    
Sbjct  20   KQETFSHGFSQSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFKSSGSHV-R  78

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ-FPFLL-RFPEISQK  367
            P +VA V+  +     +  + ++L  L+ R+GTLLLCG   L  + + FLL +F +IS +
Sbjct  79   PDEVAEVMATKAMPVTVTVVRIVLRLLTFRLGTLLLCGFVCLDKKNWSFLLLKFSDISLE  138

Query  368  KRERIVHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            KRE+++  W         R  F  +KA+ L  +FT  ++  +NP+W AIG
Sbjct  139  KREKVLQKWNKQWYNPLARIAFMMIKAIFLFYYFTWTNENTENPAWDAIG  188



>ref|XP_009119340.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Brassica rapa]
Length=761

 Score =   165 bits (418),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 127/205 (62%), Gaps = 0/205 (0%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLA  785
             PL KGII+    +E    +L        K      +F IECDAVV+GSGCGGGV +  LA
Sbjct  212   PLEKGIIETAKEDEATIKQLMINKGLKLKEDKESNTFKIECDAVVIGSGCGGGVAAANLA  271

Query  786   TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVN  965
              +G KV+V+EKGNY+   + S LEGPSM +MF   GLLMT D     +AGST+GGGS VN
Sbjct  272   KSGLKVIVVEKGNYFVPQDYSTLEGPSMFEMFEANGLLMTHDGRFRFMAGSTLGGGSVVN  331

Query  966   WSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGC  1145
             W+AS+KTP  ++ EW    G+  F  + Y  AM++VC ++ V      E FQN +LRKGC
Sbjct  332   WAASLKTPDAIIEEWSVDRGIATFDREGYTAAMESVCKRICVTERVIREGFQNQILRKGC  391

Query  1146  RELCYPVVNIPQNAPSDHYCGWCTF  1220
              +L   V  +P+N+  +HYCG C+F
Sbjct  392   EKLGLDVTVVPRNSSEEHYCGSCSF  416


 Score = 68.6 bits (166),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 11/170 (6%)
 Frame = +2

Query  35   ENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGT  193
            +  T +   S S ++ LSA+C   +P +       +  L    + ++ +FF++S +    
Sbjct  27   KQETFSHGFSQSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFKSSGSHV-R  85

Query  194  PHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ-FPFLL-RFPEISQK  367
            P +VA V+  +     +  + ++L  L+ R+GTLLLCG   L  + + FLL +F +IS +
Sbjct  86   PDEVAEVMATKAMPVTVTVVRIVLRLLTFRLGTLLLCGFVCLDKKNWSFLLLKFSDISLE  145

Query  368  KRERIVHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            KRE+++  W         R  F  +KA+ L  +FT  ++  +NP+W AIG
Sbjct  146  KREKVLQKWNKQWYNPLARIAFMMIKAIFLFYYFTWTNENTENPAWDAIG  195



>emb|CDO99261.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   176 bits (447),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 141/206 (68%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++  +  E  + + L + G  V K  P    + I+CD V+VGSGCGGGV + VL
Sbjct  199   PLMKGMVETTHETESTIVSSLVQKGLRV-KEVPKEKLYKIKCDVVIVGSGCGGGVAAAVL  257

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KV+V+EKGNY+ +T+ S LEGPSM++++  GG+L T D  M+LLAGSTVGGGSAV
Sbjct  258   AKSGQKVVVIEKGNYFTKTDYSSLEGPSMNELYESGGILATLDGKMMLLAGSTVGGGSAV  317

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW     + LF S  Y  AMDTV  ++GV  +C +E FQN +LR+G
Sbjct  318   NWSACIKTPMSVLQEWANDCQIPLFTSSQYISAMDTVSQRIGVTEKCSEEGFQNQILRRG  377

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   V ++P+N+  +HYCG C +
Sbjct  378   CEKLGLEVESVPRNSSENHYCGSCNY  403


 Score = 57.0 bits (136),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 90/174 (52%), Gaps = 10/174 (6%)
 Frame = +2

Query  17   SLHRKMENNTATKTLSPSQMETLSALCNTFLPAI--NEALPE------TTDASVTNFFQT  172
            SL         +   S S++E L+ +C  F+P +  N + P+       T  ++ +F+++
Sbjct  9    SLRGGRRETKYSHGFSSSELEALTGICEAFIPPLPLNNS-PDIVGKDGKTKEAIQSFYKS  67

Query  173  SAASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFP  352
            S A    P +VA +  +R     +  + LLL  LSTR+GTLLLCG      ++P++ +F 
Sbjct  68   SGAQYPIPDEVAELAVKRGFLEAVILVRLLLIILSTRLGTLLLCGTLCFGEKWPYINKFS  127

Query  353  EISQKKRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
            +I  + RE+++  W     L  IR  F  +K L L  FFT V D   NP+W+A+
Sbjct  128  DIPVENREKVIQKWFKHRFLTPIRLPFVFIKFLCLYAFFTQVWDDLKNPAWEAM  181



>ref|XP_004309279.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=228

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 135/197 (69%), Gaps = 0/197 (0%)
 Frame = +3

Query  630   LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvLATAGYKVLV  809
             +N  +  +   LTK G  V           I+CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  1     MNKTDSTLIESLTKKGTEVTDGAAHPQIHKIKCDVVIVGSGCGGGVAAAVLAQSGQKVVV  60

Query  810   LEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTP  989
             LEKGNY+   + SLLEGPSM++++  GG++ +KD  M++LAGSTVGGGSAVNWSASI+TP
Sbjct  61    LEKGNYFVPKDYSLLEGPSMNELYESGGIMASKDGKMIILAGSTVGGGSAVNWSASIRTP  120

Query  990   PYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELCYPVV  1169
               VL EW  VH + LFGS  Y  AMD VC ++GV   C +E+ QN +LRKGC +L   V 
Sbjct  121   NSVLEEWSVVHKIPLFGSPDYQSAMDAVCKRIGVTDSCTEENMQNQILRKGCEKLGLKVD  180

Query  1170  NIPQNAPSDHYCGWCTF  1220
             ++P+N+ +DHYCG C +
Sbjct  181   SVPRNSSADHYCGSCNY  197



>ref|XP_009136067.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Brassica rapa]
Length=740

 Score =   157 bits (397),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 132/206 (64%), Gaps = 4/206 (2%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KG+++ +   E+ +   L + G    + +    +  I+CDAVVVGSG GGGV + VL
Sbjct  192   PLEKGMVETMQETEQTLVESLAQKGL---EAETDHDTIRIKCDAVVVGSGSGGGVAASVL  248

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG KV+V+EKG+YY  +     EGP M+K++  GG+L T D +M++LAG+TVGGGSAV
Sbjct  249   AKAGMKVVVMEKGSYYTPSTYPSTEGPGMNKLYENGGILPTIDGNMMVLAGATVGGGSAV  308

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  VL+EW E   + L+ +  Y  AM+ V  ++GV   CE E FQN VLRKG
Sbjct  309   NWSACIKTPKSVLQEWSEDRKIPLYATKEYVSAMELVWKRIGVTETCELEGFQNQVLRKG  368

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L   V N+ +N+   HYCG C +
Sbjct  369   CENLGINVENVARNSSERHYCGSCGY  394


 Score = 75.1 bits (183),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 92/177 (52%), Gaps = 19/177 (11%)
 Frame = +2

Query  32   MENNTATKT-----LSPSQMETLSALCNTFLPAIN--EALPETTD-----ASVTNFFQTS  175
            M NN  T       ++ ++ME+L++ C   LP ++  E      D      ++ +FF TS
Sbjct  1    MGNNIDTGNFGHLGITTAEMESLASFCEAVLPPVSPPEEYSGGDDHYRNKETLRSFFFTS  60

Query  176  AASTGTPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPE  355
             + T    +   +I +R          L+L+ L+TR+GTLL+CG   L +++PF+ +F E
Sbjct  61   GSRTPVVRESIELITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSE  120

Query  356  ISQKKRERIVH----SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            +S +KRER++     +W    L  IR  F  +K   L  FF+ V   G+N +W+AIG
Sbjct  121  LSLEKRERVLQKQFRNWL---LTPIRAAFVYIKVAFLFCFFSRVSPNGENLAWEAIG  174



>ref|XP_011080082.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Sesamum indicum]
Length=742

 Score =   160 bits (405),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 134/204 (66%), Gaps = 2/204 (1%)
 Frame = +3

Query  606   PLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL KGII+ +N  E  +   L + G + A+ +     + I+CDAV++GSGCGGGV + VL
Sbjct  193   PLEKGIIEIMNEDESSLKESLMQKGINFAEDEDENV-YKIKCDAVIIGSGCGGGVTAAVL  251

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G KVL+LEKG+Y+   + S LEGP+  +++  GG+L T+D  ++++AG+TVGGGS +
Sbjct  252   AKSGQKVLILEKGHYFVPEDYSGLEGPAFSELYESGGMLTTQDGKIMVMAGTTVGGGSYM  311

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             N S  I+TP Y+L+EW     + LFGS  Y  AMD VC ++GV   C  E FQN VLR+G
Sbjct  312   NLSHWIRTPDYILKEWSTESKIHLFGSHEYQSAMDAVCERIGVTENCVQEGFQNQVLRRG  371

Query  1143  CRELCYPVVNIPQNAPSDHYCGWC  1214
             C  L   V  +P+N+  DHYCG C
Sbjct  372   CENLGLNVEPVPRNSSPDHYCGSC  395


 Score = 71.6 bits (174),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 87/149 (58%), Gaps = 1/149 (1%)
 Frame = +2

Query  71   QMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlns  250
            Q+++L+A+C T +P +     +  DA++ +    S   +  P +VA ++ +R     +  
Sbjct  28   QIQSLAAICQTLIPPLPLDDNDNDDANLLHQPNHSFYKSSGPDEVAELLVKRGIPAAVFI  87

Query  251  lllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNF  427
            + L+L FLS+R+GTLLLCG      ++PF+  F E++ KKRE I+  W+  +L   +R  
Sbjct  88   VSLVLKFLSSRLGTLLLCGWICSDWKWPFVHSFCELTLKKREAILQKWSRETLFLPLRIA  147

Query  428  FTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            F  +K + L VFF+  D+   NP+W+AIG
Sbjct  148  FLLLKIMCLFVFFSWTDENSSNPAWEAIG  176



>ref|XP_002889487.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65746.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
Length=760

 Score =   159 bits (402),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 130/206 (63%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL +GII+    +E     R+   G  V + +    ++ IECDAVVVGSGCGGGV + +L
Sbjct  207   PLDQGIIETAKEDEMTIKQRMINKGLKVTEDRD-SDTYKIECDAVVVGSGCGGGVAAAIL  265

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A +G +V+V+EKGNY+   + S LEGPSM ++F    LLMT D     +AGSTVGGGS V
Sbjct  266   AKSGLRVVVIEKGNYFVPRDYSALEGPSMFELFESNSLLMTHDGRFRFMAGSTVGGGSVV  325

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NW+AS+KTP  ++ EW    G+ ++ S+ Y  AMD V  ++GV  +   E FQN +LRKG
Sbjct  326   NWAASLKTPDAIIEEWSVHRGISVYSSEKYKAAMDRVLKRLGVTEKINSEGFQNRILRKG  385

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C +L   V  +P+N+   H CG C+F
Sbjct  386   CEKLGLDVTIVPRNSTEKHNCGSCSF  411


 Score = 72.4 bits (176),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 88/160 (55%), Gaps = 10/160 (6%)
 Frame = +2

Query  62   SPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGT-PHQVAWVI  217
            S S ++ LSA+C+  +P +          L    + ++ +FF++S + +   P +VA ++
Sbjct  30   SQSDLQALSAICDAIMPPVPLESLNLEMKLKVLRNDALLSFFKSSTSESHVRPDEVAELL  89

Query  218  NQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQ-FPFLLRFPEISQKKRERIVHSW  394
              +     +  + ++L  L+ R+GTLLLCG   L  + +PFLL+F E+S +KRE+++  W
Sbjct  90   ATKAIPLTVLVVRIVLRILTFRLGTLLLCGLVCLDMKNWPFLLKFSEMSLEKREKVLQRW  149

Query  395  ATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAI  511
             T       R  F  +KA+ L  +FT  ++  +NP+W AI
Sbjct  150  NTQWYNPLARIGFMMIKAIFLFYYFTWTNENTENPAWDAI  189



>gb|EMT04470.1| Putative GMC-type oxidoreductase [Aegilops tauschii]
Length=865

 Score =   171 bits (432),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 136/197 (69%), Gaps = 5/197 (3%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSF-VIECDAvvvgsgcgggvisgv  779
             PL KG+++     +  F R +T+ G +V   KP    +  +ECD V+ GSGCGGGV + V
Sbjct  325   PLDKGVLNTKELNDQTFLRSVTEKGLAV---KPGTNQYHTVECDVVIAGSGCGGGVAAAV  381

Query  780   LATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSA  959
             LA+AG KV+V+EKG+Y+   + S +EGPSM++++  GG+L T D    LL+G+TVGGGSA
Sbjct  382   LASAGLKVVVVEKGDYFIADDYSGIEGPSMEQLYENGGILFTSDATTALLSGATVGGGSA  441

Query  960   VNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRK  1139
             VNWSASI+TP  VL+EW + HGL LF S  Y +AMD VC ++GV   C +E FQN VLR+
Sbjct  442   VNWSASIRTPEDVLQEWSQHHGLGLFRSSRYEQAMDAVCKRLGVTARCREEGFQNKVLRR  501

Query  1140  GCRELCYPVVNIPQNAP  1190
             GC+ L  PV  +P+N+P
Sbjct  502   GCKALGIPVQAVPRNSP  518


 Score = 60.1 bits (144),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 5/82 (6%)
 Frame = +2

Query  275  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS--LQFIRNFFTAMKAL  448
            ST+ GTL+LCG+  +S +   + RF  +  +++E  +  W+ +S  L   R  F   K L
Sbjct  228  STKAGTLVLCGRLCISDE---IRRFAHMPLERKEEALKKWSKASWFLLPTRIAFVIFKML  284

Query  449  VLLVFFTSVDDKGDNPSWKAIG  514
               VF+T VD+  DNPSWKAIG
Sbjct  285  CQYVFYTKVDENYDNPSWKAIG  306



>ref|XP_010548742.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=729

 Score =   176 bits (446),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 136/207 (66%), Gaps = 9/207 (4%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRLTKL--GCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgv  779
             PL KGII+  + E+ +  R + L  G  VA+         I CD VVVGSGCGGGV +  
Sbjct  181   PLEKGIIE-TVDEDDISIRQSLLDKGVHVAEDN------TIRCDVVVVGSGCGGGVAAAN  233

Query  780   LATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSA  959
             LA AG KV+VLEKGNY++  + S LEGPSM +++   GL+ T D   ++LAGSTVGGGSA
Sbjct  234   LAMAGLKVVVLEKGNYFSPRDYSSLEGPSMAELYEKSGLMTTVDGKFMVLAGSTVGGGSA  293

Query  960   VNWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRK  1139
             VNWSASI+TP +VL+EW   H ++LF S  Y  AMD V  ++G+   CE E FQN VLRK
Sbjct  294   VNWSASIRTPDHVLQEWSTEHKIKLFNSQEYHSAMDQVMTRLGITESCEREGFQNQVLRK  353

Query  1140  GCRELCYPVVNIPQNAPSDHYCGWCTF  1220
             GC  L   V  +P+N+P DHYCG C +
Sbjct  354   GCERLGLKVEPVPRNSPRDHYCGSCGY  380


 Score = 53.1 bits (126),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 83/170 (49%), Gaps = 26/170 (15%)
 Frame = +2

Query  26   RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDA-----SVTNFFQTSAASTG  190
            RK+E    +   S +Q+++L+A+C T LP      P + D+     S+ +      A  G
Sbjct  16   RKVEG-AYSHGFSLAQIQSLAAICRTLLPP-----PPSLDSFHSQPSLPDEVGEMMARHG  69

Query  191  TPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKK  370
             P  VA V+   +K             LS+R+G+LLLCG   +  ++PFL  F ++    
Sbjct  70   RPEAVA-VVRIVLK------------ILSSRLGSLLLCGTLCIDAKWPFLHTFSQLPLHT  116

Query  371  RERIVHSWATSSLQFI--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            RE I+ +W+  S  F+  R  F  +K   L  FF   D+   NP+W++IG
Sbjct  117  REAILRAWSKQSGVFVPLRITFLLVKFFCLFYFFARADENSKNPAWESIG  166



>ref|NP_001148058.1| oxidoreductase [Zea mays]
 gb|ACG29606.1| oxidoreductase [Zea mays]
Length=768

 Score =   144 bits (362),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 126/206 (61%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRL-TKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  GI++ N   +     L  + G +VA         V ECD V+VGSGCGGGV + VL
Sbjct  214   PLDDGIVETNKENDASLPALLAEKGLTVADDAARNVCRV-ECDVVIVGSGCGGGVAAAVL  272

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG+KV+V+EKG+Y+   + + +E PSM+ ++ GGG + T     +LLAGSTVGGG+AV
Sbjct  273   AAAGHKVVVIEKGDYFTARDYTAIEAPSMEHLYEGGGFVSTLSASALLLAGSTVGGGTAV  332

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  V  EW    GL LF +  Y  AMD V  ++GV   C +E  QN VLRKG
Sbjct  333   NWSACIKTPDDVRGEWARDRGLPLFATGEYAAAMDKVFERLGVTAGCAEEGLQNKVLRKG  392

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L Y V ++ +N+   HYCG C +
Sbjct  393   CERLGYKVESVSRNSSEGHYCGSCGY  418


 Score = 85.1 bits (209),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 85/169 (50%), Gaps = 14/169 (8%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEA----------LPETTDAS---VTNFFQTSAASTG  190
            T   S SQM  L+ALC   +P++  A           PE    S   V  F   SAA   
Sbjct  24   THGFSASQMAALTALCGALVPSLPPADRRNGHHHNPQPEEDGGSSKVVEEFLLASAADPP  83

Query  191  TPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKK  370
             P +VA +++++     L  +  +LW L TR+G+L LCG   LS +FPF+ RF E+  + 
Sbjct  84   VPGEVAELMSRKCLPEALALVRAVLWLLGTRLGSLALCGARCLSWRFPFVRRFDELPLEH  143

Query  371  RERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            RE  +  W+  + L  +R FF   K   L VF++  D+   NP W+AIG
Sbjct  144  REAALRRWSRQTLLPPLRMFFLITKVFCLYVFYSWTDENSKNPHWRAIG  192



>gb|ACN27562.1| unknown [Zea mays]
 gb|AFW63032.1| oxidoreductase [Zea mays]
Length=768

 Score =   144 bits (364),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 125/206 (61%), Gaps = 2/206 (1%)
 Frame = +3

Query  606   PLYKGIIDLNLPEEHVFNRL-TKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgvL  782
             PL  GI++ N   +     L  + G  VA         V ECD V+VGSGCGGGV + VL
Sbjct  214   PLDDGIVETNKENDASLPALLAEKGLRVADDAARNVCRV-ECDVVIVGSGCGGGVAAAVL  272

Query  783   ATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAV  962
             A AG+KV+V+EKGNY+   + + +E PSM+ ++ GGG + T     +LLAGSTVGGG+AV
Sbjct  273   AAAGHKVVVIEKGNYFTARDYTAIEAPSMEHLYEGGGFVSTLSASALLLAGSTVGGGTAV  332

Query  963   NWSASIKTPPYVLREWCEVHGLELFGSDVYXKAMDTVCGKMGVQRECEDESFQNMVLRKG  1142
             NWSA IKTP  V  EW    GL LF +  Y  AMD V  ++GV   C +E  QN VLRKG
Sbjct  333   NWSACIKTPDDVRGEWARDRGLPLFATGEYAAAMDKVFERLGVTAGCAEEGLQNKVLRKG  392

Query  1143  CRELCYPVVNIPQNAPSDHYCGWCTF  1220
             C  L Y V ++ +N+   HYCG C +
Sbjct  393   CERLGYKVESVSRNSSEGHYCGSCGY  418


 Score = 84.3 bits (207),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 85/169 (50%), Gaps = 14/169 (8%)
 Frame = +2

Query  50   TKTLSPSQMETLSALCNTFLPAINEA----------LPETTDAS---VTNFFQTSAASTG  190
            T   S SQM  L+ALC   +P++  A           PE    S   V  F   SAA   
Sbjct  24   THGFSASQMAALTALCGALVPSLPPADRRNGHHHNPQPEEDGGSSKVVEEFLLASAADPP  83

Query  191  TPHQVAWVINQRMKHPKlnslllllwflSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKK  370
             P +VA +++++     L  +  +LW L TR+G+L LCG   LS +FPF+ RF E+  + 
Sbjct  84   VPGEVAELMSRKCLPEALALVRAVLWLLGTRLGSLALCGARCLSWRFPFVRRFDELPLEH  143

Query  371  RERIVHSWAT-SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIG  514
            RE  +  W+  + L  +R FF   K   L VF++  D+   NP W+AIG
Sbjct  144  REAALRRWSRLTLLPPLRMFFLITKVFCLYVFYSWTDENSKNPHWRAIG  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3434935870995