BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1580

Length=996
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797126.1|  PREDICTED: uncharacterized protein LOC104243609    241   5e-72   Nicotiana sylvestris
ref|XP_009592787.1|  PREDICTED: uncharacterized protein LOC104089563    238   7e-71   Nicotiana tomentosiformis
ref|XP_004251462.1|  PREDICTED: uncharacterized protein LOC101257536    236   4e-70   Solanum lycopersicum
ref|XP_011095401.1|  PREDICTED: uncharacterized protein LOC105174869    236   7e-70   Sesamum indicum [beniseed]
ref|XP_006365955.1|  PREDICTED: uncharacterized protein LOC102604282    233   9e-69   Solanum tuberosum [potatoes]
gb|KHG14666.1|  HAUS augmin-like complex subunit 4                      230   1e-68   Gossypium arboreum [tree cotton]
gb|KJB62819.1|  hypothetical protein B456_009G438400                    231   2e-68   Gossypium raimondii
ref|XP_010063011.1|  PREDICTED: uncharacterized protein LOC104450241    232   2e-68   Eucalyptus grandis [rose gum]
ref|XP_002280015.1|  PREDICTED: uncharacterized protein LOC100253742    231   3e-68   Vitis vinifera
ref|XP_006393115.1|  hypothetical protein EUTSA_v10011513mg             230   5e-68   Eutrema salsugineum [saltwater cress]
gb|KJB62817.1|  hypothetical protein B456_009G438400                    230   5e-68   Gossypium raimondii
gb|KJB62818.1|  hypothetical protein B456_009G438400                    230   9e-68   Gossypium raimondii
ref|XP_010545512.1|  PREDICTED: uncharacterized protein LOC104817858    230   1e-67   Tarenaya hassleriana [spider flower]
emb|CDP05762.1|  unnamed protein product                                229   1e-67   Coffea canephora [robusta coffee]
ref|XP_009147810.1|  PREDICTED: uncharacterized protein LOC103871323    229   2e-67   Brassica rapa
emb|CDY37107.1|  BnaC06g03920D                                          229   2e-67   Brassica napus [oilseed rape]
emb|CDY22815.1|  BnaA06g02620D                                          228   3e-67   Brassica napus [oilseed rape]
ref|XP_007020816.1|  HAUS augmin-like complex subunit 4 isoform 2       224   3e-67   
gb|KJB62821.1|  hypothetical protein B456_009G438500                    228   4e-67   Gossypium raimondii
ref|XP_006305844.1|  hypothetical protein CARUB_v10010894mg             228   4e-67   Capsella rubella
ref|XP_002894271.1|  hypothetical protein ARALYDRAFT_474203             228   5e-67   
emb|CDP04568.1|  unnamed protein product                                228   5e-67   Coffea canephora [robusta coffee]
ref|XP_008447737.1|  PREDICTED: uncharacterized protein LOC103490141    228   5e-67   Cucumis melo [Oriental melon]
ref|XP_011658976.1|  PREDICTED: uncharacterized protein LOC101203307    227   1e-66   Cucumis sativus [cucumbers]
gb|EYU27337.1|  hypothetical protein MIMGU_mgv1a006702mg                226   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_010461924.1|  PREDICTED: uncharacterized protein LOC104742601    226   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010500647.1|  PREDICTED: uncharacterized protein LOC104777995    226   3e-66   Camelina sativa [gold-of-pleasure]
gb|EPS64103.1|  hypothetical protein M569_10678                         222   3e-66   Genlisea aurea
ref|XP_007020815.1|  HAUS augmin-like complex subunit 4 isoform 1       225   5e-66   Theobroma cacao [chocolate]
gb|KFK35913.1|  hypothetical protein AALP_AA4G052600                    225   6e-66   Arabis alpina [alpine rockcress]
ref|XP_012070832.1|  PREDICTED: uncharacterized protein LOC105632963    224   1e-65   Jatropha curcas
ref|XP_006452375.1|  hypothetical protein CICLE_v10008353mg             223   3e-65   
ref|XP_002532562.1|  conserved hypothetical protein                     223   5e-65   Ricinus communis
ref|XP_010479537.1|  PREDICTED: uncharacterized protein LOC104758377    222   9e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006452374.1|  hypothetical protein CICLE_v10008353mg             221   3e-64   Citrus clementina [clementine]
ref|XP_010670158.1|  PREDICTED: uncharacterized protein LOC104887254    220   4e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007215411.1|  hypothetical protein PRUPE_ppa005986mg             218   3e-63   Prunus persica
ref|XP_008228485.1|  PREDICTED: uncharacterized protein LOC103327892    218   4e-63   Prunus mume [ume]
ref|XP_010097813.1|  hypothetical protein L484_000961                   216   7e-63   
gb|AAG50783.1|AC079027_6  hypothetical protein, 3' partial              206   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278680.1|  PREDICTED: uncharacterized protein LOC104612800    214   7e-62   Nelumbo nucifera [Indian lotus]
ref|XP_009353594.1|  PREDICTED: uncharacterized protein LOC103944...    214   8e-62   Pyrus x bretschneideri [bai li]
ref|XP_004302887.1|  PREDICTED: uncharacterized protein LOC101313133    213   2e-61   Fragaria vesca subsp. vesca
ref|NP_175486.2|  uncharacterized protein                               210   3e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51195.1|AC079279_16  unknown protein                              210   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380933.1|  PREDICTED: uncharacterized protein LOC103443814    209   1e-59   
gb|ACJ84282.1|  unknown                                                 207   2e-59   Medicago truncatula
gb|KEH27911.1|  SKIP interacting protein                                202   2e-59   Medicago truncatula
gb|KHM99560.1|  HAUS augmin-like complex subunit 4                      208   2e-59   Glycine soja [wild soybean]
ref|NP_001242486.1|  uncharacterized protein LOC100786070               207   2e-59   Glycine max [soybeans]
ref|XP_006858187.1|  PREDICTED: uncharacterized protein LOC18448048     207   3e-59   Amborella trichopoda
ref|XP_003600108.1|  HAUS augmin-like complex subunit                   207   6e-59   Medicago truncatula
ref|XP_008342667.1|  PREDICTED: uncharacterized protein LOC103405443    206   1e-58   Malus domestica [apple tree]
ref|XP_009338054.1|  PREDICTED: uncharacterized protein LOC103930437    206   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_004500070.1|  PREDICTED: uncharacterized protein LOC101512734    206   2e-58   Cicer arietinum [garbanzo]
ref|XP_003551881.1|  PREDICTED: uncharacterized protein LOC100790889    205   3e-58   Glycine max [soybeans]
ref|XP_007146480.1|  hypothetical protein PHAVU_006G044000g             199   3e-56   Phaseolus vulgaris [French bean]
gb|KEH27912.1|  SKIP interacting protein                                199   4e-56   Medicago truncatula
ref|XP_008781277.1|  PREDICTED: uncharacterized protein LOC103701...    192   1e-53   Phoenix dactylifera
ref|XP_008781274.1|  PREDICTED: uncharacterized protein LOC103701...    192   2e-53   Phoenix dactylifera
ref|XP_010935260.1|  PREDICTED: uncharacterized protein LOC105055...    192   2e-53   Elaeis guineensis
ref|XP_010935259.1|  PREDICTED: uncharacterized protein LOC105055...    192   2e-53   Elaeis guineensis
ref|XP_011012481.1|  PREDICTED: uncharacterized protein LOC105116724    189   3e-52   Populus euphratica
gb|KHG12190.1|  Paternally-expressed gene 3 protein                     184   3e-52   Gossypium arboreum [tree cotton]
gb|ABK96275.1|  unknown                                                 186   3e-51   Populus trichocarpa x Populus deltoides
ref|XP_009144940.1|  PREDICTED: uncharacterized protein LOC103868607    185   8e-51   
ref|XP_010276096.1|  PREDICTED: uncharacterized protein LOC104610933    184   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_009420825.1|  PREDICTED: uncharacterized protein LOC104000482    181   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001768748.1|  predicted protein                                  172   1e-45   
ref|XP_007213462.1|  hypothetical protein PRUPE_ppa024388mg             171   2e-45   Prunus persica
ref|XP_008226895.1|  PREDICTED: HAUS augmin-like complex subunit ...    170   3e-45   Prunus mume [ume]
ref|XP_008226894.1|  PREDICTED: HAUS augmin-like complex subunit ...    170   3e-45   Prunus mume [ume]
ref|XP_002989789.1|  hypothetical protein SELMODRAFT_235871             167   4e-44   
ref|XP_007020817.1|  HAUS augmin-like complex subunit 4 isoform 3       164   6e-44   
ref|XP_002990133.1|  hypothetical protein SELMODRAFT_235950             161   6e-42   
ref|XP_008355341.1|  PREDICTED: uncharacterized protein LOC103418998    151   3e-40   
gb|KJB62820.1|  hypothetical protein B456_009G438400                    154   1e-39   Gossypium raimondii
ref|XP_009360992.1|  PREDICTED: uncharacterized protein LOC103951...    152   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_008365005.1|  PREDICTED: HAUS augmin-like complex subunit 4      149   1e-37   
ref|XP_004295822.1|  PREDICTED: uncharacterized protein LOC101299752    143   3e-35   Fragaria vesca subsp. vesca
gb|KHG12191.1|  Macrophage receptor MARCO                               131   2e-32   Gossypium arboreum [tree cotton]
gb|EAZ21518.1|  hypothetical protein OsJ_05142                          132   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009353597.1|  PREDICTED: uncharacterized protein LOC103944...    129   2e-30   
ref|XP_009353598.1|  PREDICTED: uncharacterized protein LOC103944...    128   5e-30   Pyrus x bretschneideri [bai li]
ref|XP_002453194.1|  hypothetical protein SORBIDRAFT_04g001450          127   2e-29   Sorghum bicolor [broomcorn]
ref|XP_003573417.1|  PREDICTED: uncharacterized protein LOC100821831    125   8e-29   
ref|XP_004952114.1|  PREDICTED: uncharacterized protein LOC101756520    124   2e-28   Setaria italica
gb|EAY84227.1|  hypothetical protein OsI_05607                          118   2e-26   Oryza sativa Indica Group [Indian rice]
gb|ACN31535.1|  unknown                                                 109   1e-23   Zea mays [maize]
dbj|BAJ90177.1|  predicted protein                                      109   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002316767.2|  hypothetical protein POPTR_0011s09280g           83.6    1e-14   
ref|XP_008226896.1|  PREDICTED: HAUS augmin-like complex subunit ...  80.1    2e-13   Prunus mume [ume]
ref|XP_006646792.1|  PREDICTED: uncharacterized protein LOC102709140  70.5    4e-10   
ref|NP_001130646.1|  uncharacterized protein LOC100191747             65.9    6e-09   
gb|AFW69843.2|  hypothetical protein ZEAMMB73_576256                  65.9    1e-08   
ref|XP_009360993.1|  PREDICTED: uncharacterized protein LOC103951...  64.3    3e-08   
gb|EMS60102.1|  hypothetical protein TRIUR3_07799                     64.7    4e-08   Triticum urartu
ref|XP_008813609.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.4    2e-06   Phoenix dactylifera



>ref|XP_009797126.1| PREDICTED: uncharacterized protein LOC104243609 [Nicotiana sylvestris]
Length=433

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
            G G+ NLPADVTQLIDQLERHCLAPDGSL+SK+ Y+D QLAREEM+KERQ+YLE+LAVYI
Sbjct  4    GVGSQNLPADVTQLIDQLERHCLAPDGSLVSKSAYFDRQLAREEMSKERQRYLESLAVYI  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA  MVE+YQQA+SV NLGGIRDVQG Y Q+GLKNPPQVYEALEHRMVVAEAAQRLRLPL
Sbjct  64   EATAMVEDYQQAISVANLGGIRDVQGLYSQLGLKNPPQVYEALEHRMVVAEAAQRLRLPL  123

Query  791  ISKDGEVQDDEIEKW  835
            ISKDGE+ +DEIEKW
Sbjct  124  ISKDGEIHEDEIEKW  138



>ref|XP_009592787.1| PREDICTED: uncharacterized protein LOC104089563 [Nicotiana tomentosiformis]
Length=433

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
            G G+ NL ADVTQLIDQLERHCLAPDGSLISK+ Y+DLQLAREEM+KERQ+YLE+LA+YI
Sbjct  4    GVGSQNLAADVTQLIDQLERHCLAPDGSLISKSAYFDLQLAREEMSKERQRYLESLAIYI  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA  MVE+YQQA+SV NLGGIRDVQG Y Q+GLKNPPQVYEALEHRMVVAEAAQRLRLPL
Sbjct  64   EATAMVEDYQQAISVANLGGIRDVQGLYSQLGLKNPPQVYEALEHRMVVAEAAQRLRLPL  123

Query  791  ISKDGEVQDDEIEKW  835
            ISKDGE+ ++EIEKW
Sbjct  124  ISKDGEIHEEEIEKW  138



>ref|XP_004251462.1| PREDICTED: uncharacterized protein LOC101257536 [Solanum lycopersicum]
Length=427

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
            G G+ NLPADV QLIDQL+RHCLAPDGSLISK+ +YDLQLAREEM+KERQ+YLE+LA+YI
Sbjct  4    GLGSQNLPADVAQLIDQLDRHCLAPDGSLISKSAHYDLQLAREEMSKERQRYLESLAIYI  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA  MVE+YQQA+SV NLGG+RDVQG Y Q+GLKNPPQVYEALEHRMVVAEAAQRLRLPL
Sbjct  64   EATAMVEDYQQAISVANLGGMRDVQGLYSQLGLKNPPQVYEALEHRMVVAEAAQRLRLPL  123

Query  791  ISKDGEVQDDEIEKW  835
            ISKDGE+ ++EIEKW
Sbjct  124  ISKDGEIHEEEIEKW  138



>ref|XP_011095401.1| PREDICTED: uncharacterized protein LOC105174869 [Sesamum indicum]
Length=433

 Score =   236 bits (601),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
             A NLPADV+Q++D LERHCLAPDGSLISK+TYYDLQLAREEM KERQ+YLEALAVYIEA
Sbjct  6    AAQNLPADVSQVMDLLERHCLAPDGSLISKSTYYDLQLAREEMCKERQRYLEALAVYIEA  65

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEEYQQA+SV NLGGIRDVQG YPQ+GL+N PQVYEALEHRMVVAEAAQ+LRLPLIS
Sbjct  66   ISMVEEYQQAVSVANLGGIRDVQGLYPQLGLRNSPQVYEALEHRMVVAEAAQKLRLPLIS  125

Query  797  KDGEVQDDEIEKW  835
            KDGE+ ++EIEKW
Sbjct  126  KDGEIHEEEIEKW  138



>ref|XP_006365955.1| PREDICTED: uncharacterized protein LOC102604282 [Solanum tuberosum]
Length=433

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
            G G+ NLPADVTQLIDQL+RHCLA DGSLISK+ +YDLQLARE+M+KERQ+YLE+LA+YI
Sbjct  4    GLGSQNLPADVTQLIDQLDRHCLAHDGSLISKSAHYDLQLAREDMSKERQRYLESLAIYI  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA  MVE+YQQA+SV NLGG+RDVQG Y Q+GLKNPPQVYEALEHRMVVAEAAQRLRLPL
Sbjct  64   EATAMVEDYQQAISVANLGGMRDVQGLYSQLGLKNPPQVYEALEHRMVVAEAAQRLRLPL  123

Query  791  ISKDGEVQDDEIEKW  835
            ISKDGE+ ++EIEKW
Sbjct  124  ISKDGEIHEEEIEKW  138



>gb|KHG14666.1| HAUS augmin-like complex subunit 4 [Gossypium arboreum]
Length=360

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
            G  NLPADV Q+IDQLERHCL+PDGSLISK+ YYDLQLAREEM++ER +YLEA+A+Y EA
Sbjct  4    GVQNLPADVIQVIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYLEAMAIYCEA  63

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQVYE LEHR+VVAEAAQRLRLPLIS
Sbjct  64   IAMVEEYQQAVSVANLGGIRDIQGFYPQLGLKNSPQVYETLEHRLVVAEAAQRLRLPLIS  123

Query  797  KDGEVQDDEIEKW  835
            KDGE+ ++EIEKW
Sbjct  124  KDGEIHEEEIEKW  136



>gb|KJB62819.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=389

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
            G  NLPADV QLIDQLERHCL+PDGSLISK+ YYDLQLAREEM++ER +YLEA+A+Y EA
Sbjct  4    GGQNLPADVIQLIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYLEAMAIYCEA  63

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQVYE LEHR+VVAEAAQRLRLPLIS
Sbjct  64   MAMVEEYQQAVSVANLGGIRDIQGFYPQLGLKNSPQVYETLEHRLVVAEAAQRLRLPLIS  123

Query  797  KDGEVQDDEIEKW  835
            KDGE+ ++EIEKW
Sbjct  124  KDGEIHEEEIEKW  136



>ref|XP_010063011.1| PREDICTED: uncharacterized protein LOC104450241 [Eucalyptus grandis]
 gb|KCW70186.1| hypothetical protein EUGRSUZ_F03470 [Eucalyptus grandis]
Length=436

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  446  NLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGM  625
            NLPADV+QL+DQLERHCLAPDGSL+SK+ YYDLQLAREEM++ER +YLEA+A+Y EA+ M
Sbjct  13   NLPADVSQLVDQLERHCLAPDGSLVSKSAYYDLQLAREEMSRERLRYLEAMAIYCEAIAM  72

Query  626  VEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDG  805
            VEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQVYE LEHR+VVAEAAQRLRLPLISKDG
Sbjct  73   VEEYQQAVSVANLGGIRDLQGLYPQLGLKNAPQVYETLEHRLVVAEAAQRLRLPLISKDG  132

Query  806  EVQDDEIEKWsilsrssldssgtsvtvssssisTNFTNL  922
            E+ +DEIEKWSI+SRSS+DS+ TS+T+SSS+ STN+TN+
Sbjct  133  EIHEDEIEKWSIMSRSSIDSTSTSITISSSANSTNYTNI  171



>ref|XP_002280015.1| PREDICTED: uncharacterized protein LOC100253742 [Vitis vinifera]
 emb|CBI26640.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  434  AGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIE  613
            AG  NLPADVT LIDQLERHCLAPDGSL+SK+ YYDLQLAREEM +ER +Y EA+A+Y E
Sbjct  9    AGGQNLPADVTALIDQLERHCLAPDGSLVSKSAYYDLQLAREEMARERLRYFEAMAIYCE  68

Query  614  AVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLI  793
            A+ MVEEYQQA+SV NLGGIRDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQRLRLPLI
Sbjct  69   AIAMVEEYQQAVSVANLGGIRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQRLRLPLI  128

Query  794  SKDGEVQDDEIEKW  835
            SKDGE+ ++EIEKW
Sbjct  129  SKDGEIHEEEIEKW  142



>ref|XP_006393115.1| hypothetical protein EUTSA_v10011513mg [Eutrema salsugineum]
 gb|ESQ30401.1| hypothetical protein EUTSA_v10011513mg [Eutrema salsugineum]
Length=423

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ YYDLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQA+SV N GG+RDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAVAMVEEYQQAISVANHGGVRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>gb|KJB62817.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=402

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
            G  NLPADV QLIDQLERHCL+PDGSLISK+ YYDLQLAREEM++ER +YLEA+A+Y EA
Sbjct  4    GGQNLPADVIQLIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYLEAMAIYCEA  63

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQVYE LEHR+VVAEAAQRLRLPLIS
Sbjct  64   MAMVEEYQQAVSVANLGGIRDIQGFYPQLGLKNSPQVYETLEHRLVVAEAAQRLRLPLIS  123

Query  797  KDGEVQDDEIEKW  835
            KDGE+ ++EIEKW
Sbjct  124  KDGEIHEEEIEKW  136



>gb|KJB62818.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=425

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
            G  NLPADV QLIDQLERHCL+PDGSLISK+ YYDLQLAREEM++ER +YLEA+A+Y EA
Sbjct  4    GGQNLPADVIQLIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYLEAMAIYCEA  63

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQVYE LEHR+VVAEAAQRLRLPLIS
Sbjct  64   MAMVEEYQQAVSVANLGGIRDIQGFYPQLGLKNSPQVYETLEHRLVVAEAAQRLRLPLIS  123

Query  797  KDGEVQDDEIEKW  835
            KDGE+ ++EIEKW
Sbjct  124  KDGEIHEEEIEKW  136



>ref|XP_010545512.1| PREDICTED: uncharacterized protein LOC104817858 [Tarenaya hassleriana]
Length=427

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L     NLPADV+QLIDQLERHCLAPDGSL++K  YYDLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAGQNLPADVSQLIDQLERHCLAPDGSLVTKTAYYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+SV +LGGIRDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQR
Sbjct  61   MAIYCEAIAMVEEYQQAVSVASLGGIRDVQGLYPQLGLKNSPQVYENLEHRLVVAEAAQR  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>emb|CDP05762.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
            G  A NL ADV QL+DQLERHCLAPDGSLI+K+T+YDLQLAREEM KERQ+YL+ALA+YI
Sbjct  4    GIAAQNLGADVIQLLDQLERHCLAPDGSLIAKSTHYDLQLAREEMCKERQRYLQALAIYI  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA+ MVEEYQQA+SV N GGIRDVQG Y Q+GLKNPPQVYEALEHRMV+AEAAQ+LRLPL
Sbjct  64   EAIAMVEEYQQAVSVANFGGIRDVQGLYSQLGLKNPPQVYEALEHRMVMAEAAQKLRLPL  123

Query  791  ISKDGEVQDDEIEKW  835
            ISKDGE+ ++EIEKW
Sbjct  124  ISKDGEIHEEEIEKW  138



>ref|XP_009147810.1| PREDICTED: uncharacterized protein LOC103871323 [Brassica rapa]
Length=419

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ YYDLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA  MVEEYQQALSV N GG RDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAAAMVEEYQQALSVANHGGTRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>emb|CDY37107.1| BnaC06g03920D [Brassica napus]
Length=419

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ YYDLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA  MVEEYQQALSV N GG RDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAAAMVEEYQQALSVANHGGTRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>emb|CDY22815.1| BnaA06g02620D [Brassica napus]
Length=419

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ YYDLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA  MVEEYQQALSV N GG RDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAAAMVEEYQQALSVANHGGSRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>ref|XP_007020816.1| HAUS augmin-like complex subunit 4 isoform 2 [Theobroma cacao]
 gb|EOY12341.1| HAUS augmin-like complex subunit 4 isoform 2 [Theobroma cacao]
Length=296

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
            G  NLPADV Q+IDQLERHCLAPDGSL+SK+ YYDLQLAREEM++ER +YLEA+A+Y EA
Sbjct  4    GGQNLPADVIQVIDQLERHCLAPDGSLVSKSAYYDLQLAREEMSRERLRYLEAMAIYCEA  63

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQVYE LEHR+VVAEAAQRLRLPLIS
Sbjct  64   IAMVEEYQQAVSVANLGGIRDLQGLYPQLGLKNSPQVYETLEHRLVVAEAAQRLRLPLIS  123

Query  797  KDGEVQDDEIEKW  835
             DGE+ ++EIEKW
Sbjct  124  NDGEIHEEEIEKW  136



>gb|KJB62821.1| hypothetical protein B456_009G438500 [Gossypium raimondii]
Length=418

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
            G  NLPADV Q+IDQLERHCL+PDGSLISK+ YYDLQLAREEM++ER +YLEA+A+Y EA
Sbjct  4    GGQNLPADVIQIIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYLEAMAIYCEA  63

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQVYE LEHR+VVAEAAQRLRLPLIS
Sbjct  64   MAMVEEYQQAVSVANLGGIRDIQGFYPQLGLKNFPQVYETLEHRLVVAEAAQRLRLPLIS  123

Query  797  KDGEVQDDEIEKW  835
            KDGE+ ++EIEKW
Sbjct  124  KDGEIHEEEIEKW  136



>ref|XP_006305844.1| hypothetical protein CARUB_v10010894mg [Capsella rubella]
 gb|EOA38742.1| hypothetical protein CARUB_v10010894mg [Capsella rubella]
Length=423

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ Y DLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYSDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQA+SV N GGIRDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAVAMVEEYQQAISVANHGGIRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>ref|XP_002894271.1| hypothetical protein ARALYDRAFT_474203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70530.1| hypothetical protein ARALYDRAFT_474203 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ Y DLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYSDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQA+SV N GGIRDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAVAMVEEYQQAISVANHGGIRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>emb|CDP04568.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
            G GA NL AD  QL DQLERHCLAPDGSLISK+T+YDLQLAREEM KERQ+YLEALA+YI
Sbjct  4    GIGAQNLGADAIQLSDQLERHCLAPDGSLISKSTHYDLQLAREEMCKERQRYLEALAIYI  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA+ MVEEYQQA+SV N GGIRDVQG Y Q+GLKNPP+VYEALE RMVVAEAAQ+LRLPL
Sbjct  64   EAIAMVEEYQQAVSVANFGGIRDVQGLYSQLGLKNPPEVYEALEQRMVVAEAAQKLRLPL  123

Query  791  ISKDGEVQDDEIEKW  835
            ISKDGE+ ++EIEKW
Sbjct  124  ISKDGEIHEEEIEKW  138



>ref|XP_008447737.1| PREDICTED: uncharacterized protein LOC103490141 [Cucumis melo]
Length=430

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L  G  NLPADVTQ+IDQLERHCLAPDGSL+SK  +YDLQLAREEM++ER +YLEA
Sbjct  1    MVKSLQGGGQNLPADVTQVIDQLERHCLAPDGSLVSKPAHYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+S+ NLGG+RDVQ  YPQ+GLKN PQVYE LEHRMVVAEA+QR
Sbjct  61   MAIYCEAIAMVEEYQQAVSMANLGGVRDVQALYPQLGLKNSPQVYETLEHRMVVAEASQR  120

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGE+ ++EIEK
Sbjct  121  LRLPLISKDGEIHEEEIEK  139



>ref|XP_011658976.1| PREDICTED: uncharacterized protein LOC101203307 [Cucumis sativus]
 gb|KGN44163.1| hypothetical protein Csa_7G210080 [Cucumis sativus]
Length=430

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L  G  NLP DVTQ+IDQLERHCLAPDGSL+SK  +YDLQLAREEM++ER +YLEA
Sbjct  1    MVKSLQGGGQNLPTDVTQVIDQLERHCLAPDGSLVSKPAHYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+S+ NLGG+RDVQ  YPQ+GLKN PQVYE LEHRMVVAEA+QR
Sbjct  61   MAIYCEAIAMVEEYQQAVSMANLGGVRDVQALYPQLGLKNSPQVYETLEHRMVVAEASQR  120

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGE+ ++EIEK
Sbjct  121  LRLPLISKDGEIHEEEIEK  139



>gb|EYU27337.1| hypothetical protein MIMGU_mgv1a006702mg [Erythranthe guttata]
Length=434

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
               NLPADV+ ++DQLERHCLAPDGSLISK+ YYDLQLAREEM KERQ+YLE+LAVYIEA
Sbjct  6    ATQNLPADVSLVMDQLERHCLAPDGSLISKSAYYDLQLAREEMCKERQRYLESLAVYIEA  65

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            V MVEEYQQA+SV +LGGIRD+QG YPQ+GL+N PQVYEALEHRM VAEAAQRLRLPLIS
Sbjct  66   VAMVEEYQQAVSVASLGGIRDLQGLYPQLGLRNIPQVYEALEHRMAVAEAAQRLRLPLIS  125

Query  797  KDGEVQDDEIEKW  835
            KDGE+ ++EIEKW
Sbjct  126  KDGEIHEEEIEKW  138



>ref|XP_010461924.1| PREDICTED: uncharacterized protein LOC104742601 [Camelina sativa]
Length=423

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ Y DLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYSDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQA+SV N GGIRDVQ  YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAVAMVEEYQQAISVANHGGIRDVQSLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>ref|XP_010500647.1| PREDICTED: uncharacterized protein LOC104777995 [Camelina sativa]
Length=423

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ Y DLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYSDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQA+SV N GGIRDVQ  YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAVAMVEEYQQAISVANHGGIRDVQSLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>gb|EPS64103.1| hypothetical protein M569_10678, partial [Genlisea aurea]
Length=298

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
             AHNLPA+V+Q+++QLERHCLAPDGSLISK+ YYDLQLAREEM KERQ+YLEA+AVY+EA
Sbjct  6    AAHNLPAEVSQVVEQLERHCLAPDGSLISKSAYYDLQLAREEMCKERQRYLEAMAVYMEA  65

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEE+QQ +SV NLG IRDV G YPQ+GLKN  QVYE LEHRMVVAEAAQ+LRLPL+S
Sbjct  66   IAMVEEHQQEVSVANLGTIRDVDGLYPQLGLKNSSQVYETLEHRMVVAEAAQKLRLPLVS  125

Query  797  KDGEVQDDEIEKW  835
            KDGEV+ +EIEKW
Sbjct  126  KDGEVRKEEIEKW  138



>ref|XP_007020815.1| HAUS augmin-like complex subunit 4 isoform 1 [Theobroma cacao]
 gb|EOY12340.1| HAUS augmin-like complex subunit 4 isoform 1 [Theobroma cacao]
Length=420

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
            G  NLPADV Q+IDQLERHCLAPDGSL+SK+ YYDLQLAREEM++ER +YLEA+A+Y EA
Sbjct  4    GGQNLPADVIQVIDQLERHCLAPDGSLVSKSAYYDLQLAREEMSRERLRYLEAMAIYCEA  63

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQVYE LEHR+VVAEAAQRLRLPLIS
Sbjct  64   IAMVEEYQQAVSVANLGGIRDLQGLYPQLGLKNSPQVYETLEHRLVVAEAAQRLRLPLIS  123

Query  797  KDGEVQDDEIEKW  835
             DGE+ ++EIEKW
Sbjct  124  NDGEIHEEEIEKW  136



>gb|KFK35913.1| hypothetical protein AALP_AA4G052600 [Arabis alpina]
Length=421

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV  LIDQLERHCLAPDGSL++K+ +YDLQLAREEM++ER +YLEA
Sbjct  1    MVKTLQGAAQNLPADVNHLIDQLERHCLAPDGSLVTKSAFYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y E+V MVEEYQQA+SV N GGIRDVQG YPQ+GLKN  QVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCESVAMVEEYQQAISVANHGGIRDVQGLYPQLGLKNSAQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>ref|XP_012070832.1| PREDICTED: uncharacterized protein LOC105632963 [Jatropha curcas]
 gb|KDP39134.1| hypothetical protein JCGZ_00891 [Jatropha curcas]
Length=435

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK +  G  NLPADV Q+ DQLERHCLAPDGSLISK+ Y DLQ+AREEM++ER +YLEA
Sbjct  1    MVKGVQGGGQNLPADVIQVTDQLERHCLAPDGSLISKSAYCDLQIAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+SV NLG IRD+QG YPQ+ LKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAIAMVEEYQQAVSVANLGSIRDIQGLYPQLSLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLISKDGE+ ++EIEKW
Sbjct  121  LRLPLISKDGEIHEEEIEKW  140



>ref|XP_006452375.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 gb|ESR65615.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
Length=406

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L  G  NLPADV+Q+ID LERHCLAPDGSL+SK+ +YDLQLAREEM++ER +YLEA
Sbjct  1    MVKGLQGGDQNLPADVSQVIDLLERHCLAPDGSLVSKSAHYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVE YQQA+SV NLGGIRDVQG   Q+GLK+ PQVYE LEHR+VVAEAAQR
Sbjct  61   MAIYCEAIAMVEGYQQAVSVANLGGIRDVQGLSSQLGLKSSPQVYETLEHRLVVAEAAQR  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLISKDGE+ +DEIEKW
Sbjct  121  LRLPLISKDGEILEDEIEKW  140



>ref|XP_002532562.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29823.1| conserved hypothetical protein [Ricinus communis]
Length=432

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 122/140 (87%), Gaps = 3/140 (2%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G     +PADV Q+IDQLERHCLAPDGSLISK+ YYDLQLAREEM +ER +YLEA
Sbjct  1    MVKGTG---QTMPADVAQVIDQLERHCLAPDGSLISKSAYYDLQLAREEMCRERLRYLEA  57

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+GMVEEYQQA+SV NLGGIRD+QG YPQ+ LKN PQVYE LEHR+VVAEAAQ+
Sbjct  58   MAIYCEAIGMVEEYQQAVSVGNLGGIRDIQGLYPQLSLKNSPQVYECLEHRLVVAEAAQK  117

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLISKDGE+ ++EIEKW
Sbjct  118  LRLPLISKDGEIHEEEIEKW  137



>ref|XP_010479537.1| PREDICTED: uncharacterized protein LOC104758377 [Camelina sativa]
Length=423

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPD SL++K+ Y DLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDESLVTKSAYSDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQA+SV N GG+RDVQ  YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAVAMVEEYQQAISVANHGGVRDVQSLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ ++EIEKW
Sbjct  121  LRLPLISDDGEIHEEEIEKW  140



>ref|XP_006452374.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 ref|XP_006475067.1| PREDICTED: uncharacterized protein LOC102629463 [Citrus sinensis]
 gb|ESR65614.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 gb|KDO62727.1| hypothetical protein CISIN_1g014093mg [Citrus sinensis]
Length=431

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L  G  NLPADV+Q+ID LERHCLAPDGSL+SK+ +YDLQLAREEM++ER +YLEA
Sbjct  1    MVKGLQGGDQNLPADVSQVIDLLERHCLAPDGSLVSKSAHYDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVE YQQA+SV NLGGIRDVQG   Q+GLK+ PQVYE LEHR+VVAEAAQR
Sbjct  61   MAIYCEAIAMVEGYQQAVSVANLGGIRDVQGLSSQLGLKSSPQVYETLEHRLVVAEAAQR  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLISKDGE+ +DEIEKW
Sbjct  121  LRLPLISKDGEILEDEIEKW  140



>ref|XP_010670158.1| PREDICTED: uncharacterized protein LOC104887254 [Beta vulgaris 
subsp. vulgaris]
Length=430

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 121/140 (86%), Gaps = 2/140 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G    NLPADVTQL++QLERHCLA DGSL+SK+ Y DLQLAREEM +ER +YLEA
Sbjct  1    MVK--GLQQQNLPADVTQLVEQLERHCLASDGSLVSKSAYSDLQLAREEMCRERLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQALSV NLGGIRDV G YPQ+GL+N PQVYE LEHR+VVAEAAQ+
Sbjct  59   MAIYCEAIAMVEEYQQALSVANLGGIRDVPGLYPQLGLRNSPQVYETLEHRLVVAEAAQK  118

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLISKDGE+ ++EIEKW
Sbjct  119  LRLPLISKDGEIHEEEIEKW  138



>ref|XP_007215411.1| hypothetical protein PRUPE_ppa005986mg [Prunus persica]
 gb|EMJ16610.1| hypothetical protein PRUPE_ppa005986mg [Prunus persica]
Length=433

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L     NLP D+TQ+IDQLERHCLAPDGSL+SK+ Y+DLQLAREEM++ER +YLEA
Sbjct  1    MVKGLQQQGQNLPPDLTQVIDQLERHCLAPDGSLVSKSAYFDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+SV NLGGIRDVQG Y Q  LKNPPQ+YE LEHRM+VAEAAQR
Sbjct  61   MAIYGEAIAMVEEYQQAVSVANLGGIRDVQGLYLQSDLKNPPQLYETLEHRMIVAEAAQR  120

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGE+ ++EIEK
Sbjct  121  LRLPLISKDGEIHEEEIEK  139



>ref|XP_008228485.1| PREDICTED: uncharacterized protein LOC103327892 [Prunus mume]
Length=433

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L     NLP D+TQ+IDQLERHCLAPDGSL+SK+ Y+DLQLAREEM++ER +YLEA
Sbjct  1    MVKGLQQQGQNLPPDLTQVIDQLERHCLAPDGSLVSKSAYFDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+SV NLGGIRDVQG Y Q  LKNPPQ+YE LEHRM+VAEAAQR
Sbjct  61   MAIYGEAIAMVEEYQQAVSVANLGGIRDVQGLYLQSDLKNPPQLYETLEHRMIVAEAAQR  120

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGE+ ++EIEK
Sbjct  121  LRLPLISKDGEIHEEEIEK  139



>ref|XP_010097813.1| hypothetical protein L484_000961 [Morus notabilis]
 gb|EXB72071.1| hypothetical protein L484_000961 [Morus notabilis]
Length=408

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L  G  NLPADVTQ+I+QLERHCLA DGSL+SK+ +YDLQLAREEM +ER +YLEA
Sbjct  1    MVKGLQQG-QNLPADVTQVIEQLERHCLAADGSLVSKSAHYDLQLAREEMARERLRYLEA  59

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ M EEYQ A+SV NLGGIRD+QG Y Q+GLKN PQVYE LEHRMVVAEAAQR
Sbjct  60   MAIYSEAIAMTEEYQHAVSVANLGGIRDLQGSYMQLGLKNSPQVYETLEHRMVVAEAAQR  119

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGEV++DEIEK
Sbjct  120  LRLPLISKDGEVREDEIEK  138



>gb|AAG50783.1|AC079027_6 hypothetical protein, 3' partial [Arabidopsis thaliana]
Length=138

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ Y DLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSVYSDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQA+SV N GGIRDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAVAMVEEYQQAISVANHGGIRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLIS  796
            LRLPLIS
Sbjct  121  LRLPLIS  127



>ref|XP_010278680.1| PREDICTED: uncharacterized protein LOC104612800 [Nelumbo nucifera]
 ref|XP_010278681.1| PREDICTED: uncharacterized protein LOC104612800 [Nelumbo nucifera]
Length=434

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
            G     LPADVTQLI+QLERHCLAPDGS++SK+ YYDLQLAREE+++ER +YLEA+A+Y 
Sbjct  4    GLQVQGLPADVTQLIEQLERHCLAPDGSMVSKSAYYDLQLAREELSRERLRYLEAMAIYC  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA+ MVEEYQQA+SV NLGGIRDV G YPQ+GLK+ PQVYE+LEHR+V+AEAAQRLRLPL
Sbjct  64   EAIAMVEEYQQAVSVANLGGIRDVHGLYPQLGLKSSPQVYESLEHRLVIAEAAQRLRLPL  123

Query  791  ISKDGEVQDDEIEK  832
            +SKDGE+ ++EI+K
Sbjct  124  LSKDGEIHEEEIDK  137



>ref|XP_009353594.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009353595.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009353596.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
Length=435

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  446  NLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGM  625
            NLP+D+TQ+IDQLERHCLAPDGSL+SK+ Y DLQL REEM++ER +YLEA+A+Y EA+ M
Sbjct  12   NLPSDLTQVIDQLERHCLAPDGSLVSKSAYLDLQLGREEMSRERLRYLEAMALYSEAIAM  71

Query  626  VEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDG  805
            VEEYQQA+SV NLGGIRDVQG Y Q+GLKNPPQ+YE LEHRM+V+EAAQRLRLPLISKDG
Sbjct  72   VEEYQQAVSVANLGGIRDVQGLYLQLGLKNPPQLYETLEHRMIVSEAAQRLRLPLISKDG  131

Query  806  EVQDDEIEK  832
            E+ ++EIEK
Sbjct  132  EIHEEEIEK  140



>ref|XP_004302887.1| PREDICTED: uncharacterized protein LOC101313133 [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK     A NLPAD+TQ+IDQLERHCLAPD SL+SK+ YYDLQLAREEM+KER +YLEA
Sbjct  1    MVKGGVQQAQNLPADLTQVIDQLERHCLAPDASLVSKSAYYDLQLAREEMSKERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+S+ NLGG RDVQG Y Q+GLK+ PQ+YE LEHRM+VAEAAQR
Sbjct  61   MALYSEAMAMVEEYQQAVSMANLGGSRDVQGVYQQLGLKSSPQLYETLEHRMIVAEAAQR  120

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGE+ ++EIEK
Sbjct  121  LRLPLISKDGEIHEEEIEK  139



>ref|NP_175486.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42179.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63929.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32582.1| uncharacterized protein AT1G50710 [Arabidopsis thaliana]
Length=423

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ Y DLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSVYSDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQA+SV N GGIRDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAVAMVEEYQQAISVANHGGIRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS  GE+ ++EIEKW
Sbjct  121  LRLPLISDGGEIHEEEIEKW  140



>gb|AAG51195.1|AC079279_16 unknown protein [Arabidopsis thaliana]
Length=420

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A NLPADV QLIDQLERHCLAPDGSL++K+ Y DLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSVYSDLQLAREEMSRERLRYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQA+SV N GGIRDVQG YPQ+GLKN PQVYE LEHR+VVAEAAQ+
Sbjct  61   MAIYCEAVAMVEEYQQAISVANHGGIRDVQGLYPQLGLKNSPQVYETLEHRLVVAEAAQK  120

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS  GE+ ++EIEKW
Sbjct  121  LRLPLISDGGEIHEEEIEKW  140



>ref|XP_008380933.1| PREDICTED: uncharacterized protein LOC103443814 [Malus domestica]
Length=455

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +2

Query  446  NLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGM  625
            NLP+D+TQ+IDQLERHCLA DGSL+SK+ Y DLQLAREEM++ER +YLEA+A+Y EA  M
Sbjct  12   NLPSDLTQVIDQLERHCLASDGSLVSKSAYLDLQLAREEMSRERLRYLEAMALYSEAXAM  71

Query  626  VEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDG  805
            VEEYQQA+SV NLGGIRDVQG Y Q+G KNPPQ+YE LEHRM+V+EAAQRLRLPLISKDG
Sbjct  72   VEEYQQAVSVXNLGGIRDVQGLYLQLGXKNPPQLYETLEHRMIVSEAAQRLRLPLISKDG  131

Query  806  EVQDDEIEK  832
            E+ ++EIEK
Sbjct  132  EIHEEEIEK  140



>gb|ACJ84282.1| unknown [Medicago truncatula]
Length=393

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G  + NLP DV+QLIDQLERHCLAPDGSLISK  Y DLQLAREEM +ER +YLEA
Sbjct  1    MVK--GLHSQNLPTDVSQLIDQLERHCLAPDGSLISKPLYNDLQLAREEMCRERLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
             A+Y EA+ MVEEY QA+S  ++GGIRD  G YPQ GL+N PQVY+ LEH+M+VAEAAQR
Sbjct  59   TAIYSEAIAMVEEYHQAISGSSIGGIRDTGGLYPQFGLRNSPQVYQTLEHQMIVAEAAQR  118

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLP+ISKDGEV DDEIEK
Sbjct  119  LRLPMISKDGEVHDDEIEK  137



>gb|KEH27911.1| SKIP interacting protein [Medicago truncatula]
Length=223

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G  + NLP DV+QLIDQLERHCLAPDGSLISK  Y DLQLAREEM +E+ +YLEA
Sbjct  1    MVK--GLHSQNLPTDVSQLIDQLERHCLAPDGSLISKPLYNDLQLAREEMCREKLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
             A+Y EA+ MVEEY QA+S  ++GGIRD  G YPQ G++N PQVY+ LEH+M+VAEAAQ+
Sbjct  59   TAIYSEAIAMVEEYHQAISGSSIGGIRDTGGLYPQFGIRNSPQVYQTLEHQMIVAEAAQQ  118

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLIS+DGEV DDEIEK
Sbjct  119  LRLPLISEDGEVHDDEIEK  137



>gb|KHM99560.1| HAUS augmin-like complex subunit 4 [Glycine soja]
Length=425

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G    NLPA V QL+DQLERHC APDGSLISK  + DLQLAREEM +ER +YLEA
Sbjct  1    MVK--GLHGQNLPAHVAQLVDQLERHCFAPDGSLISKPLFNDLQLAREEMCRERLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+SV NLGGIRD    YPQ+GLKN PQVY+ LEH+MVVAEAAQR
Sbjct  59   MAIYSEAIAMVEEYQQAISVSNLGGIRDTGNLYPQLGLKNSPQVYQTLEHQMVVAEAAQR  118

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGEV D++IEK
Sbjct  119  LRLPLISKDGEVHDEDIEK  137



>ref|NP_001242486.1| uncharacterized protein LOC100786070 [Glycine max]
 gb|ACU20702.1| unknown [Glycine max]
Length=425

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G    NLPA V QL+DQLERHC APDGSLISK  + DLQLAREEM +ER +YLEA
Sbjct  1    MVK--GLHGQNLPAHVAQLVDQLERHCFAPDGSLISKPLFNDLQLAREEMCRERLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+SV NLGGIRD    YPQ+GLKN PQVY+ LEH+MVVAEAAQR
Sbjct  59   MAIYSEAIAMVEEYQQAISVSNLGGIRDTGNLYPQLGLKNSPQVYQTLEHQMVVAEAAQR  118

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGEV D++IEK
Sbjct  119  LRLPLISKDGEVHDEDIEK  137



>ref|XP_006858187.1| PREDICTED: uncharacterized protein LOC18448048 [Amborella trichopoda]
 gb|ERN19654.1| hypothetical protein AMTR_s00062p00162950 [Amborella trichopoda]
Length=435

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            M K +  G  +LP+D++QLI+QLERHCLAPDGS   K++YYDLQLAREEM++ER  YLEA
Sbjct  1    MAKPVILGQQSLPSDISQLIEQLERHCLAPDGSGTCKSSYYDLQLAREEMSRERLYYLEA  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +AVY EAV MVEEYQQA+SV N+GGIRD+Q  YPQ+GLK+ PQVYE+LE R+VVAEA QR
Sbjct  61   MAVYCEAVAMVEEYQQAVSVANVGGIRDLQSLYPQLGLKSSPQVYESLERRLVVAEATQR  120

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPL+SKDGE+ ++EIEK
Sbjct  121  LRLPLLSKDGEIHEEEIEK  139



>ref|XP_003600108.1| HAUS augmin-like complex subunit [Medicago truncatula]
 gb|AES70359.1| SKIP interacting protein [Medicago truncatula]
Length=424

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G  + NLP DV+QLIDQLERHCLAPDGSLISK  Y DLQLAREEM +ER +YLEA
Sbjct  1    MVK--GLHSQNLPTDVSQLIDQLERHCLAPDGSLISKPLYNDLQLAREEMCRERLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
             A+Y EA+ MVEEY QA+S  ++GGIRD  G YPQ GL+N PQVY+ LEH+M+VAEAAQR
Sbjct  59   TAIYSEAIAMVEEYHQAISGSSIGGIRDTGGLYPQFGLRNSPQVYQTLEHQMIVAEAAQR  118

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLP+ISKDGEV DDEIEK
Sbjct  119  LRLPMISKDGEVHDDEIEK  137



>ref|XP_008342667.1| PREDICTED: uncharacterized protein LOC103405443 [Malus domestica]
Length=430

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 117/129 (91%), Gaps = 5/129 (4%)
 Frame = +2

Query  446  NLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGM  625
            NLP+D+TQ+IDQLERHCLAPDGSL+SK+ Y+DLQLAREEM++ER +YLEA+A+Y EA+ M
Sbjct  12   NLPSDLTQVIDQLERHCLAPDGSLVSKSAYFDLQLAREEMSRERLRYLEAMALYSEAIAM  71

Query  626  VEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDG  805
            VEEYQQA+SV NLGGIRD+     Q+GLKNPPQ+YE LEHRM+V+EAAQRLRLPLISKDG
Sbjct  72   VEEYQQAVSVANLGGIRDL-----QLGLKNPPQLYETLEHRMIVSEAAQRLRLPLISKDG  126

Query  806  EVQDDEIEK  832
            E+ ++EIEK
Sbjct  127  EIHEEEIEK  135



>ref|XP_009338054.1| PREDICTED: uncharacterized protein LOC103930437 [Pyrus x bretschneideri]
 ref|XP_009338055.1| PREDICTED: uncharacterized protein LOC103930438 [Pyrus x bretschneideri]
Length=430

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 117/129 (91%), Gaps = 5/129 (4%)
 Frame = +2

Query  446  NLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGM  625
            NLP+D+TQ+IDQLERHCLAPDGSL+SK+ Y+DLQLAREEM++ER +YLEA+A+Y EA+ M
Sbjct  12   NLPSDLTQVIDQLERHCLAPDGSLVSKSAYFDLQLAREEMSRERLRYLEAMALYSEAIAM  71

Query  626  VEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDG  805
            VEEYQQA+SV NLGGIRD+     Q+GLKNPPQ+YE LEHRM+V+EAAQRLRLPLISKDG
Sbjct  72   VEEYQQAVSVANLGGIRDL-----QLGLKNPPQLYETLEHRMIVSEAAQRLRLPLISKDG  126

Query  806  EVQDDEIEK  832
            E+ ++EIEK
Sbjct  127  EIHEEEIEK  135



>ref|XP_004500070.1| PREDICTED: uncharacterized protein LOC101512734 [Cicer arietinum]
Length=431

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G    NLP DV Q++DQLERHCLAPDGSLISK  Y DLQLAREEM +ER +YLEA
Sbjct  1    MVK--GLHGQNLPTDVAQVVDQLERHCLAPDGSLISKPLYNDLQLAREEMCRERLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEY QA+SV ++GGIRD  G YPQ GL+N PQVY+ LEH+M+VAEAAQR
Sbjct  59   MAIYSEAIAMVEEYHQAISVSSIGGIRDTGGLYPQFGLRNTPQVYQTLEHQMIVAEAAQR  118

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGEV D++IEK
Sbjct  119  LRLPLISKDGEVHDEDIEK  137



>ref|XP_003551881.1| PREDICTED: uncharacterized protein LOC100790889 [Glycine max]
 gb|KHN02840.1| HAUS augmin-like complex subunit 4 [Glycine soja]
Length=425

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G    NLPADV Q++DQLERHC APDGSLIS+  + DLQLAREEM +ER +YLEA
Sbjct  1    MVK--GLHGQNLPADVAQVVDQLERHCFAPDGSLISRPLFNDLQLAREEMCRERLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA+SV NLGGIRD    YPQ+GL+  PQVY+ LEH+MVVAEAAQR
Sbjct  59   MAIYSEAIAMVEEYQQAISVSNLGGIRDTGNLYPQLGLRTSPQVYQTLEHQMVVAEAAQR  118

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGEV D++IEK
Sbjct  119  LRLPLISKDGEVHDEDIEK  137



>ref|XP_007146480.1| hypothetical protein PHAVU_006G044000g [Phaseolus vulgaris]
 gb|ESW18474.1| hypothetical protein PHAVU_006G044000g [Phaseolus vulgaris]
Length=425

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G    +LPADV Q++D LERHC A DGSLISK  + DLQLAREEM +ER +YLEA
Sbjct  1    MVK--GLHGQSLPADVAQVVDHLERHCFASDGSLISKPLFNDLQLAREEMCRERLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVEEYQQA SV NLGGIRD    YPQ+GL+N PQVY+ LEH+MVVAEAAQR
Sbjct  59   MAIYSEAIAMVEEYQQATSVSNLGGIRDTGNLYPQLGLRNSPQVYQTLEHQMVVAEAAQR  118

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLISKDGEV D++IEK
Sbjct  119  LRLPLISKDGEVHDEDIEK  137



>gb|KEH27912.1| SKIP interacting protein [Medicago truncatula]
Length=424

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK  G  + NLP DV+QLIDQLERHCLAPDGSLISK  Y DLQLAREEM +E+ +YLEA
Sbjct  1    MVK--GLHSQNLPTDVSQLIDQLERHCLAPDGSLISKPLYNDLQLAREEMCREKLRYLEA  58

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
             A+Y EA+ MVEEY  A+S  ++GGIRD  G YPQ G++N PQVY+ LEH+M+VAEAAQ+
Sbjct  59   TAIYSEAIAMVEEYHHAISGSSIGGIRDTGGLYPQFGIRNSPQVYQTLEHQMIVAEAAQQ  118

Query  776  LRLPLISKDGEVQDDEIEK  832
            LRLPLIS+DGEV DDEIEK
Sbjct  119  LRLPLISEDGEVHDDEIEK  137



>ref|XP_008781277.1| PREDICTED: uncharacterized protein LOC103701092 isoform X2 [Phoenix 
dactylifera]
Length=433

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
             A + +LPADVT LIDQLERHCLAPDGS +SK+ + DLQLARE+M +ER +YLEA+AV  
Sbjct  4    NAQSQSLPADVTHLIDQLERHCLAPDGSYVSKSAHADLQLAREDMARERTRYLEAMAVCC  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA+ MVEEY QA+S  NLGG RD+QG + Q+GL   PQVYE+LEHR+ VAEAAQRLRLPL
Sbjct  64   EAIAMVEEYHQAVSAANLGGARDIQGLHQQLGLNCSPQVYESLEHRLAVAEAAQRLRLPL  123

Query  791  ISKDGEVQDDEIEK  832
            +SKDGE+ ++EIEK
Sbjct  124  LSKDGEIHEEEIEK  137



>ref|XP_008781274.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781275.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781276.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
Length=434

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
             A + +LPADVT LIDQLERHCLAPDGS +SK+ + DLQLARE+M +ER +YLEA+AV  
Sbjct  4    NAQSQSLPADVTHLIDQLERHCLAPDGSYVSKSAHADLQLAREDMARERTRYLEAMAVCC  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA+ MVEEY QA+S  NLGG RD+QG + Q+GL   PQVYE+LEHR+ VAEAAQRLRLPL
Sbjct  64   EAIAMVEEYHQAVSAANLGGARDIQGLHQQLGLNCSPQVYESLEHRLAVAEAAQRLRLPL  123

Query  791  ISKDGEVQDDEIEK  832
            +SKDGE+ ++EIEK
Sbjct  124  LSKDGEIHEEEIEK  137



>ref|XP_010935260.1| PREDICTED: uncharacterized protein LOC105055203 isoform X2 [Elaeis 
guineensis]
Length=435

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
             A + +LPADVT LIDQLERH LAPDGS +SK+ + DLQLAREEM +ER +YLEA+AVY 
Sbjct  4    NAQSQSLPADVTHLIDQLERHSLAPDGSYVSKSAHADLQLAREEMARERTRYLEAMAVYC  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGH--YPQIGLKNPPQVYEALEHRMVVAEAAQRLRL  784
            EA+ MVEEY QA+S  NLGG+RD+QG   Y Q+GL   PQVYE+LEHR+ VAEAAQRLRL
Sbjct  64   EAISMVEEYHQAVSAANLGGLRDIQGQAFYQQLGLNCSPQVYESLEHRLAVAEAAQRLRL  123

Query  785  PLISKDGEVQDDEIEK  832
            PL+SKDGE+ ++EIEK
Sbjct  124  PLLSKDGEIHEEEIEK  139



>ref|XP_010935259.1| PREDICTED: uncharacterized protein LOC105055203 isoform X1 [Elaeis 
guineensis]
Length=436

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
             A + +LPADVT LIDQLERH LAPDGS +SK+ + DLQLAREEM +ER +YLEA+AVY 
Sbjct  4    NAQSQSLPADVTHLIDQLERHSLAPDGSYVSKSAHADLQLAREEMARERTRYLEAMAVYC  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGH--YPQIGLKNPPQVYEALEHRMVVAEAAQRLRL  784
            EA+ MVEEY QA+S  NLGG+RD+QG   Y Q+GL   PQVYE+LEHR+ VAEAAQRLRL
Sbjct  64   EAISMVEEYHQAVSAANLGGLRDIQGQAFYQQLGLNCSPQVYESLEHRLAVAEAAQRLRL  123

Query  785  PLISKDGEVQDDEIEK  832
            PL+SKDGE+ ++EIEK
Sbjct  124  PLLSKDGEIHEEEIEK  139



>ref|XP_011012481.1| PREDICTED: uncharacterized protein LOC105116724 [Populus euphratica]
Length=430

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 11/143 (8%)
 Frame = +2

Query  416  MVKELGAGAHN--LPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYL  589
            MVK  G G  N  L ADV+Q+IDQLERHCLAPDGSL+SK+ + DLQLAREEM++ER +YL
Sbjct  1    MVK--GGGLQNPGLAADVSQVIDQLERHCLAPDGSLVSKSAFSDLQLAREEMSRERLRYL  58

Query  590  EALAVYIEAVGMVEEY-QQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEA  766
            E+LA+Y EA+ MVEEY QQ +S+ NLGGIRDVQG        + PQVYE LEHR+VVAEA
Sbjct  59   ESLAIYCEAIAMVEEYQQQGVSMANLGGIRDVQGS------NSSPQVYETLEHRLVVAEA  112

Query  767  AQRLRLPLISKDGEVQDDEIEKW  835
            AQ+LRLPLISKDGE+ ++EIEKW
Sbjct  113  AQKLRLPLISKDGEIHEEEIEKW  135



>gb|KHG12190.1| Paternally-expressed gene 3 protein [Gossypium arboreum]
Length=242

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 107/145 (74%), Gaps = 25/145 (17%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK    G  NLPAD+ Q+IDQLERHCL+PDGSLISK+ YYDLQLA              
Sbjct  1    MVK----GGQNLPADIIQVIDQLERHCLSPDGSLISKSAYYDLQLA--------------  42

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQ-----VYEALEHRMVVA  760
              +Y EA+ MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQ     +   LEHR+VVA
Sbjct  43   --IYCEAIAMVEEYQQAVSVANLGGIRDIQGFYPQLGLKNSPQSKRDLLTPTLEHRLVVA  100

Query  761  EAAQRLRLPLISKDGEVQDDEIEKW  835
            EAAQRLRLPLISKDGE+ ++EIEKW
Sbjct  101  EAAQRLRLPLISKDGEIHEEEIEKW  125



>gb|ABK96275.1| unknown [Populus trichocarpa x Populus deltoides]
Length=429

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 115/143 (80%), Gaps = 12/143 (8%)
 Frame = +2

Query  416  MVKELGAGAHN--LPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYL  589
            MVK    G  N  L ADV+Q+IDQLERHCLAPDGSL+SK+ + DLQLARE+M++ER +YL
Sbjct  1    MVK---GGVQNPGLAADVSQVIDQLERHCLAPDGSLVSKSAFSDLQLAREDMSRERLRYL  57

Query  590  EALAVYIEAVGMVEEY-QQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEA  766
            EALA+Y EA+ MVEEY QQ +S+ NLGGIRDVQG        + PQVYE LEHR+VVAEA
Sbjct  58   EALAIYCEAIAMVEEYQQQGVSMANLGGIRDVQGS------NSSPQVYETLEHRLVVAEA  111

Query  767  AQRLRLPLISKDGEVQDDEIEKW  835
            AQ+LRLPLISKDGE+ ++EIEKW
Sbjct  112  AQKLRLPLISKDGEIHEEEIEKW  134



>ref|XP_009144940.1| PREDICTED: uncharacterized protein LOC103868607 [Brassica rapa]
 emb|CDY29600.1| BnaA05g15700D [Brassica napus]
Length=406

 Score =   185 bits (469),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 110/140 (79%), Gaps = 13/140 (9%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK L   A     DV QL+DQLERHCLAPDGSL++K+ YYDLQLAREEM++ER +YLEA
Sbjct  1    MVKALQGAA-----DVNQLMDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYLEA  55

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EAV MVEEYQQALS+ N  G RDVQG +        PQVYE LEHR+VVAEAAQ+
Sbjct  56   MAIYCEAVAMVEEYQQALSLPNHVGTRDVQGLF--------PQVYETLEHRLVVAEAAQK  107

Query  776  LRLPLISKDGEVQDDEIEKW  835
            LRLPLIS DGE+ +++IEKW
Sbjct  108  LRLPLISDDGEIHEEDIEKW  127



>ref|XP_010276096.1| PREDICTED: uncharacterized protein LOC104610933 [Nelumbo nucifera]
Length=430

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  431  GAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYI  610
            G     L ADVTQLI+QLERHCLAPDGS+ SK+ YYDLQLAREEM +ER  YLEA+A+Y 
Sbjct  4    GLQTEGLAADVTQLIEQLERHCLAPDGSMTSKSAYYDLQLAREEMLRERLHYLEAMAIYC  63

Query  611  EAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            EA+GMVEEYQ+A+SV +LGGI DV G YP+  LK  PQVYE+LEHR+VVAEAAQ+LR PL
Sbjct  64   EAIGMVEEYQKAVSVASLGGISDVHGLYPEFDLKISPQVYESLEHRLVVAEAAQKLRFPL  123

Query  791  ISK  799
            +SK
Sbjct  124  LSK  126



>ref|XP_009420825.1| PREDICTED: uncharacterized protein LOC104000482 [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +2

Query  446  NLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGM  625
            NLP DV  L+DQLERHCLAPDGS +SKA + DLQLAREEM++ER +YLEA+AVY EA+ +
Sbjct  9    NLPVDVAHLVDQLERHCLAPDGSHVSKAAFSDLQLAREEMSRERMRYLEAMAVYCEAIAV  68

Query  626  VEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDG  805
            VEEYQQA+S  N+GG++D+    PQ+GL   P V E+LEH + VAEA+QRLRLPL+SKDG
Sbjct  69   VEEYQQAVSAANIGGVKDIPVLQPQLGLNCSPLVCESLEHWLAVAEASQRLRLPLLSKDG  128

Query  806  EVQDDEIEK  832
            E+ ++EIEK
Sbjct  129  EIHEEEIEK  137



>ref|XP_001768748.1| predicted protein [Physcomitrella patens]
 gb|EDQ66480.1| predicted protein [Physcomitrella patens]
Length=433

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +2

Query  416  MVKE--LGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYL  589
            MVK   L A A  L   V+ L+DQLERHCLAPD SL+SK  Y DL  AREEM +ER +YL
Sbjct  1    MVKAMLLPAPATALGQGVSALLDQLERHCLAPDASLVSKPAYLDLLQAREEMARERLRYL  60

Query  590  EALAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAA  769
            EALAVY EAV +VEEYQ ALS+ N+GGIRD+   + Q+GL++ PQVY+ALE R+VVAEA 
Sbjct  61   EALAVYGEAVALVEEYQHALSIANVGGIRDLNTVFDQLGLRSSPQVYDALEQRLVVAEAT  120

Query  770  QRLRLPLISKDGEVQDDEIEKW  835
            QRLRLPL+SKDG++ +D+ ++W
Sbjct  121  QRLRLPLLSKDGDLPEDDNQEW  142



>ref|XP_007213462.1| hypothetical protein PRUPE_ppa024388mg [Prunus persica]
 gb|EMJ14661.1| hypothetical protein PRUPE_ppa024388mg [Prunus persica]
Length=414

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 101/140 (72%), Gaps = 21/140 (15%)
 Frame = +2

Query  416  MVKELG-AGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLE  592
            MVK L   G  NLP DVT LIDQLERHCLAPD SL+SK+ Y+DLQLAREEM+ ER +YLE
Sbjct  1    MVKGLQLPGQQNLPPDVTHLIDQLERHCLAPDASLVSKSAYFDLQLAREEMSNERLRYLE  60

Query  593  ALAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQ  772
            A+A+Y EA+ MVEEY+Q                    GL N PQ+YE LEHRM +AEAAQ
Sbjct  61   AMAIYSEAIAMVEEYEQ--------------------GLSNSPQLYETLEHRMTIAEAAQ  100

Query  773  RLRLPLISKDGEVQDDEIEK  832
            RLRLPLISKDGE+ +DEIEK
Sbjct  101  RLRLPLISKDGEIHEDEIEK  120



>ref|XP_008226895.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X2 [Prunus 
mume]
Length=414

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 101/140 (72%), Gaps = 21/140 (15%)
 Frame = +2

Query  416  MVKELG-AGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLE  592
            MVK L   G  NLP DVT LIDQLERHCLAPD SL+SK+ Y+DLQLAREEM+ ER +YLE
Sbjct  1    MVKGLQLPGQQNLPPDVTHLIDQLERHCLAPDASLVSKSAYFDLQLAREEMSNERLRYLE  60

Query  593  ALAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQ  772
            A+A+Y EA+ MVEEY+Q                    GL N PQ+YE LEHRM +AEAAQ
Sbjct  61   AMAIYSEAIAMVEEYEQ--------------------GLNNSPQLYETLEHRMTIAEAAQ  100

Query  773  RLRLPLISKDGEVQDDEIEK  832
            RLRLPL+SKDGE+ +DEIEK
Sbjct  101  RLRLPLLSKDGEIHEDEIEK  120



>ref|XP_008226894.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X1 [Prunus 
mume]
Length=415

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 101/140 (72%), Gaps = 21/140 (15%)
 Frame = +2

Query  416  MVKELG-AGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLE  592
            MVK L   G  NLP DVT LIDQLERHCLAPD SL+SK+ Y+DLQLAREEM+ ER +YLE
Sbjct  1    MVKGLQLPGQQNLPPDVTHLIDQLERHCLAPDASLVSKSAYFDLQLAREEMSNERLRYLE  60

Query  593  ALAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQ  772
            A+A+Y EA+ MVEEY+Q                    GL N PQ+YE LEHRM +AEAAQ
Sbjct  61   AMAIYSEAIAMVEEYEQ--------------------GLNNSPQLYETLEHRMTIAEAAQ  100

Query  773  RLRLPLISKDGEVQDDEIEK  832
            RLRLPL+SKDGE+ +DEIEK
Sbjct  101  RLRLPLLSKDGEIHEDEIEK  120



>ref|XP_002989789.1| hypothetical protein SELMODRAFT_235871 [Selaginella moellendorffii]
 gb|EFJ09056.1| hypothetical protein SELMODRAFT_235871 [Selaginella moellendorffii]
Length=392

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  461  VTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGMVEEYQ  640
            + QL++QL RHCLAPDGS ++KA YYDL  AREEM +ER ++LE +A Y EAV +VEE+Q
Sbjct  6    LAQLVEQLNRHCLAPDGSYVAKAAYYDLVQAREEMGRERLRFLEVMAAYSEAVTLVEEFQ  65

Query  641  QALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEVQDD  820
            QA+SV N GGIRDVQ  + Q+GL++ PQVYEALE R+ VAEA QRLRLP ++KDG++ D+
Sbjct  66   QAISVANAGGIRDVQALFLQLGLRSTPQVYEALEERLAVAEACQRLRLPSVTKDGDILDE  125

Query  821  EIEK  832
            E EK
Sbjct  126  EAEK  129



>ref|XP_007020817.1| HAUS augmin-like complex subunit 4 isoform 3 [Theobroma cacao]
 gb|EOY12342.1| HAUS augmin-like complex subunit 4 isoform 3 [Theobroma cacao]
Length=313

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  437  GAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEA  616
            G  NLPADV Q+IDQLERHCLAPDGSL+SK+ YYDLQLAREEM++ER +YLEA+A+Y EA
Sbjct  4    GGQNLPADVIQVIDQLERHCLAPDGSLVSKSAYYDLQLAREEMSRERLRYLEAMAIYCEA  63

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQ  724
            + MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQ
Sbjct  64   IAMVEEYQQAVSVANLGGIRDLQGLYPQLGLKNSPQ  99



>ref|XP_002990133.1| hypothetical protein SELMODRAFT_235950 [Selaginella moellendorffii]
 gb|EFJ08850.1| hypothetical protein SELMODRAFT_235950 [Selaginella moellendorffii]
Length=401

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +2

Query  461  VTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGMVEEYQ  640
            + QL++QL RHCLAPDGS ++KA YYDL  AREEM +ER ++LEA   Y EAV +VEE+Q
Sbjct  6    LAQLVEQLNRHCLAPDGSYVAKAAYYDLVQAREEMGRERLRFLEA--AYSEAVTLVEEFQ  63

Query  641  QALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEVQDD  820
            QA+SV N GGIRDVQ  + Q+GL++ PQVYEALE R+ VAEA QRLRLP ++KDG++ D+
Sbjct  64   QAISVANAGGIRDVQALFLQLGLRSTPQVYEALEERLAVAEACQRLRLPSVTKDGDILDE  123

Query  821  EIEK  832
            E EK
Sbjct  124  EAEK  127



>ref|XP_008355341.1| PREDICTED: uncharacterized protein LOC103418998 [Malus domestica]
Length=195

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 117/159 (74%), Gaps = 22/159 (14%)
 Frame = +2

Query  446  NLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGM  625
            NLP DV  ++DQLERHCLAPDGSL SK+ YYDLQLARE M  ER +YLEA+A+Y EA+ M
Sbjct  12   NLPPDVAHVVDQLERHCLAPDGSLGSKSAYYDLQLAREAMCGERIRYLEAMAIYGEAIAM  71

Query  626  VEEYQQALSVVNLGGIRDVQGHYPQIGLKNPP--QVYEALEHRMVVAEAAQRLRLPLISK  799
            VEEYQQ                    GLK+    ++YE LEHRM+VAEAAQR RLPL+SK
Sbjct  72   VEEYQQ--------------------GLKHSSEAELYETLEHRMIVAEAAQRSRLPLVSK  111

Query  800  DGEVQDDEIEKWsilsrssldssgtsvtvssssisTNFT  916
            DGEV ++EIEK SI+SRSSLDS+ T VT+SSSS STN+T
Sbjct  112  DGEVHEEEIEKCSIMSRSSLDSTCTGVTISSSSNSTNYT  150



>gb|KJB62820.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=380

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +2

Query  563  MTKERQQYLEALAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALE  742
            M++ER +YLEA+A+Y EA+ MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQVYE LE
Sbjct  1    MSRERLRYLEAMAIYCEAMAMVEEYQQAVSVANLGGIRDIQGFYPQLGLKNSPQVYETLE  60

Query  743  HRMVVAEAAQRLRLPLISKDGEVQDDEIEKW  835
            HR+VVAEAAQRLRLPLISKDGE+ ++EIEKW
Sbjct  61   HRLVVAEAAQRLRLPLISKDGEIHEEEIEKW  91



>ref|XP_009360992.1| PREDICTED: uncharacterized protein LOC103951362 isoform X1 [Pyrus 
x bretschneideri]
Length=409

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 94/131 (72%), Gaps = 22/131 (17%)
 Frame = +2

Query  446  NLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGM  625
            NLP DV  ++DQLERHCLAPDGSL SK+ YYDLQLAREEM +ER +YLEA+A+Y EA+ M
Sbjct  12   NLPPDVAHVVDQLERHCLAPDGSLGSKSAYYDLQLAREEMCRERIRYLEAMAIYGEAIAM  71

Query  626  VEEYQQALSVVNLGGIRDVQGHYPQIGLKNPP--QVYEALEHRMVVAEAAQRLRLPLISK  799
            VEEYQQ                    GLK+    ++YE LEHRM VAEAAQR RLPL+SK
Sbjct  72   VEEYQQ--------------------GLKHSSEAELYETLEHRMTVAEAAQRSRLPLVSK  111

Query  800  DGEVQDDEIEK  832
            DGEV ++EIEK
Sbjct  112  DGEVHEEEIEK  122



>ref|XP_008365005.1| PREDICTED: HAUS augmin-like complex subunit 4 [Malus domestica]
Length=409

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 93/131 (71%), Gaps = 22/131 (17%)
 Frame = +2

Query  446  NLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGM  625
            NLP DV  ++DQLERHCLAPDGSL SK+ YYDLQLARE M  ER +YLEA+A+Y EA+ M
Sbjct  12   NLPPDVAHVVDQLERHCLAPDGSLGSKSAYYDLQLAREAMCGERIRYLEAMAIYGEAIAM  71

Query  626  VEEYQQALSVVNLGGIRDVQGHYPQIGLKNPP--QVYEALEHRMVVAEAAQRLRLPLISK  799
            VEEYQQ                    GLK+    ++YE LEHRM+VAEAAQR RLPL+SK
Sbjct  72   VEEYQQ--------------------GLKHSSEAELYETLEHRMIVAEAAQRSRLPLVSK  111

Query  800  DGEVQDDEIEK  832
            DGEV ++EIEK
Sbjct  112  DGEVHEEEIEK  122



>ref|XP_004295822.1| PREDICTED: uncharacterized protein LOC101299752 [Fragaria vesca 
subsp. vesca]
Length=409

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 93/138 (67%), Gaps = 20/138 (14%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            M+K L         D++Q+ID L RHC APD SL+SK+TYY+LQLAREEM +ER +YLE+
Sbjct  1    MLKRLQLHEQCRLHDLSQVIDHLARHCFAPDDSLVSKSTYYNLQLAREEMCRERLRYLES  60

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQR  775
            +A+Y EA+ MVE+Y Q                    G  NPPQ+YE LEH M++AEA Q+
Sbjct  61   MAIYSEAIAMVEDYNQ--------------------GWGNPPQLYETLEHLMIIAEATQK  100

Query  776  LRLPLISKDGEVQDDEIE  829
            LRLPL+SKDG++ ++EIE
Sbjct  101  LRLPLLSKDGDIHEEEIE  118



>gb|KHG12191.1| Macrophage receptor MARCO [Gossypium arboreum]
Length=213

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 74/103 (72%), Gaps = 20/103 (19%)
 Frame = +2

Query  416  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEA  595
            MVK    G  NLPAD+ Q+IDQLERHCL+PDGSLISK+ YYDLQLA              
Sbjct  1    MVK----GGQNLPADIIQVIDQLERHCLSPDGSLISKSAYYDLQLA--------------  42

Query  596  LAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQ  724
              +Y EA+ MVEEYQQA+SV NLGGIRD+QG YPQ+GLKN PQ
Sbjct  43   --IYCEAIAMVEEYQQAVSVANLGGIRDIQGFYPQLGLKNSPQ  83



>gb|EAZ21518.1| hypothetical protein OsJ_05142 [Oryza sativa Japonica Group]
Length=428

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 88/127 (69%), Gaps = 13/127 (10%)
 Frame = +2

Query  458  DVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGMVEEY  637
            +V  L+DQL+RH LAPD SL+S   + DL  AREE+  ER +YLEALAVY EA+ MVEEY
Sbjct  16   EVAHLVDQLQRHHLAPDASLLSSCAHSDLLQAREEVASERARYLEALAVYAEAIAMVEEY  75

Query  638  QQALS--VVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEV  811
            Q A+S  V N G             L   PQVYE+LEH + VAEAAQRLRLPL+S+DG+V
Sbjct  76   QHAISTGVANAGK-----------KLNCSPQVYESLEHHLAVAEAAQRLRLPLLSQDGDV  124

Query  812  QDDEIEK  832
             ++EIEK
Sbjct  125  HEEEIEK  131



>ref|XP_009353597.1| PREDICTED: uncharacterized protein LOC103944849 isoform X2 [Pyrus 
x bretschneideri]
Length=407

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +2

Query  602  VYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLR  781
            ++ EA+ MVEEYQQA+SV NLGGIRDVQG Y Q+GLKNPPQ+YE LEHRM+V+EAAQRLR
Sbjct  36   IFGEAIAMVEEYQQAVSVANLGGIRDVQGLYLQLGLKNPPQLYETLEHRMIVSEAAQRLR  95

Query  782  LPLISKDGEVQDDEIEK  832
            LPLISKDGE+ ++EIEK
Sbjct  96   LPLISKDGEIHEEEIEK  112



>ref|XP_009353598.1| PREDICTED: uncharacterized protein LOC103944849 isoform X3 [Pyrus 
x bretschneideri]
Length=400

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  608  IEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLP  787
             EA+ MVEEYQQA+SV NLGGIRDVQG Y Q+GLKNPPQ+YE LEHRM+V+EAAQRLRLP
Sbjct  31   CEAIAMVEEYQQAVSVANLGGIRDVQGLYLQLGLKNPPQLYETLEHRMIVSEAAQRLRLP  90

Query  788  LISKDGEVQDDEIEK  832
            LISKDGE+ ++EIEK
Sbjct  91   LISKDGEIHEEEIEK  105



>ref|XP_002453194.1| hypothetical protein SORBIDRAFT_04g001450 [Sorghum bicolor]
 gb|EES06170.1| hypothetical protein SORBIDRAFT_04g001450 [Sorghum bicolor]
Length=424

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 86/127 (68%), Gaps = 16/127 (13%)
 Frame = +2

Query  458  DVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGMVEEY  637
            +V  L++QL+RH LAPD SL+S + + DL  AREE+  ER  YLEALAVY EAV MVEEY
Sbjct  15   EVAHLVEQLQRHHLAPDASLLSNSAHSDLLQAREEVAAERALYLEALAVYAEAVAMVEEY  74

Query  638  QQALSVVNLGGIRDVQGHYPQIG--LKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEV  811
              A      GG        P  G  L   PQVYE+LEHR+ VAEAAQRLRLPL+S+DGEV
Sbjct  75   HAA------GG--------PGAGKKLNCSPQVYESLEHRLAVAEAAQRLRLPLLSQDGEV  120

Query  812  QDDEIEK  832
             + EIEK
Sbjct  121  HEQEIEK  127



>ref|XP_003573417.1| PREDICTED: uncharacterized protein LOC100821831 [Brachypodium 
distachyon]
Length=419

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 88/125 (70%), Gaps = 9/125 (7%)
 Frame = +2

Query  458  DVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGMVEEY  637
            +V  L++QL+RH LAPD SL+S + + DL  AREE+  ER +YLEALAVY EA+ MVEEY
Sbjct  16   EVAHLVEQLQRHHLAPDASLLSTSAHSDLLQAREEVAAERARYLEALAVYAEAMAMVEEY  75

Query  638  QQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEVQD  817
            Q A +  + G  +          L   PQVYE+LEH + VAEAAQRLRLPL+S+DGEV +
Sbjct  76   QHATAAGSAGAGK---------KLNCSPQVYESLEHHLAVAEAAQRLRLPLLSQDGEVHE  126

Query  818  DEIEK  832
            +EIEK
Sbjct  127  EEIEK  131



>ref|XP_004952114.1| PREDICTED: uncharacterized protein LOC101756520 [Setaria italica]
Length=425

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 83/125 (66%), Gaps = 12/125 (10%)
 Frame = +2

Query  458  DVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGMVEEY  637
            +V  L++QL+RH LAPD SL+S + + DL  AREE+  ER  YLEALAVY EAV MVEEY
Sbjct  16   EVAHLVEQLQRHHLAPDASLLSNSAHSDLLQAREEVAAERALYLEALAVYAEAVAMVEEY  75

Query  638  QQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEVQD  817
              A                    L   PQVYE+LEHR+ VAEAAQRLRLPL+S+DGEV +
Sbjct  76   HAAGGAGAGK------------KLNCSPQVYESLEHRLAVAEAAQRLRLPLLSQDGEVHE  123

Query  818  DEIEK  832
            +EIEK
Sbjct  124  EEIEK  128



>gb|EAY84227.1| hypothetical protein OsI_05607 [Oryza sativa Indica Group]
 gb|ACA64829.1| SKIP interacting protein 9 [Oryza sativa]
Length=428

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 89/127 (70%), Gaps = 13/127 (10%)
 Frame = +2

Query  458  DVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGMVEEY  637
            +V  L+DQL+RH LAPD SL+S + + DL  AREE+  ER +YLEALAVY EA+ MVEEY
Sbjct  16   EVAHLVDQLQRHHLAPDASLLSSSAHSDLLQAREEVASERARYLEALAVYAEAIAMVEEY  75

Query  638  QQALS--VVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEV  811
            Q A+S  V N G             L   PQVYE+LEH + VAEAAQRLRLPL+S+DG+V
Sbjct  76   QHAISTGVANAGK-----------KLNCSPQVYESLEHHLAVAEAAQRLRLPLLSQDGDV  124

Query  812  QDDEIEK  832
             ++EIEK
Sbjct  125  HEEEIEK  131



>gb|ACN31535.1| unknown [Zea mays]
Length=422

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 84/125 (67%), Gaps = 14/125 (11%)
 Frame = +2

Query  458  DVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGMVEEY  637
            +V  L++QL+RH LAPD SL+S + + DL  AREE+  ER  YLEALAVY EAV MVEEY
Sbjct  15   EVAHLVEQLQRHHLAPDASLLSSSAHSDLLQAREEVAAERALYLEALAVYAEAVAMVEEY  74

Query  638  QQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEVQD  817
              A       G +          L   PQVYE+LEHR+ VAEAAQRLRLPL+S+DGEV +
Sbjct  75   HAAAG----AGKK----------LNCSPQVYESLEHRLAVAEAAQRLRLPLLSQDGEVHE  120

Query  818  DEIEK  832
             EIEK
Sbjct  121  QEIEK  125



>dbj|BAJ90177.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91025.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86731.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 9/127 (7%)
 Frame = +2

Query  452  PADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYLEALAVYIEAVGMVE  631
            P +V+ L++QL+RH LAPD SL+S + + DL  ARE++  ER +YLEALAVY EA+ MVE
Sbjct  18   PPEVSHLVEQLQRHHLAPDASLLSSSAHSDLLQAREQVAAERARYLEALAVYAEAMAMVE  77

Query  632  EYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEV  811
            EYQ A +  +    +          L   P+VYE+LEH + VAEAAQRLRLPL+S+DGE 
Sbjct  78   EYQHATAAGSASAAKK---------LNCSPEVYESLEHHLAVAEAAQRLRLPLLSQDGEA  128

Query  812  QDDEIEK  832
             ++EIEK
Sbjct  129  HEEEIEK  135



>ref|XP_002316767.2| hypothetical protein POPTR_0011s09280g [Populus trichocarpa]
 gb|EEE97379.2| hypothetical protein POPTR_0011s09280g [Populus trichocarpa]
Length=376

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 67/142 (47%), Gaps = 63/142 (44%)
 Frame = +2

Query  416  MVKELGAGAHN--LPADVTQLIDQLERHCLAPDGSLISKATYYDLQLAREEMTKERQQYL  589
            MVK    G  N  L ADV+Q+IDQLERHCLAPDG                          
Sbjct  1    MVK---GGVQNPGLAADVSQVIDQLERHCLAPDG--------------------------  31

Query  590  EALAVYIEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAA  769
                                S+V+     D+Q             VYE LEHR+VVAEAA
Sbjct  32   --------------------SLVSKSAFSDLQ------------LVYETLEHRLVVAEAA  59

Query  770  QRLRLPLISKDGEVQDDEIEKW  835
            Q+LRLPLISKDGE+ ++EIEKW
Sbjct  60   QKLRLPLISKDGEIHEEEIEKW  81



>ref|XP_008226896.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X3 [Prunus 
mume]
Length=380

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 48/75 (64%), Gaps = 20/75 (27%)
 Frame = +2

Query  608  IEAVGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLP  787
             EA+ MVEEY+Q                    GL N PQ+YE LEHRM +AEAAQRLRLP
Sbjct  31   CEAIAMVEEYEQ--------------------GLNNSPQLYETLEHRMTIAEAAQRLRLP  70

Query  788  LISKDGEVQDDEIEK  832
            L+SKDGE+ +DEIEK
Sbjct  71   LLSKDGEIHEDEIEK  85



>ref|XP_006646792.1| PREDICTED: uncharacterized protein LOC102709140 [Oryza brachyantha]
Length=360

 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 13/74 (18%)
 Frame = +2

Query  617  VGMVEEYQQALS--VVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPL  790
            + MVEEYQ A++  V N G             L   PQVYE+LEH + VAEAAQRLRLPL
Sbjct  1    MAMVEEYQHAIAAGVANAGK-----------KLNCSPQVYESLEHHLAVAEAAQRLRLPL  49

Query  791  ISKDGEVQDDEIEK  832
            +S+DG+V ++EIEK
Sbjct  50   LSQDGDVHEEEIEK  63



>ref|NP_001130646.1| uncharacterized protein LOC100191747 [Zea mays]
 gb|ACF78950.1| unknown [Zea mays]
 gb|AFW69844.2| hypothetical protein ZEAMMB73_576256 [Zea mays]
Length=271

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  707  LKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEVQDDEIEK  832
            L   PQVYE+LEHR+ VAEAAQRLRLPL+S+DGEV + EIEK
Sbjct  15   LNCSPQVYESLEHRLAVAEAAQRLRLPLLSQDGEVHEQEIEK  56



>gb|AFW69843.2| hypothetical protein ZEAMMB73_576256 [Zea mays]
Length=353

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  707  LKNPPQVYEALEHRMVVAEAAQRLRLPLISKDGEVQDDEIEK  832
            L   PQVYE+LEHR+ VAEAAQRLRLPL+S+DGEV + EIEK
Sbjct  15   LNCSPQVYESLEHRLAVAEAAQRLRLPLLSQDGEVHEQEIEK  56



>ref|XP_009360993.1| PREDICTED: uncharacterized protein LOC103951362 isoform X2 [Pyrus 
x bretschneideri]
Length=339

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 44/72 (61%), Gaps = 22/72 (31%)
 Frame = +2

Query  623  MVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQ--VYEALEHRMVVAEAAQRLRLPLIS  796
            MVEEYQQ                    GLK+  +  +YE LEHRM VAEAAQR RLPL+S
Sbjct  1    MVEEYQQ--------------------GLKHSSEAELYETLEHRMTVAEAAQRSRLPLVS  40

Query  797  KDGEVQDDEIEK  832
            KDGEV ++EIEK
Sbjct  41   KDGEVHEEEIEK  52



>gb|EMS60102.1| hypothetical protein TRIUR3_07799 [Triticum urartu]
Length=487

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 9/72 (13%)
 Frame = +2

Query  617  VGMVEEYQQALSVVNLGGIRDVQGHYPQIGLKNPPQVYEALEHRMVVAEAAQRLRLPLIS  796
            + MVEEYQ          +           L   P+VYE+LEH + VAEAAQRLRLPL+S
Sbjct  1    MAMVEEYQH---------VTAAGSAGAAKKLNCSPEVYESLEHHLAVAEAAQRLRLPLLS  51

Query  797  KDGEVQDDEIEK  832
            +DGEV ++EIEK
Sbjct  52   QDGEVHEEEIEK  63



>ref|XP_008813609.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103724195 
[Phoenix dactylifera]
Length=191

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  725  VYEALEHRMVVAEAAQRLRLPLISKDGEVQDDEIEKWsilsrssldssgtsvtvssssis  904
            VYE+LEHR+ V EAAQ LRLPL+SKDGE+ ++E EK S+ SRSSL+ + T +T SSSS  
Sbjct  19   VYESLEHRLAVPEAAQGLRLPLLSKDGEIHEEETEKSSMTSRSSLNCTTTIITPSSSSNL  78

Query  905  TNFTN  919
            T+F N
Sbjct  79   TSFNN  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2475370696162