BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1574

Length=918
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770759.1|  PREDICTED: acyl-CoA-binding domain-containin...    284   6e-92   Nicotiana sylvestris
emb|CDO98898.1|  unnamed protein product                                295   4e-90   Coffea canephora [robusta coffee]
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...    291   7e-89   Nicotiana tomentosiformis
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...    289   5e-88   Sesamum indicum [beniseed]
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...    286   3e-87   Solanum lycopersicum
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...    286   6e-87   Solanum lycopersicum
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...    285   1e-86   Solanum tuberosum [potatoes]
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...    285   2e-86   Solanum tuberosum [potatoes]
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg                281   7e-85   Erythranthe guttata [common monkey flower]
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...    276   9e-83   Vitis vinifera
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g             272   2e-81   Phaseolus vulgaris [French bean]
gb|KDO75106.1|  hypothetical protein CISIN_1g0050431mg                  261   5e-81   Citrus sinensis [apfelsine]
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...    268   5e-80   Glycine max [soybeans]
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4            268   1e-79   Glycine soja [wild soybean]
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg             266   2e-79   Citrus clementina [clementine]
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...    266   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...    265   6e-79   
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...    265   8e-79   Citrus sinensis [apfelsine]
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...    265   9e-79   
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...    265   1e-78   
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...    264   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...    262   9e-78   Pyrus x bretschneideri [bai li]
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4            262   1e-77   Glycine soja [wild soybean]
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...    262   1e-77   Cicer arietinum [garbanzo]
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...    261   3e-77   Prunus mume [ume]
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...    258   2e-76   Fragaria vesca subsp. vesca
gb|EPS67095.1|  hypothetical protein M569_07681                         245   3e-76   Genlisea aurea
ref|XP_010241732.1|  PREDICTED: acyl-CoA-binding domain-containin...    253   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...    256   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...    256   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...    256   2e-75   Nelumbo nucifera [Indian lotus]
gb|AES64218.2|  acyl-CoA-binding domain protein                         255   3e-75   Medicago truncatula
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g             254   9e-75   Phaseolus vulgaris [French bean]
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein         255   1e-74   
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...    253   1e-74   Cucumis melo [Oriental melon]
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...    251   5e-74   Cucumis sativus [cucumbers]
ref|XP_012069388.1|  PREDICTED: acyl-CoA-binding domain-containin...    250   3e-73   Jatropha curcas
ref|XP_010098333.1|  hypothetical protein L484_023581                   248   9e-73   
ref|XP_002516884.1|  acyl-CoA binding protein, putative                 247   4e-72   Ricinus communis
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...    247   4e-72   Glycine max [soybeans]
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...    247   5e-72   Glycine max [soybeans]
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...    244   2e-71   
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...    244   4e-71   
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...    244   4e-71   
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...    240   2e-69   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4            238   7e-69   Gossypium arboreum [tree cotton]
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g             236   3e-68   
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...    236   5e-68   Populus euphratica
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g             236   5e-68   
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...    236   6e-68   Populus euphratica
gb|KJB72597.1|  hypothetical protein B456_011G187500                    233   8e-68   Gossypium raimondii
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...    236   9e-68   Populus euphratica
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...    236   9e-68   Populus euphratica
gb|KJB72598.1|  hypothetical protein B456_011G187500                    234   2e-67   Gossypium raimondii
gb|KCW61088.1|  hypothetical protein EUGRSUZ_H03862                     230   2e-67   Eucalyptus grandis [rose gum]
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...    234   3e-67   Populus euphratica
gb|KJB72599.1|  hypothetical protein B456_011G187500                    234   3e-67   Gossypium raimondii
gb|KJB72596.1|  hypothetical protein B456_011G187500                    234   3e-67   Gossypium raimondii
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4            234   5e-67   Gossypium arboreum [tree cotton]
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    232   1e-66   
emb|CDY13903.1|  BnaC09g39230D                                          232   1e-66   Brassica napus [oilseed rape]
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...    230   7e-66   Brassica rapa
emb|CDX92598.1|  BnaA10g16370D                                          230   7e-66   
gb|KJB38635.1|  hypothetical protein B456_006G264600                    230   8e-66   Gossypium raimondii
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein      228   7e-65   Gossypium arboreum [tree cotton]
gb|AES91803.2|  acyl-CoA-binding domain protein                         228   7e-65   Medicago truncatula
gb|AES91804.2|  acyl-CoA-binding domain protein                         228   7e-65   Medicago truncatula
ref|XP_006287583.1|  hypothetical protein CARUB_v10000793mg             219   2e-63   
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...    224   2e-63   Cicer arietinum [garbanzo]
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...    223   4e-63   Phoenix dactylifera
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg             222   1e-62   Eutrema salsugineum [saltwater cress]
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...    220   3e-62   
dbj|BAH19562.1|  AT5G18590                                              220   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197360.2|  kelch repeat-containing protein                       220   4e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78582.1|  RanGAP1 interacting protein                             220   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...    216   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...    215   3e-60   
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein         214   7e-60   
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein         214   8e-60   
ref|XP_002873905.1|  kelch repeat-containing protein                    213   1e-59   
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...    213   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...    213   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   3e-57   Elaeis guineensis
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   4e-57   Elaeis guineensis
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...    206   4e-57   
gb|KEH32273.1|  acyl-CoA-binding domain protein                         205   2e-56   Medicago truncatula
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    199   2e-54   
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...    197   7e-54   
ref|XP_011627422.1|  PREDICTED: acyl-CoA-binding domain-containin...    197   8e-54   Amborella trichopoda
ref|XP_006855461.2|  PREDICTED: acyl-CoA-binding domain-containin...    197   8e-54   Amborella trichopoda
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...    196   1e-53   Cicer arietinum [garbanzo]
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...    196   2e-53   Elaeis guineensis
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...    196   3e-53   Elaeis guineensis
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...    196   3e-53   Elaeis guineensis
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...    194   2e-52   
ref|XP_009402528.1|  PREDICTED: acyl-CoA-binding domain-containin...    191   2e-52   
gb|KJB72601.1|  hypothetical protein B456_011G187500                    189   6e-51   Gossypium raimondii
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...    183   7e-49   
gb|KJB38636.1|  hypothetical protein B456_006G264600                    180   7e-48   Gossypium raimondii
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...    179   3e-47   
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...    174   2e-45   Setaria italica
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...    169   6e-44   
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...    169   6e-44   Brachypodium distachyon [annual false brome]
gb|EEE52499.1|  hypothetical protein OsJ_34700                          169   6e-44   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95166.1|  Kelch motif family protein, expressed                   169   8e-44   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68565.1|  hypothetical protein OsI_36893                          168   2e-43   Oryza sativa Indica Group [Indian rice]
dbj|BAK00700.1|  predicted protein                                      167   4e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86800.1|  predicted protein                                      167   4e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW56515.1|  hypothetical protein ZEAMMB73_667685                    157   1e-42   
ref|XP_003575710.1|  PREDICTED: acyl-CoA-binding domain-containin...    165   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...    165   2e-42   
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915          163   6e-42   
ref|XP_006663088.1|  PREDICTED: acyl-CoA-binding domain-containin...    163   1e-41   
ref|XP_006663087.1|  PREDICTED: acyl-CoA-binding domain-containin...    160   6e-41   Oryza brachyantha
gb|AFW60226.1|  hypothetical protein ZEAMMB73_572222                    160   7e-41   
ref|XP_008677101.1|  PREDICTED: uncharacterized protein LOC100279...    160   7e-41   Zea mays [maize]
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...    161   9e-41   
gb|AFW60227.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    160   9e-41   
ref|NP_001145999.1|  uncharacterized protein LOC100279529               160   1e-40   
gb|AFW56518.1|  hypothetical protein ZEAMMB73_667685                    157   2e-40   
ref|NP_001146281.1|  uncharacterized protein LOC100279856               157   8e-40   Zea mays [maize]
gb|AFW56516.1|  hypothetical protein ZEAMMB73_667685                    157   8e-40   
gb|EEE53353.1|  hypothetical protein OsJ_36377                          156   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066944.1|  Os12g0538800                                       157   1e-39   
gb|EEC69433.1|  hypothetical protein OsI_38606                          157   2e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_004962833.1|  PREDICTED: acyl-CoA-binding domain-containin...    154   9e-39   Setaria italica
ref|XP_004962837.1|  PREDICTED: acyl-CoA-binding domain-containin...    154   1e-38   
ref|XP_006664610.1|  PREDICTED: acyl-CoA-binding domain-containin...    154   2e-38   Oryza brachyantha
ref|XP_011012826.1|  PREDICTED: acyl-CoA-binding domain-containin...    142   1e-34   Populus euphratica
gb|KDO75110.1|  hypothetical protein CISIN_1g0050431mg                  137   1e-34   Citrus sinensis [apfelsine]
ref|XP_004486044.1|  PREDICTED: acyl-CoA-binding domain-containin...    138   3e-33   Cicer arietinum [garbanzo]
gb|EMT25879.1|  hypothetical protein F775_10881                         138   8e-33   
gb|ERN16928.1|  hypothetical protein AMTR_s00057p00182130               128   2e-29   Amborella trichopoda
gb|EMS52652.1|  Acyl-CoA-binding domain-containing protein 4            121   9e-27   Triticum urartu
gb|EMS62709.1|  Acyl-CoA-binding domain-containing protein 4            118   5e-26   Triticum urartu
ref|XP_010931596.1|  PREDICTED: tip elongation aberrant protein 3...    107   4e-22   
ref|XP_001751751.1|  predicted protein                                99.8    2e-19   
gb|EMT26901.1|  hypothetical protein F775_29769                       94.4    5e-18   
ref|XP_002975032.1|  hypothetical protein SELMODRAFT_415315           94.4    6e-18   Selaginella moellendorffii
ref|XP_002977452.1|  hypothetical protein SELMODRAFT_417505           94.0    7e-18   Selaginella moellendorffii
ref|XP_001759823.1|  predicted protein                                93.2    2e-17   
ref|XP_002442263.1|  hypothetical protein SORBIDRAFT_08g017210        89.4    2e-16   Sorghum bicolor [broomcorn]
ref|XP_001761348.1|  predicted protein                                86.7    2e-15   
gb|EMS60218.1|  Acyl-CoA-binding domain-containing protein 4          85.1    5e-15   Triticum urartu
ref|XP_006855517.1|  PREDICTED: acyl-CoA-binding domain-containin...  85.1    5e-15   
tpg|DAA55336.1|  TPA: hypothetical protein ZEAMMB73_384883            80.5    7e-15   
tpg|DAA55334.1|  TPA: hypothetical protein ZEAMMB73_384883            80.5    4e-14   
ref|XP_008456547.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.4    4e-14   Cucumis melo [Oriental melon]
ref|XP_010904810.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.0    7e-14   Elaeis guineensis
ref|XP_004150374.1|  PREDICTED: acyl-CoA-binding domain-containin...  81.6    7e-14   Cucumis sativus [cucumbers]
ref|XP_010904809.1|  PREDICTED: acyl-CoA-binding domain-containin...  81.6    8e-14   Elaeis guineensis
ref|XP_008672333.1|  PREDICTED: hypothetical protein isoform X3       81.3    8e-14   
ref|XP_008672336.1|  PREDICTED: hypothetical protein isoform X5       80.9    9e-14   
ref|XP_008672334.1|  PREDICTED: hypothetical protein isoform X4       81.3    9e-14   Zea mays [maize]
ref|XP_008672331.1|  PREDICTED: hypothetical protein isoform X1       81.3    9e-14   Zea mays [maize]
ref|XP_008672332.1|  PREDICTED: hypothetical protein isoform X2       81.3    1e-13   Zea mays [maize]
ref|NP_001169061.1|  uncharacterized protein LOC100382902             81.3    1e-13   Zea mays [maize]
ref|XP_010659627.1|  PREDICTED: acyl-CoA-binding domain-containin...  80.9    2e-13   Vitis vinifera
ref|XP_002284019.1|  PREDICTED: acyl-CoA-binding domain-containin...  80.9    2e-13   Vitis vinifera
gb|EEC69439.1|  hypothetical protein OsI_38614                        80.1    2e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001152073.1|  acyl-CoA binding protein                         80.1    2e-13   
ref|XP_003562942.1|  PREDICTED: acyl-CoA-binding domain-containin...  79.7    4e-13   Brachypodium distachyon [annual false brome]
gb|EEE53359.1|  hypothetical protein OsJ_36386                        79.0    4e-13   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA52360.1|  TPA: hypothetical protein ZEAMMB73_733782            79.3    5e-13   
ref|NP_001066950.1|  Os12g0540800                                     79.0    5e-13   
tpg|DAA52361.1|  TPA: acyl-CoA binding protein                        79.0    6e-13   
ref|XP_001764473.1|  predicted protein                                79.0    6e-13   
ref|XP_010931617.1|  PREDICTED: acyl-CoA-binding domain-containin...  78.6    7e-13   
ref|XP_010931615.1|  PREDICTED: acyl-CoA-binding domain-containin...  78.6    8e-13   Elaeis guineensis
ref|XP_006650861.1|  PREDICTED: acyl-CoA-binding domain-containin...  78.6    9e-13   Oryza brachyantha
ref|XP_001760924.1|  predicted protein                                78.2    1e-12   
gb|KHG13462.1|  Acyl-CoA-binding domain-containing 4 -like protein    78.2    1e-12   Gossypium arboreum [tree cotton]
ref|XP_006664611.1|  PREDICTED: acyl-CoA-binding domain-containin...  77.8    1e-12   Oryza brachyantha
gb|KJB45987.1|  hypothetical protein B456_007G342000                  77.8    2e-12   Gossypium raimondii
gb|KJB45986.1|  hypothetical protein B456_007G342000                  77.4    2e-12   Gossypium raimondii
ref|XP_002463567.1|  hypothetical protein SORBIDRAFT_01g002200        77.4    2e-12   Sorghum bicolor [broomcorn]
gb|EMT00399.1|  Acyl-CoA-binding domain-containing protein 4          76.3    5e-12   
gb|EAZ29205.1|  hypothetical protein OsJ_13266                        76.3    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAR88580.1|  putative transcription factor                         76.3    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051819.1|  Os03g0835600                                     76.3    5e-12   
gb|ABF99749.1|  acyl-CoA binding family protein, putative, expressed  75.9    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007220663.1|  hypothetical protein PRUPE_ppa004462mg           75.9    6e-12   
ref|XP_004962830.1|  PREDICTED: acyl-CoA-binding domain-containin...  75.5    7e-12   Setaria italica
ref|XP_010674725.1|  PREDICTED: acyl-CoA-binding domain-containin...  75.9    7e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002984630.1|  hypothetical protein SELMODRAFT_20979            75.5    7e-12   
ref|XP_004144782.1|  PREDICTED: acyl-CoA-binding domain-containin...  75.5    9e-12   Cucumis sativus [cucumbers]
ref|XP_003575455.1|  PREDICTED: acyl-CoA-binding domain-containin...  75.1    9e-12   Brachypodium distachyon [annual false brome]
ref|XP_011648837.1|  PREDICTED: acyl-CoA-binding domain-containin...  75.5    1e-11   Cucumis sativus [cucumbers]
ref|XP_008800864.1|  PREDICTED: acyl-CoA-binding domain-containin...  75.1    1e-11   
ref|XP_010550980.1|  PREDICTED: acyl-CoA-binding domain-containin...  75.1    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_010524874.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.7    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_010524875.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.7    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_008232327.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.7    1e-11   Prunus mume [ume]
dbj|BAJ87202.1|  predicted protein                                    74.7    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008232325.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.7    2e-11   Prunus mume [ume]
ref|XP_010267284.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.3    2e-11   Nelumbo nucifera [Indian lotus]
gb|ACN39866.1|  unknown                                               74.7    2e-11   Picea sitchensis
ref|XP_012089029.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.3    2e-11   Jatropha curcas
ref|XP_008354811.1|  PREDICTED: acyl-CoA-binding domain-containin...  73.6    3e-11   
ref|XP_002882412.1|  acyl-CoA binding protein 4, acyl-CoA-binding...  73.6    3e-11   
emb|CDY18777.1|  BnaAnng02420D                                        73.6    4e-11   Brassica napus [oilseed rape]
ref|XP_004981190.1|  PREDICTED: acyl-CoA-binding domain-containin...  73.2    5e-11   Setaria italica
ref|XP_004981189.1|  PREDICTED: acyl-CoA-binding domain-containin...  73.2    5e-11   Setaria italica
ref|XP_009134825.1|  PREDICTED: acyl-CoA-binding domain-containin...  73.2    5e-11   Brassica rapa
emb|CDX74147.1|  BnaA03g29000D                                        73.2    5e-11   
ref|XP_010088948.1|  Acyl-CoA-binding domain-containing protein 4     72.8    6e-11   
ref|XP_006289311.1|  hypothetical protein CARUB_v10002793mg           72.8    6e-11   Capsella rubella
ref|XP_010485985.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.8    7e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010417784.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.8    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010464068.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.8    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010485986.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.4    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010464067.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.4    8e-11   Camelina sativa [gold-of-pleasure]
emb|CDY18797.1|  BnaAnng02620D                                        72.4    9e-11   Brassica napus [oilseed rape]
ref|XP_006297138.1|  hypothetical protein CARUB_v10013146mg           72.0    1e-10   Capsella rubella
ref|XP_008454338.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.0    1e-10   Cucumis melo [Oriental melon]
ref|XP_008454347.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.0    1e-10   
ref|XP_008375625.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    1e-10   
gb|AIS76201.1|  acyl-coA binding protein                              71.2    2e-10   Brassica napus [oilseed rape]
ref|XP_008347058.1|  PREDICTED: acyl-CoA-binding domain-containin...  71.2    2e-10   
ref|XP_009147241.1|  PREDICTED: acyl-CoA-binding domain-containin...  71.2    2e-10   Brassica rapa
ref|XP_002264719.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.9    3e-10   Vitis vinifera
ref|XP_009147243.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.9    3e-10   Brassica rapa
ref|XP_009346106.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.9    3e-10   Pyrus x bretschneideri [bai li]
gb|AIS76200.1|  acyl-coA binding protein                              70.9    3e-10   Brassica napus [oilseed rape]
ref|XP_009346105.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.9    3e-10   
emb|CDY27769.1|  BnaA05g31780D                                        70.9    3e-10   Brassica napus [oilseed rape]
emb|CDY05166.1|  BnaC05g46370D                                        70.9    3e-10   
gb|AIS76195.1|  acyl-coA binding protein                              70.9    3e-10   Brassica napus [oilseed rape]
ref|NP_974227.1|  acyl-CoA binding protein 4                          70.9    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187193.3|  acyl-CoA binding protein 4                          70.5    3e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAN60660.1|  hypothetical protein VITISV_040879                   69.7    4e-10   Vitis vinifera
gb|AIS76194.1|  acyl-coA binding protein                              70.5    4e-10   Brassica napus [oilseed rape]
ref|XP_004496137.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    5e-10   Cicer arietinum [garbanzo]
ref|XP_002512412.1|  acyl-CoA binding protein, putative               70.1    5e-10   Ricinus communis
ref|XP_004307015.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    5e-10   Fragaria vesca subsp. vesca
ref|XP_010269461.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    5e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009124026.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    5e-10   
ref|XP_010269462.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    5e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009124023.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    5e-10   Brassica rapa
ref|XP_010269463.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    5e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009124025.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    5e-10   Brassica rapa
ref|XP_009381939.1|  PREDICTED: acyl-CoA-binding domain-containin...  70.1    6e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010259670.1|  PREDICTED: acyl-CoA-binding domain-containin...  69.7    7e-10   Nelumbo nucifera [Indian lotus]
gb|KJB45284.1|  hypothetical protein B456_007G298800                  69.7    7e-10   Gossypium raimondii
gb|KJB45282.1|  hypothetical protein B456_007G298800                  69.7    7e-10   Gossypium raimondii
gb|KJB45278.1|  hypothetical protein B456_007G298800                  69.7    8e-10   Gossypium raimondii
ref|XP_006577230.1|  PREDICTED: acyl-CoA-binding domain-containin...  69.7    8e-10   Glycine max [soybeans]
gb|EMT16097.1|  hypothetical protein F775_31985                       69.3    8e-10   
ref|XP_006577229.1|  PREDICTED: acyl-CoA-binding domain-containin...  69.7    8e-10   Glycine max [soybeans]
ref|XP_006408080.1|  hypothetical protein EUTSA_v10020218mg           69.7    8e-10   Eutrema salsugineum [saltwater cress]
ref|XP_003521699.1|  PREDICTED: acyl-CoA-binding domain-containin...  69.7    8e-10   Glycine max [soybeans]
gb|KJB45280.1|  hypothetical protein B456_007G298800                  69.7    8e-10   Gossypium raimondii
ref|XP_006408079.1|  hypothetical protein EUTSA_v10020218mg           69.7    8e-10   Eutrema salsugineum [saltwater cress]
gb|KEH43326.1|  acyl-CoA-binding domain protein                       69.3    8e-10   Medicago truncatula
gb|KFK26496.1|  hypothetical protein AALP_AA8G256900                  69.3    9e-10   Arabis alpina [alpine rockcress]
ref|XP_008246400.1|  PREDICTED: acyl-CoA-binding domain-containin...  69.3    9e-10   
ref|XP_007030972.1|  Acyl-CoA binding protein 4 isoform 3             69.3    1e-09   
ref|XP_007030971.1|  Acyl-CoA binding protein 4 isoform 2             69.3    1e-09   
ref|XP_007030970.1|  Acyl-CoA binding protein 4 isoform 1             69.3    1e-09   
ref|XP_004302406.1|  PREDICTED: acyl-CoA-binding domain-containin...  69.3    1e-09   Fragaria vesca subsp. vesca
ref|XP_009405427.1|  PREDICTED: acyl-CoA-binding domain-containin...  69.3    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB45281.1|  hypothetical protein B456_007G298800                  69.3    1e-09   Gossypium raimondii
emb|CDY40708.1|  BnaC03g34240D                                        68.9    1e-09   Brassica napus [oilseed rape]
gb|KJB45279.1|  hypothetical protein B456_007G298800                  68.6    1e-09   Gossypium raimondii
gb|EYU28972.1|  hypothetical protein MIMGU_mgv1a003858mg              68.6    2e-09   Erythranthe guttata [common monkey flower]
gb|AIS76199.1|  acyl-coA binding protein                              68.6    2e-09   Brassica napus [oilseed rape]
ref|XP_004494606.1|  PREDICTED: acyl-CoA-binding domain-containin...  68.6    2e-09   Cicer arietinum [garbanzo]
ref|XP_004494607.1|  PREDICTED: acyl-CoA-binding domain-containin...  68.6    2e-09   Cicer arietinum [garbanzo]
gb|EYU29897.1|  hypothetical protein MIMGU_mgv1a0025143mg             66.2    2e-09   Erythranthe guttata [common monkey flower]
ref|NP_001048563.1|  Os02g0822800                                     68.2    2e-09   
ref|XP_007208046.1|  hypothetical protein PRUPE_ppa002406mg           68.2    2e-09   Prunus persica
ref|XP_008370455.1|  PREDICTED: acyl-CoA-binding domain-containin...  68.2    2e-09   
ref|XP_010935816.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.8    3e-09   Elaeis guineensis
ref|XP_008787450.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.8    3e-09   Phoenix dactylifera
ref|XP_008787448.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.8    3e-09   Phoenix dactylifera
ref|XP_008388550.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.8    3e-09   
ref|XP_009376644.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.8    4e-09   Pyrus x bretschneideri [bai li]
ref|XP_006394953.1|  hypothetical protein EUTSA_v10003780mg           67.8    4e-09   Eutrema salsugineum [saltwater cress]
ref|XP_006851311.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.4    4e-09   Amborella trichopoda
ref|XP_009361434.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.0    5e-09   
ref|XP_009350221.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.0    5e-09   
gb|KJB81009.1|  hypothetical protein B456_013G125100                  67.0    6e-09   
ref|XP_005648328.1|  galactose oxidase                                67.0    6e-09   
ref|NP_198115.2|  acyl-CoA binding protein 5                          67.0    6e-09   
gb|KJB81007.1|  hypothetical protein B456_013G125100                  67.0    6e-09   
gb|KJB81008.1|  hypothetical protein B456_013G125100                  67.0    6e-09   
ref|XP_010043066.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.0    6e-09   
gb|KJB81012.1|  hypothetical protein B456_013G125100                  66.6    7e-09   
gb|KJB81010.1|  hypothetical protein B456_013G125100                  66.6    7e-09   
ref|XP_006433393.1|  hypothetical protein CICLE_v100005041mg          66.6    8e-09   
gb|KJB81011.1|  hypothetical protein B456_013G125100                  66.2    8e-09   
ref|XP_010090434.1|  Acyl-CoA-binding domain-containing protein 4     66.2    8e-09   
ref|XP_006472069.1|  PREDICTED: acyl-CoA-binding domain-containin...  66.6    9e-09   
gb|KDO56253.1|  hypothetical protein CISIN_1g0066451mg                65.9    9e-09   
gb|KJB82619.1|  hypothetical protein B456_013G205300                  66.2    1e-08   
ref|XP_010067200.1|  PREDICTED: acyl-CoA-binding domain-containin...  65.9    1e-08   
gb|KCW65281.1|  hypothetical protein EUGRSUZ_G02738                   65.9    1e-08   
gb|KJB82618.1|  hypothetical protein B456_013G205300                  65.9    1e-08   
gb|KCW65280.1|  hypothetical protein EUGRSUZ_G02738                   65.9    1e-08   
emb|CDP19998.1|  unnamed protein product                              65.9    1e-08   
ref|XP_006382498.1|  acyl-CoA binding family protein                  65.9    1e-08   
gb|KHN43291.1|  Acyl-CoA-binding domain-containing protein 4          65.9    2e-08   
ref|XP_006604817.1|  PREDICTED: acyl-CoA-binding domain-containin...  65.5    2e-08   
ref|XP_002442260.1|  hypothetical protein SORBIDRAFT_08g017180        65.5    2e-08   
gb|AIS76197.1|  acyl-coA binding protein                              65.5    2e-08   
ref|XP_008789937.1|  PREDICTED: acyl-CoA-binding domain-containin...  65.5    2e-08   
emb|CDY25029.1|  BnaC02g39790D                                        65.5    2e-08   
ref|XP_008789936.1|  PREDICTED: acyl-CoA-binding domain-containin...  65.5    2e-08   
gb|AIS76198.1|  acyl-coA binding protein                              65.1    2e-08   
ref|XP_002989176.1|  hypothetical protein SELMODRAFT_427769           65.1    2e-08   
emb|CDY05568.1|  BnaA02g31230D                                        65.1    2e-08   
ref|XP_009129871.1|  PREDICTED: acyl-CoA-binding domain-containin...  65.1    3e-08   
ref|XP_009129872.1|  PREDICTED: acyl-CoA-binding domain-containin...  65.1    3e-08   
ref|XP_010694512.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.7    3e-08   
ref|XP_003556301.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.7    3e-08   
ref|XP_006649183.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.7    3e-08   
ref|XP_010493995.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.7    4e-08   
ref|XP_009418632.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.3    4e-08   
gb|EPS63465.1|  hypothetical protein M569_11319                       64.3    4e-08   
ref|XP_011101540.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.3    4e-08   
ref|XP_010493994.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.3    4e-08   
ref|XP_002874360.1|  acyl-CoA binding protein 5, acyl-CoA-binding...  64.3    4e-08   
ref|XP_010493996.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.3    4e-08   
gb|KHN20236.1|  Acyl-CoA-binding domain-containing protein 4          64.3    5e-08   
ref|XP_004230218.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.9    6e-08   
ref|XP_011036847.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.9    6e-08   
ref|XP_011031604.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.5    7e-08   
ref|XP_007147035.1|  hypothetical protein PHAVU_006G090700g           63.9    7e-08   
ref|XP_007144252.1|  hypothetical protein PHAVU_007G140800g           63.5    7e-08   
ref|XP_003556514.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.5    8e-08   
ref|XP_007147036.1|  hypothetical protein PHAVU_006G090700g           63.5    8e-08   
ref|XP_006606527.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.5    8e-08   
ref|XP_011087406.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.5    9e-08   
emb|CDY58438.1|  BnaC03g71230D                                        62.8    1e-07   
gb|AFZ62126.1|  acyl-CoA binding protein 4                            63.2    1e-07   
ref|XP_003570438.1|  PREDICTED: acyl-CoA-binding domain-containin...  62.8    1e-07   
gb|KCW65279.1|  hypothetical protein EUGRSUZ_G02738                   62.8    1e-07   
ref|XP_002977349.1|  hypothetical protein SELMODRAFT_417312           63.2    1e-07   
ref|XP_006375749.1|  hypothetical protein POPTR_0013s01950g           62.4    2e-07   
ref|XP_006436541.1|  hypothetical protein CICLE_v10031292mg           62.4    2e-07   
ref|XP_002319530.1|  acyl-CoA binding family protein                  62.4    2e-07   
ref|XP_006436542.1|  hypothetical protein CICLE_v10031292mg           62.4    2e-07   
ref|XP_006485342.1|  PREDICTED: acyl-CoA-binding domain-containin...  62.4    2e-07   
ref|XP_012090508.1|  PREDICTED: acyl-CoA-binding domain-containin...  62.0    2e-07   
ref|XP_006589352.1|  PREDICTED: acyl-CoA-binding domain-containin...  62.0    2e-07   
ref|NP_001068393.1|  Os11g0657000                                     62.0    2e-07   
gb|KJB60498.1|  hypothetical protein B456_009G308900                  62.0    2e-07   
ref|XP_003626261.1|  Acyl-CoA-binding domain-containing protein       62.0    3e-07   
gb|AFW63940.1|  hypothetical protein ZEAMMB73_171525                  61.2    3e-07   
ref|XP_008677016.1|  PREDICTED: uncharacterized protein LOC100277...  61.6    3e-07   
gb|KDO45185.1|  hypothetical protein CISIN_1g010551mg                 61.6    3e-07   
gb|KDO45184.1|  hypothetical protein CISIN_1g010551mg                 61.6    3e-07   
gb|EYU32444.1|  hypothetical protein MIMGU_mgv1a004856mg              61.6    3e-07   
gb|KEH24514.1|  acyl-CoA-binding domain protein                       61.6    3e-07   
ref|XP_007010054.1|  Galactose oxidase/kelch repeat superfamily p...  61.6    4e-07   
ref|XP_007010055.1|  Galactose oxidase/kelch repeat superfamily p...  61.2    4e-07   
ref|XP_006344641.1|  PREDICTED: acyl-CoA-binding domain-containin...  61.6    4e-07   
ref|XP_010103362.1|  Acyl-CoA-binding domain-containing protein 4     60.8    4e-07   
ref|XP_011023664.1|  PREDICTED: acyl-CoA-binding domain-containin...  61.2    5e-07   
ref|XP_011023663.1|  PREDICTED: acyl-CoA-binding domain-containin...  61.2    5e-07   
ref|XP_004495715.1|  PREDICTED: acyl-CoA-binding domain-containin...  60.8    5e-07   
ref|XP_002316404.1|  hypothetical protein POPTR_0010s23690g           60.8    6e-07   
gb|EMS61872.1|  Acyl-CoA-binding domain-containing protein 4          60.8    6e-07   
ref|XP_010490952.1|  PREDICTED: acyl-CoA-binding domain-containin...  60.8    6e-07   
gb|KHG10768.1|  Acyl-CoA-binding domain-containing 4 -like protein    60.5    8e-07   
ref|XP_002454805.1|  hypothetical protein SORBIDRAFT_04g037760        60.1    9e-07   
ref|XP_009589679.1|  PREDICTED: acyl-CoA-binding domain-containin...  59.7    1e-06   
ref|XP_006398900.1|  hypothetical protein EUTSA_v10013283mg           59.7    2e-06   
ref|XP_009791118.1|  PREDICTED: acyl-CoA-binding domain-containin...  59.7    2e-06   
gb|KHF99247.1|  Acyl-CoA-binding domain-containing 4 -like protein    58.2    2e-06   
ref|XP_002311053.2|  hypothetical protein POPTR_0008s03110g           59.3    2e-06   
emb|CDO99817.1|  unnamed protein product                              58.9    2e-06   
ref|XP_010421592.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.9    3e-06   
ref|XP_010421591.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.9    3e-06   
ref|XP_011024324.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.5    4e-06   
ref|XP_011024325.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.2    4e-06   
ref|XP_011024328.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.2    4e-06   
gb|AAL06496.1|AF412043_1  AT5g04420/T32M21_20                         57.8    5e-06   
ref|NP_196062.1|  kelch repeat-containing protein                     57.8    5e-06   
ref|XP_010423580.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.8    6e-06   
ref|XP_010452338.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.8    6e-06   
gb|AFW87095.1|  hypothetical protein ZEAMMB73_553938                  57.4    8e-06   
ref|XP_009130823.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    9e-06   
ref|XP_004250024.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    1e-05   
gb|AFW67053.1|  hypothetical protein ZEAMMB73_589353                  53.9    1e-05   
ref|XP_009619479.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.6    2e-05   
ref|XP_009619480.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.6    2e-05   
ref|XP_009619482.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.2    2e-05   
ref|XP_002873147.1|  kelch repeat-containing protein                  56.2    2e-05   
gb|EPS64186.1|  hypothetical protein M569_10595                       55.8    3e-05   
ref|XP_010558260.1|  PREDICTED: acyl-CoA-binding domain-containin...  55.5    3e-05   
ref|XP_009795858.1|  PREDICTED: acyl-CoA-binding domain-containin...  55.5    3e-05   
ref|XP_002532624.1|  acyl-CoA binding protein, putative               54.7    5e-05   
emb|CDP19491.1|  unnamed protein product                              54.3    6e-05   
ref|XP_003083732.1|  acyl-CoA binding family protein (ISS)            54.3    7e-05   
emb|CEG00457.1|  FERM/acyl-CoA-binding protein, 3-helical bundle      54.3    7e-05   
ref|XP_009621732.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.9    8e-05   
gb|KHG01995.1|  Rab9 effector with kelch motifs                       54.3    1e-04   
gb|KJB26306.1|  hypothetical protein B456_004G236300                  53.9    1e-04   
gb|KJB26307.1|  hypothetical protein B456_004G236300                  53.9    1e-04   
ref|XP_009596275.1|  PREDICTED: kelch domain-containing protein 2...  53.9    1e-04   
ref|XP_006589115.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.1    2e-04   
ref|XP_006589116.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.1    2e-04   
ref|XP_009802412.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.1    2e-04   
ref|XP_009767264.1|  PREDICTED: kelch domain-containing protein 2...  53.1    2e-04   
ref|XP_002890623.1|  hypothetical protein ARALYDRAFT_335696           50.8    2e-04   
ref|XP_009802410.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.1    2e-04   
ref|XP_009802411.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.1    2e-04   
ref|XP_009802413.1|  PREDICTED: acyl-CoA-binding domain-containin...  52.8    2e-04   
ref|XP_006287446.1|  hypothetical protein CARUB_v10000653mg           52.8    2e-04   
emb|CBI39602.3|  unnamed protein product                              52.8    2e-04   
ref|XP_010659707.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...  52.4    4e-04   
ref|XP_010318867.1|  PREDICTED: tip elongation aberrant protein 1...  52.0    4e-04   
ref|XP_003638184.1|  Acyl-CoA-binding domain-containing protein       51.2    4e-04   
ref|XP_004236063.1|  PREDICTED: kelch domain-containing protein 3...  52.0    4e-04   
ref|XP_006345112.1|  PREDICTED: tip elongation aberrant protein 1...  51.6    6e-04   
ref|XP_006605801.1|  PREDICTED: acyl-CoA-binding domain-containin...  51.6    6e-04   
ref|XP_006605800.1|  PREDICTED: acyl-CoA-binding domain-containin...  51.6    6e-04   
ref|XP_010938234.1|  PREDICTED: rab9 effector protein with kelch ...  51.6    7e-04   
ref|XP_009609103.1|  PREDICTED: rab9 effector protein with kelch ...  51.2    7e-04   
ref|XP_009609102.1|  PREDICTED: host cell factor 2-like isoform X4    51.2    7e-04   
ref|XP_009609101.1|  PREDICTED: uncharacterized protein LOC104102...  51.2    8e-04   
ref|XP_009609099.1|  PREDICTED: host cell factor 2-like isoform X1    51.2    8e-04   
ref|XP_010938233.1|  PREDICTED: rab9 effector protein with kelch ...  51.2    8e-04   
ref|XP_009609100.1|  PREDICTED: host cell factor 2-like isoform X2    51.2    8e-04   
ref|XP_010259671.1|  PREDICTED: acyl-CoA-binding domain-containin...  50.8    9e-04   
ref|XP_007145005.1|  hypothetical protein PHAVU_007G201700g           51.2    9e-04   



>ref|XP_009770759.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Nicotiana sylvestris]
Length=214

 Score =   284 bits (727),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 169/188 (90%), Gaps = 5/188 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL      + QGT+SP+RHPKRFS+S+GEAV +S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----SSPQGTRSPMRHPKRFSNSSGEAVPHSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A EFNNC SG +ENWM+LSIAG+KP PRFNH+AAVVGNKMVVVGGE+GS LLEDVQVLNF
Sbjct  56   APEFNNCASGGTENWMLLSIAGEKPTPRFNHAAAVVGNKMVVVGGETGSRLLEDVQVLNF  115

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D FSWT+ SSKLYLSPTSLPLKIPACKGH+LV WGKK+L+VGGKTDPAS+KVSVWAFDTE
Sbjct  116  DSFSWTTASSKLYLSPTSLPLKIPACKGHALVQWGKKILMVGGKTDPASEKVSVWAFDTE  175

Query  895  TECWSLME  918
            TECWSL+E
Sbjct  176  TECWSLLE  183



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   295 bits (755),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR SS +G+ +  ++N S ES+CQ S+G
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRVSSYSGQGLAPALNASHESNCQTSSG  60

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A EFNNCTSGSSENWMVLS+ GDKP PR +H+AAVVGNKMVVVGGESG+ LL+DVQVL+F
Sbjct  61   APEFNNCTSGSSENWMVLSVTGDKPAPRSSHAAAVVGNKMVVVGGESGNKLLDDVQVLHF  120

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRFSW++ SSKLYLSP SLPLKIPACKGH LVSWGKKVLLVGG+TDPASDKVSVWAFDTE
Sbjct  121  DRFSWSTASSKLYLSPNSLPLKIPACKGHCLVSWGKKVLLVGGRTDPASDKVSVWAFDTE  180

Query  895  TECWSLME  918
            TECW+ +E
Sbjct  181  TECWAPVE  188



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score =   291 bits (746),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 169/188 (90%), Gaps = 5/188 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL      + QGT+SP+RHPKRFS+S+GEAV +S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----SSPQGTRSPMRHPKRFSNSSGEAVPHSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A EFNNC SG SENWM+LSIAG+KP PRFNH+AAVVGNKMVVVGGESGS LLEDVQVLNF
Sbjct  56   APEFNNCASGGSENWMLLSIAGEKPTPRFNHAAAVVGNKMVVVGGESGSRLLEDVQVLNF  115

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D FSWT+ SSKLYLSPTSLPLKIPACKGH+LV WGKK+L+VGGKTDPASDKVSVWAFDTE
Sbjct  116  DSFSWTTASSKLYLSPTSLPLKIPACKGHALVQWGKKILMVGGKTDPASDKVSVWAFDTE  175

Query  895  TECWSLME  918
            TECWSL+E
Sbjct  176  TECWSLLE  183



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRL+VQLSD+AQGT+SPIRHPKRFS+S GE V  + ++++E +CQ S+ 
Sbjct  1    MFGFSRRRMKLGRLRVQLSDSAQGTRSPIRHPKRFSNSNGEGVAAASSEADELNCQSSSN  60

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A E NNCTSGSSENWMVLSI+G+KP PRFNH+AAVVGNKMVVVGGES +GLLEDVQVL+F
Sbjct  61   APELNNCTSGSSENWMVLSISGEKPTPRFNHAAAVVGNKMVVVGGESANGLLEDVQVLSF  120

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRFSWT  SSKLYLSPTSLPLKIPACKGH LV WGKKVLL+GGKT+P SD+VSVWAFD E
Sbjct  121  DRFSWTMASSKLYLSPTSLPLKIPACKGHVLVPWGKKVLLIGGKTEPVSDRVSVWAFDME  180

Query  895  TECWSLME  918
             ECWS +E
Sbjct  181  AECWSPIE  188



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score =   286 bits (731),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 169/188 (90%), Gaps = 5/188 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A EFN+C SG SENWM+LSIAG+KP PRFNH+AAVVGNKMVVVGGE+GS +LEDVQVLNF
Sbjct  56   APEFNDCASGGSENWMLLSIAGEKPTPRFNHAAAVVGNKMVVVGGETGSRMLEDVQVLNF  115

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D FSWT+ SSKLYLSPTSLPLKIPACKGH+LV WGKK+L+VGGKTDP+SDKVSVWAFDTE
Sbjct  116  DSFSWTTASSKLYLSPTSLPLKIPACKGHALVQWGKKILMVGGKTDPSSDKVSVWAFDTE  175

Query  895  TECWSLME  918
            TECWSL+E
Sbjct  176  TECWSLLE  183



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score =   286 bits (732),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 169/188 (90%), Gaps = 5/188 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A EFN+C SG SENWM+LSIAG+KP PRFNH+AAVVGNKMVVVGGE+GS +LEDVQVLNF
Sbjct  56   APEFNDCASGGSENWMLLSIAGEKPTPRFNHAAAVVGNKMVVVGGETGSRMLEDVQVLNF  115

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D FSWT+ SSKLYLSPTSLPLKIPACKGH+LV WGKK+L+VGGKTDP+SDKVSVWAFDTE
Sbjct  116  DSFSWTTASSKLYLSPTSLPLKIPACKGHALVQWGKKILMVGGKTDPSSDKVSVWAFDTE  175

Query  895  TECWSLME  918
            TECWSL+E
Sbjct  176  TECWSLLE  183



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score =   285 bits (728),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 169/188 (90%), Gaps = 5/188 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A EFN+C SG SENWM+LSIAG+KP PRFNH+AAVVGNKMVVVGGE+GS +LEDVQVLNF
Sbjct  56   APEFNDCASGGSENWMLLSIAGEKPTPRFNHAAAVVGNKMVVVGGETGSRMLEDVQVLNF  115

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D FSWT+ SSKLYLSPTSLPLKIPACKGH+LV WGKK+L+VGGKTDP+S+KVSVWAFDTE
Sbjct  116  DSFSWTTASSKLYLSPTSLPLKIPACKGHALVQWGKKILMVGGKTDPSSEKVSVWAFDTE  175

Query  895  TECWSLME  918
            TECWSL+E
Sbjct  176  TECWSLLE  183



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 169/188 (90%), Gaps = 5/188 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A EFN+C SG SENWM+LSIAG+KP PRFNH+AAVVGNKMVVVGGE+GS +LEDVQVLNF
Sbjct  56   APEFNDCASGGSENWMLLSIAGEKPTPRFNHAAAVVGNKMVVVGGETGSRMLEDVQVLNF  115

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D FSWT+ SSKLYLSPTSLPLKIPACKGH+LV WGKK+L+VGGKTDP+S+KVSVWAFDTE
Sbjct  116  DSFSWTTASSKLYLSPTSLPLKIPACKGHALVQWGKKILMVGGKTDPSSEKVSVWAFDTE  175

Query  895  TECWSLME  918
            TECWSL+E
Sbjct  176  TECWSLLE  183



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score =   281 bits (718),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRR+MK+GR+KVQLSD++QGT+SPIRH KRFSSS GE V  + ++S+E +C  S+ 
Sbjct  1    MFGFSRRKMKIGRVKVQLSDSSQGTRSPIRHAKRFSSSNGEGVALASSESDELNCHSSSN  60

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E NNC+SGSSENWMV SI+G+KP PRFNH+AAVVGNKMVVVGGES SGLLEDVQVLNF
Sbjct  61   TPELNNCSSGSSENWMVPSISGEKPTPRFNHAAAVVGNKMVVVGGESASGLLEDVQVLNF  120

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DR+SWT  SSKLYLSPTSLPLKIPACKGH+LV WGKKVLL+GGKT+PASD+VSVWAFD E
Sbjct  121  DRYSWTKSSSKLYLSPTSLPLKIPACKGHTLVPWGKKVLLIGGKTEPASDRVSVWAFDME  180

Query  895  TECWSLME  918
             ECWSL+E
Sbjct  181  AECWSLIE  188



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   276 bits (705),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSST-GEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGRLKVQL+D+AQGT+SPI+  KR S++  GE+ G +   S+E +CQ+S+
Sbjct  1    MFGFSRRRMKLGRLKVQLADSAQGTRSPIKQSKRTSNTNNGESGGRASGQSDELNCQYSS  60

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A E NN T+G SENWMVLSIAGDKP PRFNH+AAV+GNKMVVVGGES +GLLEDVQVLN
Sbjct  61   DAPEANNTTTGKSENWMVLSIAGDKPTPRFNHAAAVIGNKMVVVGGESENGLLEDVQVLN  120

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRF+W++ SSK+YLSPTSLPLKIPACKGHSLVSWG+KVLLVGGKT+P S++VSVWAFD 
Sbjct  121  FDRFTWSAPSSKIYLSPTSLPLKIPACKGHSLVSWGQKVLLVGGKTEPGSERVSVWAFDI  180

Query  892  ETECWSLME  918
            ETECWSLME
Sbjct  181  ETECWSLME  189



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 160/188 (85%), Gaps = 3/188 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLS+  QGT++PIRHPKR  +S GE    S   S+E  C  ST 
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANQGTRTPIRHPKRNGNSNGEGDAGSSGHSDEVDCLPST-  59

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E ++C SGSSENWMVLSIAGDKP PR NH+AAV+GNKMVVVGGESG+GLL+DVQVLNF
Sbjct  60   --EISSCASGSSENWMVLSIAGDKPTPRSNHAAAVIGNKMVVVGGESGTGLLDDVQVLNF  117

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRFSWT  SSKLYLSP+SLPLKIPACKGHSLVSWGKK LL+GGKTDP SD++SVWA DTE
Sbjct  118  DRFSWTKASSKLYLSPSSLPLKIPACKGHSLVSWGKKALLIGGKTDPGSDRISVWALDTE  177

Query  895  TECWSLME  918
            TECWSLME
Sbjct  178  TECWSLME  185



>gb|KDO75106.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75107.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75108.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75109.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
Length=352

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N +++  C+ + 
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTI  60

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
               E +N TSG+SENWMVLSIAGDKPIPRFNH+AAV+GNKM+VVGGESG+GLL+DVQVLN
Sbjct  61   AGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLN  120

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRFSWT+ SSKLYLSP+SLPLKIPAC+GHSL+SWGKKVLLVGGKTD  SD+VSVW FDT
Sbjct  121  FDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDT  180

Query  892  ETECWSLME  918
            ETECWS++E
Sbjct  181  ETECWSVVE  189



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score =   268 bits (685),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 161/188 (86%), Gaps = 5/188 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLS+   GT++P+R PKR  +  G+A G S   S+E  CQ ST 
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANPGTRTPVRPPKRNGTEIGDAAGGSSGHSDEVDCQPST-  59

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E  +C  GSSENWMVLSIAGDKPIPR NH+AAV+GNKM+VVGGESG+GLL+DVQVLNF
Sbjct  60   --EITSC--GSSENWMVLSIAGDKPIPRSNHAAAVIGNKMIVVGGESGTGLLDDVQVLNF  115

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRFSWT+ SSKLYLSP+SLPLKIPACKGHSLVSWGKK LL+GGKTDP SD++SVWAFDTE
Sbjct  116  DRFSWTTASSKLYLSPSSLPLKIPACKGHSLVSWGKKALLIGGKTDPGSDRISVWAFDTE  175

Query  895  TECWSLME  918
            TECWSLME
Sbjct  176  TECWSLME  183



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 161/188 (86%), Gaps = 5/188 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLS+   GT++P+R PKR  +  G+A G S   S+E  CQ ST 
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANPGTRTPVRPPKRNGTEIGDAAGGSSGHSDEVDCQPST-  59

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E  +C  GSSENWMVLSIAGDKPIPR NH+AAV+GNKM+VVGGESG+GLL+DVQVLNF
Sbjct  60   --EITSC--GSSENWMVLSIAGDKPIPRSNHAAAVIGNKMIVVGGESGTGLLDDVQVLNF  115

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRFSWT+ SSKLYLSP+SLPLKIPACKGHSLVSWGKK LL+GGKTDP SD++SVWAFDTE
Sbjct  116  DRFSWTTASSKLYLSPSSLPLKIPACKGHSLVSWGKKALLIGGKTDPGSDRISVWAFDTE  175

Query  895  TECWSLME  918
            TECWSLME
Sbjct  176  TECWSLME  183



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N ++E  C+ + 
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADERDCECTI  60

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
               E +N TSG+SENWMVLSIAGDKPIPRFNH+AAV+GNKM+VVGGESG+GLL+DVQVLN
Sbjct  61   AGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLN  120

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRFSWT+ SSKLYLSP+SLPLKIPAC+GHSL+SWGKKVLLVGGKTD  SD+VSVW FDT
Sbjct  121  FDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDT  180

Query  892  ETECWSLME  918
            ETECWS++E
Sbjct  181  ETECWSVVE  189



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score =   266 bits (680),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+ QGT+SPIR  KR   S GE    + + ++E +CQ S+ 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSTQGTRSPIRPAKRVGHSNGENTAPTSSHTDELNCQCSS-  59

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
             SE +N T G+SENWMVLS  GDKP PRFNH+AAV+GNKMVVVGGESG  LL+DVQVLNF
Sbjct  60   RSETDNRTPGNSENWMVLSTIGDKPKPRFNHAAAVIGNKMVVVGGESGHELLDDVQVLNF  119

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            +RF+WT+ SSKLYLSP+SLPLKIPACKGHSLVSWGKKVLL+GGKTDPASD+VSVW+FDTE
Sbjct  120  ERFTWTTASSKLYLSPSSLPLKIPACKGHSLVSWGKKVLLIGGKTDPASDRVSVWSFDTE  179

Query  895  TECWSLME  918
            TECWSLME
Sbjct  180  TECWSLME  187



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDVPATSNSDELDSQCLSA  60

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E +N  +GSSENWMVL I+GD+P PRFNH+AAV+GNKM+VVGGESG+ LL+DVQVLNF
Sbjct  61   VPEISNSATGSSENWMVLLISGDQPTPRFNHAAAVIGNKMIVVGGESGNELLDDVQVLNF  120

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D F+WT+ SSKLYLSP+SLPLKIPACKGH LVSWGKK LL+GGKT+P SDK+SVWAFDTE
Sbjct  121  DSFTWTTASSKLYLSPSSLPLKIPACKGHKLVSWGKKALLIGGKTEPGSDKISVWAFDTE  180

Query  895  TECWSLME  918
            TECWS ME
Sbjct  181  TECWSHME  188



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score =   265 bits (677),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N +++  C+ + 
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTI  60

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
               E +N TSG+SENWMVLSIAGDKPIPRFNH+AAV+GNKM+VVGGESG+GLL+DVQVLN
Sbjct  61   AGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLN  120

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRFSWT+ SSKLYLSP+SLPLKIPAC+GHSL+SWGKKVLLVGGKTD  SD+VSVW FDT
Sbjct  121  FDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDT  180

Query  892  ETECWSLME  918
            ETECWS++E
Sbjct  181  ETECWSVVE  189



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   265 bits (677),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 159/189 (84%), Gaps = 5/189 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH KR     G+ V  +   SEE  C  S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTQGTRSPIRHHKR----NGDRVAGTSGHSEEIDCPLSS  56

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A E + CT+GSSENWMVLSIAG+KP PR +H+AAV+ NKM+VVGGESGSGLL+ VQVLN
Sbjct  57   AAPEMHTCTAGSSENWMVLSIAGNKPTPRSHHAAAVIQNKMIVVGGESGSGLLDGVQVLN  116

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRFSWT+ SSKLYLSP+SLPLKIPACKGH LVSWGKK LL+GGKTDPASDK+SVWAFDT
Sbjct  117  FDRFSWTTASSKLYLSPSSLPLKIPACKGHCLVSWGKKALLIGGKTDPASDKISVWAFDT  176

Query  892  ETECWSLME  918
            ETECWSLME
Sbjct  177  ETECWSLME  185



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 159/189 (84%), Gaps = 5/189 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH KR     G+ V  +   SEE  C  S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTQGTRSPIRHHKR----NGDRVAGTSGHSEEIDCPLSS  56

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A E + CT+GSSENWMVLSIAG+KP PR +H+AAV+ NKM+VVGGESGSGLL+ VQVLN
Sbjct  57   AAPEMHTCTAGSSENWMVLSIAGNKPTPRSHHAAAVIQNKMIVVGGESGSGLLDGVQVLN  116

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRFSWT+ SSKLYLSP+SLPLKIPACKGH LVSWGKK LL+GGKTDPASDK+SVWAFDT
Sbjct  117  FDRFSWTTASSKLYLSPSSLPLKIPACKGHCLVSWGKKALLIGGKTDPASDKISVWAFDT  176

Query  892  ETECWSLME  918
            ETECWSLME
Sbjct  177  ETECWSLME  185



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDAPASSNSDELDGQCLSA  60

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E +N  +GSSENWMVLSI+GDKP PRFNH+AAV+GNKM+VVGGESG+ LL+DVQVL F
Sbjct  61   VPEISNSATGSSENWMVLSISGDKPSPRFNHAAAVIGNKMIVVGGESGNELLDDVQVLKF  120

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D F+WT+ SSKLYLSP+SLPLKIPACKGH LVSWGKK LL+GGKT+P SDK+SVWAFDTE
Sbjct  121  DSFTWTTASSKLYLSPSSLPLKIPACKGHKLVSWGKKALLIGGKTEPGSDKISVWAFDTE  180

Query  895  TECWSLME  918
            TECWS +E
Sbjct  181  TECWSHLE  188



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   262 bits (670),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDVLASSNSDELDGQCLSA  60

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E +N  +GSSENWMVLSI+GDKP PRFNH+AAV+GNKM+VVGGESG+ LL+DVQVL F
Sbjct  61   VPEISNSATGSSENWMVLSISGDKPSPRFNHAAAVIGNKMIVVGGESGNELLDDVQVLKF  120

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D F+WT+ SSKLYLSP+SLPLKIPACKGH LVSWGKK LL+GGKT+P SDK+SVWAFDTE
Sbjct  121  DSFTWTTASSKLYLSPSSLPLKIPACKGHKLVSWGKKALLIGGKTEPGSDKISVWAFDTE  180

Query  895  TECWSLME  918
            TECWS +E
Sbjct  181  TECWSHLE  188



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 158/191 (83%), Gaps = 9/191 (5%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGN---SINDSEESSCQH  525
            MFG SRRRMKLGRLKVQLS+   GT++PIRHPKR  +S GE  G+   S   S+E  CQ 
Sbjct  1    MFGISRRRMKLGRLKVQLSEANPGTRTPIRHPKRNGNSNGEGEGDAGGSSGHSDEVDCQP  60

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
            ST        TSGSSENWMVLSIAGDKP PR NH+AAV+GNKM+VVGGESG+GLL+DVQV
Sbjct  61   ST------EITSGSSENWMVLSIAGDKPTPRSNHAAAVIGNKMIVVGGESGTGLLDDVQV  114

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            L FDRFSWT  SSKLYLSP+SLPLKIPACKGHSLVSWGKK LL+GGKTDP SD++SVWAF
Sbjct  115  LTFDRFSWTMASSKLYLSPSSLPLKIPACKGHSLVSWGKKALLIGGKTDPGSDRISVWAF  174

Query  886  DTETECWSLME  918
            DTETECWSLME
Sbjct  175  DTETECWSLME  185



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRR  KL R+KVQLSDT QGT+SPIR+PKR  +S G+ V  +   SEE  CQ S+ 
Sbjct  1    MFGFSRRHKKLSRVKVQLSDTTQGTRSPIRYPKRNGNSNGDGVAGTSGHSEEIDCQFSST  60

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A E +NC SGSSENWMVLSIAGDKP PR  H+A V+ NKM+VVGGESG+GLL+DVQVLNF
Sbjct  61   APEISNCVSGSSENWMVLSIAGDKPTPRSYHAACVIENKMIVVGGESGNGLLDDVQVLNF  120

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D FSWT+ SSKLYLSP+SLPL+IPACKGH LVSWGKK LL+GGKTD  SDK+SVWAFDTE
Sbjct  121  DTFSWTTASSKLYLSPSSLPLQIPACKGHCLVSWGKKALLIGGKTDLGSDKISVWAFDTE  180

Query  895  TECWSLME  918
            TECW+LME
Sbjct  181  TECWALME  188



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGRLKVQLSD+AQGT+SPIR PK   SS  E    + ++S+E   Q S+ 
Sbjct  1    MFGFSRRRLKLGRLKVQLSDSAQGTRSPIRQPKPNKSSNSECDAPASSNSDEPDHQCSSA  60

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A E +N T GSSENWMVLS++GDKP PRFNH+AAV+GNKM+VVGGESG+ LL+DVQVLNF
Sbjct  61   APEISNSTMGSSENWMVLSVSGDKPTPRFNHAAAVIGNKMIVVGGESGNELLDDVQVLNF  120

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D F+WT+ SSKLYLSP+SLPLKIPACKGH +VSWGKK LL+GGKT+P ++K+SVWAFDTE
Sbjct  121  DSFTWTTASSKLYLSPSSLPLKIPACKGHRMVSWGKKALLIGGKTEPGNEKISVWAFDTE  180

Query  895  TECWSLME  918
            TECWS ME
Sbjct  181  TECWSHME  188



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSR+RMK+GRLKVQLSD+ QGT+SPIR PKR +SS  ++   + + S+E  CQ    
Sbjct  1    MFGFSRKRMKIGRLKVQLSDSTQGTRSPIRQPKRNNSSNNDSDAPASSLSDELDCQ-CPS  59

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A E +N T GSSENWMVLSI+GDKP PRFNH+AAV+GNKM+VVGGESGS LL+DVQVLNF
Sbjct  60   APEISNSTMGSSENWMVLSISGDKPKPRFNHAAAVIGNKMIVVGGESGSELLDDVQVLNF  119

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D F+WT+  SKLYLSP+SLPLKIPACKGH LVSWGKK LLVGGKT+P SDK+SVWAFDTE
Sbjct  120  DSFTWTTALSKLYLSPSSLPLKIPACKGHKLVSWGKKALLVGGKTEPGSDKISVWAFDTE  179

Query  895  TECWSLME  918
            TECWS ME
Sbjct  180  TECWSHME  187



>gb|EPS67095.1| hypothetical protein M569_07681 [Genlisea aurea]
Length=238

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 3/188 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRLKV LSD++QG +SP R  KRFS +  E    ++ ++++ + Q S+ 
Sbjct  1    MFGFSKRRMKLGRLKVHLSDSSQGLRSPHRPAKRFSHTNVEG---AVAENDDLNRQSSSA  57

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
             SEF++CTSGSSENWMVLSI+G+KP PRFNH+AAVVGNKMVVVGGES +GLLEDVQVLNF
Sbjct  58   VSEFSHCTSGSSENWMVLSISGEKPTPRFNHAAAVVGNKMVVVGGESANGLLEDVQVLNF  117

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRFSW   S+KLY SP SLPLKIPACKGH+LV WGKKVLL+GGK++P S+K SVWA D E
Sbjct  118  DRFSWIKASTKLYRSPNSLPLKIPACKGHTLVPWGKKVLLIGGKSEPVSEKTSVWALDVE  177

Query  895  TECWSLME  918
            +ECWSL+E
Sbjct  178  SECWSLIE  185



>ref|XP_010241732.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Nelumbo nucifera]
Length=576

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E +NCTSG+SENWMVLS  GDKP PRFNH+AAV+G+KM+VVGGESG GLLEDVQVLNF
Sbjct  59   GPEIDNCTSGNSENWMVLSTIGDKPEPRFNHAAAVIGSKMIVVGGESGHGLLEDVQVLNF  118

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRF+WT+ SS+LYLSP+SLPLKIPACKGH LVSWGKKVLL+GGKTDPAS +VSVW+FDTE
Sbjct  119  DRFTWTTASSRLYLSPSSLPLKIPACKGHGLVSWGKKVLLIGGKTDPASGRVSVWSFDTE  178

Query  895  TECWSLME  918
            TECWSLME
Sbjct  179  TECWSLME  186



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E +NCTSG+SENWMVLS  GDKP PRFNH+AAV+G+KM+VVGGESG GLLEDVQVLNF
Sbjct  59   GPEIDNCTSGNSENWMVLSTIGDKPEPRFNHAAAVIGSKMIVVGGESGHGLLEDVQVLNF  118

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRF+WT+ SS+LYLSP+SLPLKIPACKGH LVSWGKKVLL+GGKTDPAS +VSVW+FDTE
Sbjct  119  DRFTWTTASSRLYLSPSSLPLKIPACKGHGLVSWGKKVLLIGGKTDPASGRVSVWSFDTE  178

Query  895  TECWSLME  918
            TECWSLME
Sbjct  179  TECWSLME  186



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E +NCTSG+SENWMVLS  GDKP PRFNH+AAV+G+KM+VVGGESG GLLEDVQVLNF
Sbjct  59   GPEIDNCTSGNSENWMVLSTIGDKPEPRFNHAAAVIGSKMIVVGGESGHGLLEDVQVLNF  118

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRF+WT+ SS+LYLSP+SLPLKIPACKGH LVSWGKKVLL+GGKTDPAS +VSVW+FDTE
Sbjct  119  DRFTWTTASSRLYLSPSSLPLKIPACKGHGLVSWGKKVLLIGGKTDPASGRVSVWSFDTE  178

Query  895  TECWSLME  918
            TECWSLME
Sbjct  179  TECWSLME  186



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              E +NCTSG+SENWMVLS  GDKP PRFNH+AAV+G+KM+VVGGESG GLLEDVQVLNF
Sbjct  59   GPEIDNCTSGNSENWMVLSTIGDKPEPRFNHAAAVIGSKMIVVGGESGHGLLEDVQVLNF  118

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRF+WT+ SS+LYLSP+SLPLKIPACKGH LVSWGKKVLL+GGKTDPAS +VSVW+FDTE
Sbjct  119  DRFTWTTASSRLYLSPSSLPLKIPACKGHGLVSWGKKVLLIGGKTDPASGRVSVWSFDTE  178

Query  895  TECWSLME  918
            TECWSLME
Sbjct  179  TECWSLME  186



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSR+  KLGR+K VQLSDT QGT+SP+RHPKR ++S  + V  S   SEE  CQ ++
Sbjct  1    MFGFSRKHKKLGRVKKVQLSDTTQGTRSPLRHPKRNANSNDDGVEGSSGHSEEIDCQFTS  60

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
               E +NC SGSSENWMVLSIAGDKP PR  H+A V+ NKM+VVGGESG+GLL+DVQVLN
Sbjct  61   TGPEISNCASGSSENWMVLSIAGDKPTPRSYHAACVIENKMIVVGGESGNGLLDDVQVLN  120

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD FSWT+VSSKLYLSP+SLPL+IPACKGHSLVSWG+K LL+GGKTD   DK+SVWAFDT
Sbjct  121  FDTFSWTTVSSKLYLSPSSLPLQIPACKGHSLVSWGQKALLIGGKTDSGIDKISVWAFDT  180

Query  892  ETECWSLME  918
            ETECWSL+E
Sbjct  181  ETECWSLIE  189



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score =   254 bits (649),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 155/189 (82%), Gaps = 4/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH ++     G+ V  +   SEE   Q  +
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTPQGTRSPIRHHQK---RNGDGVARTSGHSEEIDRQFLS  57

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
              +E + CTSGSSENWMVLSIAG+KP PR  H+AAVV NKMVVVGGESGSGLL+DVQVLN
Sbjct  58   ATAEMHTCTSGSSENWMVLSIAGEKPTPRSYHAAAVVENKMVVVGGESGSGLLDDVQVLN  117

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRF WT  SSKLYLSP+SLPLKIPACKGH LVSWGKK LL+GGKTDPASDK+SVW FDT
Sbjct  118  FDRFLWTKASSKLYLSPSSLPLKIPACKGHCLVSWGKKTLLIGGKTDPASDKISVWVFDT  177

Query  892  ETECWSLME  918
            ETECWSLME
Sbjct  178  ETECWSLME  186



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSR+  KLGR+K VQLSDT QGT+SP+RHPKR ++S  + V  S   SEE  CQ ++
Sbjct  1    MFGFSRKHKKLGRVKKVQLSDTTQGTRSPLRHPKRNANSNDDGVEGSSGHSEEIDCQFTS  60

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
               E +NC SGSSENWMVLSIAGDKP PR  H+A V+ NKM+VVGGESG+GLL+DVQVLN
Sbjct  61   TGPEISNCASGSSENWMVLSIAGDKPTPRSYHAACVIENKMIVVGGESGNGLLDDVQVLN  120

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD FSWT+VSSKLYLSP+SLPL+IPACKGHSLVSWG+K LL+GGKTD   DK+SVWAFDT
Sbjct  121  FDTFSWTTVSSKLYLSPSSLPLQIPACKGHSLVSWGQKALLIGGKTDSGIDKISVWAFDT  180

Query  892  ETECWSLME  918
            ETECWSL+E
Sbjct  181  ETECWSLIE  189



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 159/190 (84%), Gaps = 3/190 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE-SSCQHST  531
            MFGF RRRMKLGRLKVQLSD AQGT+SPIR+PKR SSS  E    +   SEE    Q ++
Sbjct  1    MFGF-RRRMKLGRLKVQLSDPAQGTRSPIRNPKRGSSSNSECAAPASRHSEEHDEGQRAS  59

Query  532  GASEF-NNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
               +  NN  SG SENWMVLSIAG+KP PRFNH+A V+GNKM+VVGGESGSGLL+DVQVL
Sbjct  60   DVPDISNNGASGQSENWMVLSIAGEKPAPRFNHAATVIGNKMIVVGGESGSGLLDDVQVL  119

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            NFD+F+WT  SSKLYLSP+SLPLKIPACKGHSLVSWGKK LLVGGKT+P +++V+VWAFD
Sbjct  120  NFDKFTWTRASSKLYLSPSSLPLKIPACKGHSLVSWGKKALLVGGKTEPGNERVAVWAFD  179

Query  889  TETECWSLME  918
            TETECWSLME
Sbjct  180  TETECWSLME  189



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE-SSCQHST  531
            MFGF RRRMKLGRLKVQLSD AQGT+SPIR+PKR S S  E    +   SEE    Q ++
Sbjct  1    MFGF-RRRMKLGRLKVQLSDPAQGTRSPIRNPKRGSGSNSECAAPASRHSEEHDEGQRAS  59

Query  532  GASEF-NNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
               +  NN  SG SENWMVLSIAG+KP PRFNH+A V+GNKM+VVGGESGSGLL+DVQVL
Sbjct  60   DVPDISNNGASGQSENWMVLSIAGEKPAPRFNHAATVIGNKMIVVGGESGSGLLDDVQVL  119

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            NFD+F+WT  SSKLYLSP+SLPLKIPACKGHSLVSWGKK LLVGGKT+P +++V+VWAFD
Sbjct  120  NFDKFTWTRASSKLYLSPSSLPLKIPACKGHSLVSWGKKALLVGGKTEPGNERVAVWAFD  179

Query  889  TETECWSLME  918
            TETECWSLME
Sbjct  180  TETECWSLME  189



>ref|XP_012069388.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Jatropha 
curcas]
 gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 161/189 (85%), Gaps = 3/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGR+K VQLSD+   T+SP+R  KR  +  GE    + +  +E  CQ S+
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSTLVTRSPVRTQKR--NPNGEGAAPTTSHFDELDCQCSS  58

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
               E N+ TSGSSENWMVLS++G+KP+PRFNH+A V+G KM+VVGGESG+GLL+DVQVLN
Sbjct  59   APPEINSSTSGSSENWMVLSVSGEKPMPRFNHAATVIGKKMIVVGGESGNGLLDDVQVLN  118

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD+F+WT++SSKLYLSP+SLPLKIPAC+GHSLVSWGKK LL+GGKTDPASD++SVWAFDT
Sbjct  119  FDQFTWTAISSKLYLSPSSLPLKIPACRGHSLVSWGKKALLIGGKTDPASDRISVWAFDT  178

Query  892  ETECWSLME  918
            ETECWSL+E
Sbjct  179  ETECWSLLE  187



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score =   248 bits (633),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQL+++A GT  PIR PKR  +S  E  G     S E   Q S+ 
Sbjct  1    MFGFSRRRMKLGRLKVQLNESANGT--PIRQPKRTGNSNSECDGPVSRKSNEVDAQCSSA  58

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
            A E  +   G+SENWM+LSI+GDKP PRFNH+A V+GNKM+VVGGESG+GLL+DVQVLNF
Sbjct  59   APENGSSAMGNSENWMMLSISGDKPTPRFNHAATVIGNKMIVVGGESGNGLLDDVQVLNF  118

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            DRFSWT+ SSKLYLSP+SLPLKIPACKGH LVSWGKK LLVGGKT+P  DKVSVWAFD E
Sbjct  119  DRFSWTTASSKLYLSPSSLPLKIPACKGHFLVSWGKKALLVGGKTEPWGDKVSVWAFDAE  178

Query  895  TECWSLME  918
            TECWSLME
Sbjct  179  TECWSLME  186



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score =   247 bits (631),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 161/190 (85%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS RRMKLGR+K VQLSD+A  T+SPIR  KR ++   E V  + + S+E  CQ  +
Sbjct  1    MFSFSGRRMKLGRVKKVQLSDSALVTRSPIRPQKRTNNPNSEGVAPTTSHSDELDCQCPS  60

Query  532  GASEFNN-CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
               E N+  TSG+SENWMVLSIAGDKP PRFNH+A V+GNKM+VVGGESG+GLL+DVQVL
Sbjct  61   APPETNSSTTSGNSENWMVLSIAGDKPTPRFNHAATVIGNKMIVVGGESGNGLLDDVQVL  120

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            NFD+F+WT++SSKLYLSP+SLPLKIPACKGHSLV+WGKK LL+GGKTDP++D++SVWAFD
Sbjct  121  NFDQFTWTTISSKLYLSPSSLPLKIPACKGHSLVAWGKKALLIGGKTDPSTDRISVWAFD  180

Query  889  TETECWSLME  918
            TETECWSL+E
Sbjct  181  TETECWSLLE  190



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT  GT+SPIRH KR  +S G+ V  +   SE+     S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTLGTRSPIRHHKRNVNSNGDRVTGTSGHSEK---MLSS  57

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A + + CTSGSSENWMVLSI+GDKP PR  H+AAV+ NKM+VVGGESGSGLL+DVQVLN
Sbjct  58   AAPDMHTCTSGSSENWMVLSISGDKPTPRSYHAAAVIQNKMIVVGGESGSGLLDDVQVLN  117

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRFSWT  SSKLYLSP+SLPLK+PACKGH LVSWG K LL+GGKTDPASDK+SVWAFDT
Sbjct  118  FDRFSWTMASSKLYLSPSSLPLKLPACKGHCLVSWGGKALLIGGKTDPASDKISVWAFDT  177

Query  892  ETECWSLME  918
            +TECWS ME
Sbjct  178  DTECWSPME  186



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score =   247 bits (630),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT  GT+SPIRH KR  +S G+ V  +   SE+     S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTLGTRSPIRHHKRNVNSNGDRVTGTSGHSEK---MLSS  57

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A + + CTSGSSENWMVLSI+GDKP PR  H+AAV+ NKM+VVGGESGSGLL+DVQVLN
Sbjct  58   AAPDMHTCTSGSSENWMVLSISGDKPTPRSYHAAAVIQNKMIVVGGESGSGLLDDVQVLN  117

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRFSWT  SSKLYLSP+SLPLK+PACKGH LVSWG K LL+GGKTDPASDK+SVWAFDT
Sbjct  118  FDRFSWTMASSKLYLSPSSLPLKLPACKGHCLVSWGGKALLIGGKTDPASDKISVWAFDT  177

Query  892  ETECWSLME  918
            +TECWS ME
Sbjct  178  DTECWSPME  186



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 7/191 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAV--GNSINDSEESSCQH  525
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE+       +D+ +S C  
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGESAMPAGGHSDAFDSHCPS  62

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
            +  A E N  +SG+SENWMVLS+AG+KP+PRFNH+AAVVGNKM+VVGGESG+GLL+DVQV
Sbjct  63   T--APEIN--SSGNSENWMVLSVAGEKPVPRFNHAAAVVGNKMIVVGGESGNGLLDDVQV  118

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            LNFD FSW++ SSKLYLSP+S PLKIPACKGHSLVSWGKK LLVGG+TDP +D+VSVWAF
Sbjct  119  LNFDNFSWSTASSKLYLSPSSFPLKIPACKGHSLVSWGKKALLVGGRTDPGNDRVSVWAF  178

Query  886  DTETECWSLME  918
            DTETECWS+ME
Sbjct  179  DTETECWSVME  189



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score =   244 bits (624),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 7/191 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAV--GNSINDSEESSCQH  525
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE+       +D+ +S C  
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGESAMPAGGHSDAFDSHCPS  62

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
            +  A E N  +SG+SENWMVLS+AG+KP+PRFNH+AAVVGNKM+VVGGESG+GLL+DVQV
Sbjct  63   T--APEIN--SSGNSENWMVLSVAGEKPVPRFNHAAAVVGNKMIVVGGESGNGLLDDVQV  118

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            LNFD FSW++ SSKLYLSP+S PLKIPACKGHSLVSWGKK LLVGG+TDP +D+VSVWAF
Sbjct  119  LNFDNFSWSTASSKLYLSPSSFPLKIPACKGHSLVSWGKKALLVGGRTDPGNDRVSVWAF  178

Query  886  DTETECWSLME  918
            DTETECWS+ME
Sbjct  179  DTETECWSVME  189



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 159/189 (84%), Gaps = 3/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE+   +   S+       +
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGESAMPAGGHSDAFDSHCPS  62

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A E N  +SG+SENWMVLS+AG+KP+PRFNH+AAVVGNKM+VVGGESG+GLL+DVQVLN
Sbjct  63   TAPEIN--SSGNSENWMVLSVAGEKPVPRFNHAAAVVGNKMIVVGGESGNGLLDDVQVLN  120

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD FSW++ SSKLYLSP+S PLKIPACKGHSLVSWGKK LLVGG+TDP +D+VSVWAFDT
Sbjct  121  FDNFSWSTASSKLYLSPSSFPLKIPACKGHSLVSWGKKALLVGGRTDPGNDRVSVWAFDT  180

Query  892  ETECWSLME  918
            ETECWS+ME
Sbjct  181  ETECWSVME  189



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 153/188 (81%), Gaps = 5/188 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MF FSRRR KLGR+KV LSD  QGTKSP+R  KR S+S  E+   + +   E S    + 
Sbjct  3    MFSFSRRRTKLGRMKV-LSDPTQGTKSPLRPLKRASNSNVESFVATADRVSEPS----SA  57

Query  535  ASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNF  714
              + NNCTSGSSE+WMVLSIAGDKP PRFNH+A VVGNKMVVVGGE   G+L+DVQVL+F
Sbjct  58   PQDINNCTSGSSESWMVLSIAGDKPKPRFNHAATVVGNKMVVVGGECTDGMLDDVQVLSF  117

Query  715  DRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
            D+FSWTS SSK+YLSPTSLPLKIP+C+GHSLVSWGKK LL+GGKT+P S+KVSVWAFDTE
Sbjct  118  DQFSWTSASSKIYLSPTSLPLKIPSCRGHSLVSWGKKTLLIGGKTNPGSEKVSVWAFDTE  177

Query  895  TECWSLME  918
            T CWSLME
Sbjct  178  TVCWSLME  185



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score =   238 bits (608),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 158/189 (84%), Gaps = 4/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++S  E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNSNVESAMLAVNHSDELES-HCP  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A   N  +SG+SENWMVLS+AG+ P+PRFNH+A VVGNKM+VVGGES +GLL+DVQVLN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPVPRFNHAATVVGNKMIVVGGESANGLLDDVQVLN  117

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD FSWT  SSKLYLSP++LPLKIP+CKGHSLVSWGKK LLVGG+TDPA+DKVSVW+FDT
Sbjct  118  FDTFSWTMASSKLYLSPSNLPLKIPSCKGHSLVSWGKKALLVGGRTDPANDKVSVWSFDT  177

Query  892  ETECWSLME  918
            ETECWS+ME
Sbjct  178  ETECWSVME  186



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 159/193 (82%), Gaps = 5/193 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEESSCQ  522
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E V  + N+S+E    
Sbjct  1    MFGFSKRRTKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNANSEGVALTTNNSDELDYN  60

Query  523  HSTGAS-EFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledv  699
             S+ A  + +  TSG++ENWMVLSI+GD+P PRFNH+A V+GNKM+VVGG+SGSGLL+DV
Sbjct  61   CSSSAPLDISASTSGNAENWMVLSISGDEPTPRFNHAATVIGNKMIVVGGDSGSGLLDDV  120

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVL FD+F+WT++SSKLYLSP+SLPLKIPAC+GH LVSWGKK LL+GGKTDPASD++SVW
Sbjct  121  QVLKFDQFTWTTISSKLYLSPSSLPLKIPACRGHCLVSWGKKALLIGGKTDPASDRISVW  180

Query  880  AFDTETECWSLME  918
            AF TETECWS++E
Sbjct  181  AFHTETECWSIIE  193



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEESSCQ  522
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E    + N+S+E    
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  523  HSTGAS-EFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledv  699
             S+ A  + +  TSG++ENWMVLSI+GDKP PRFNH+A V+GNKM+VVGG+SGSGLL+DV
Sbjct  61   CSSSAPLDISASTSGNAENWMVLSISGDKPTPRFNHAATVIGNKMIVVGGDSGSGLLDDV  120

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVL FD+F+WT++SSKLYLSP+SLPLKIPAC+GH LVSWGKK LL+GGKTDPASD++SVW
Sbjct  121  QVLKFDQFTWTTISSKLYLSPSSLPLKIPACRGHCLVSWGKKALLIGGKTDPASDRISVW  180

Query  880  AFDTETECWSLME  918
            AF TETECWS++E
Sbjct  181  AFHTETECWSIIE  193



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 158/194 (81%), Gaps = 6/194 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRF-----SSSTGEAVGNSINDSEESS  516
            MFGFS+RRMKLGR+K VQLSD++ G +SPIR PKR      ++S G A+  S +D  +  
Sbjct  1    MFGFSKRRMKLGRVKKVQLSDSSPGIRSPIRPPKRIISNNNANSEGVALTASNSDDLDYH  60

Query  517  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglled  696
            C  S      ++    ++ENWMVLSI+GDKP PRFNH+A V+GNKM+VVGGESGSGLL+D
Sbjct  61   CSSSAPPVISSSTAGNNAENWMVLSISGDKPNPRFNHAATVIGNKMIVVGGESGSGLLDD  120

Query  697  vQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSV  876
            VQVL FD+F+WTS+SSKLYLSP+SLPLKIPAC+GH LVSWGKK LL+GGKTDPASD++SV
Sbjct  121  VQVLKFDQFTWTSISSKLYLSPSSLPLKIPACRGHCLVSWGKKALLIGGKTDPASDRISV  180

Query  877  WAFDTETECWSLME  918
            WAFDTETECWSL+E
Sbjct  181  WAFDTETECWSLVE  194



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   236 bits (601),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEESSCQ  522
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E    + N+S+E    
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  523  HSTGAS-EFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledv  699
             S+ A  + +  TSG++ENWMVLSI+GDKP PRFNH+A V+GNKM+VVGG+SGSGLL+DV
Sbjct  61   CSSSAPLDISASTSGNAENWMVLSISGDKPTPRFNHAATVIGNKMIVVGGDSGSGLLDDV  120

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVL FD+F+WT++SSKLYLSP+SLPLKIPAC+GH LVSWGKK LL+GGKTDPASD++SVW
Sbjct  121  QVLKFDQFTWTTISSKLYLSPSSLPLKIPACRGHCLVSWGKKALLIGGKTDPASDRISVW  180

Query  880  AFDTETECWSLME  918
            AF TETECWS++E
Sbjct  181  AFHTETECWSIIE  193



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score =   233 bits (595),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELES-HCP  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A   N  +SG+SENWMVLS+AG+ P PRFNH+A VVGNKM+VVGGES +GLL+DVQVLN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPEPRFNHAATVVGNKMIVVGGESANGLLDDVQVLN  117

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD FSWT  SSKLYLSP++LPLKIP+CKGHSLVSWGKK LLVGG+TDPA+DKVSVW+FDT
Sbjct  118  FDTFSWTMASSKLYLSPSNLPLKIPSCKGHSLVSWGKKALLVGGRTDPANDKVSVWSFDT  177

Query  892  ETECWSLME  918
            ETECWS+ME
Sbjct  178  ETECWSVME  186



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   236 bits (601),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEESSCQ  522
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E    + N+S+E    
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  523  HSTGAS-EFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledv  699
             S+ A  + +  TSG++ENWMVLSI+GDKP PRFNH+A V+GNKM+VVGG+SGSGLL+DV
Sbjct  61   CSSSAPLDISASTSGNAENWMVLSISGDKPTPRFNHAATVIGNKMIVVGGDSGSGLLDDV  120

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVL FD+F+WT++SSKLYLSP+SLPLKIPAC+GH LVSWGKK LL+GGKTDPASD++SVW
Sbjct  121  QVLKFDQFTWTTISSKLYLSPSSLPLKIPACRGHCLVSWGKKALLIGGKTDPASDRISVW  180

Query  880  AFDTETECWSLME  918
            AF TETECWS++E
Sbjct  181  AFHTETECWSIIE  193



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   236 bits (601),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEESSCQ  522
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E    + N+S+E    
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  523  HSTGAS-EFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledv  699
             S+ A  + +  TSG++ENWMVLSI+GDKP PRFNH+A V+GNKM+VVGG+SGSGLL+DV
Sbjct  61   CSSSAPLDISASTSGNAENWMVLSISGDKPTPRFNHAATVIGNKMIVVGGDSGSGLLDDV  120

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVL FD+F+WT++SSKLYLSP+SLPLKIPAC+GH LVSWGKK LL+GGKTDPASD++SVW
Sbjct  121  QVLKFDQFTWTTISSKLYLSPSSLPLKIPACRGHCLVSWGKKALLIGGKTDPASDRISVW  180

Query  880  AFDTETECWSLME  918
            AF TETECWS++E
Sbjct  181  AFHTETECWSIIE  193



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELES-HCP  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A   N  +SG+SENWMVLS+AG+ P PRFNH+A VVGNKM+VVGGES +GLL+DVQVLN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPEPRFNHAATVVGNKMIVVGGESANGLLDDVQVLN  117

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD FSWT  SSKLYLSP++LPLKIP+CKGHSLVSWGKK LLVGG+TDPA+DKVSVW+FDT
Sbjct  118  FDTFSWTMASSKLYLSPSNLPLKIPSCKGHSLVSWGKKALLVGGRTDPANDKVSVWSFDT  177

Query  892  ETECWSLME  918
            ETECWS+ME
Sbjct  178  ETECWSVME  186



>gb|KCW61088.1| hypothetical protein EUGRSUZ_H03862 [Eucalyptus grandis]
Length=510

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 153/189 (81%), Gaps = 6/189 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFG SRRRMK+GR+K VQLSD  QGT+SP+R  KR ++   E    + + S E+  Q  +
Sbjct  1    MFGISRRRMKIGRVKKVQLSDATQGTRSPMRQIKRGNNQNNEGAVPASDCSNENDSQSPS  60

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A E +     SSENW VLSI+G+KP+PRFNH+A V+ NKM+VVGGESG+GLL+DVQVL 
Sbjct  61   SAPEIS-----SSENWKVLSISGEKPMPRFNHAATVIENKMIVVGGESGNGLLDDVQVLR  115

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRFSWT+ SSKLYLSP+SLPLKIPAC+GHSLVSWGKKVLLVGGKT+P +DK+SVW FDT
Sbjct  116  FDRFSWTAASSKLYLSPSSLPLKIPACRGHSLVSWGKKVLLVGGKTEPGTDKLSVWVFDT  175

Query  892  ETECWSLME  918
            ETECWSLME
Sbjct  176  ETECWSLME  184



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 157/194 (81%), Gaps = 6/194 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRF-----SSSTGEAVGNSINDSEESS  516
            MFGFS+RRMKLGR+K VQLSD++ G +SPIR PKR      ++S   A+  S +D  +  
Sbjct  1    MFGFSKRRMKLGRVKKVQLSDSSPGIRSPIRPPKRIISNNNANSEDVALTASNSDDLDYH  60

Query  517  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglled  696
            C  S      ++    ++ENWMVLSI+GDKP PRFNH+A V+GNKM+VVGGESGSGLL+D
Sbjct  61   CSSSAPPVISSSTAGNNAENWMVLSISGDKPTPRFNHAATVIGNKMIVVGGESGSGLLDD  120

Query  697  vQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSV  876
            VQVL FD+F+WTS+SSKLYLSP+SLPLKIPAC+GH LVSWGKK LL+GGKTDPASD++SV
Sbjct  121  VQVLKFDQFTWTSISSKLYLSPSSLPLKIPACRGHCLVSWGKKALLIGGKTDPASDRISV  180

Query  877  WAFDTETECWSLME  918
            WAFDTETECWSL+E
Sbjct  181  WAFDTETECWSLVE  194



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELES-HCP  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A   N  +SG+SENWMVLS+AG+ P PRFNH+A VVGNKM+VVGGES +GLL+DVQVLN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPEPRFNHAATVVGNKMIVVGGESANGLLDDVQVLN  117

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD FSWT  SSKLYLSP++LPLKIP+CKGHSLVSWGKK LLVGG+TDPA+DKVSVW+FDT
Sbjct  118  FDTFSWTMASSKLYLSPSNLPLKIPSCKGHSLVSWGKKALLVGGRTDPANDKVSVWSFDT  177

Query  892  ETECWSLME  918
            ETECWS+ME
Sbjct  178  ETECWSVME  186



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELES-HCP  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A   N  +SG+SENWMVLS+AG+ P PRFNH+A VVGNKM+VVGGES +GLL+DVQVLN
Sbjct  60   PAPVIN--SSGNSENWMVLSVAGETPEPRFNHAATVVGNKMIVVGGESANGLLDDVQVLN  117

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD FSWT  SSKLYLSP++LPLKIP+CKGHSLVSWGKK LLVGG+TDPA+DKVSVW+FDT
Sbjct  118  FDTFSWTMASSKLYLSPSNLPLKIPSCKGHSLVSWGKKALLVGGRTDPANDKVSVWSFDT  177

Query  892  ETECWSLME  918
            ETECWS+ME
Sbjct  178  ETECWSVME  186



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score =   234 bits (596),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 4/186 (2%)
 Frame = +1

Query  364  FSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTGAS  540
            FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++S  E+   ++N S+E    H   A 
Sbjct  28   FSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNSNVESAMLAVNHSDELES-HCPPAP  86

Query  541  EFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDR  720
              N  +SG+SENWMVLS+AG+ P+PRFNH+A VVGNKM+VVGGES +GLL+DVQVLNFD 
Sbjct  87   VIN--SSGNSENWMVLSVAGETPVPRFNHAATVVGNKMIVVGGESANGLLDDVQVLNFDT  144

Query  721  FSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETE  900
            FSWT  SSKLYLSP++LPLKIP+CKGHSLVSWGKK LLVGG+TDPA+DKVSVW+FDTETE
Sbjct  145  FSWTMASSKLYLSPSNLPLKIPSCKGHSLVSWGKKALLVGGRTDPANDKVSVWSFDTETE  204

Query  901  CWSLME  918
            CWS+ME
Sbjct  205  CWSVME  210



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 153/189 (81%), Gaps = 6/189 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFG SRRRMK+GR+K VQLSD  QGT+SP+R  KR ++   E    + + S E+  Q  +
Sbjct  1    MFGISRRRMKIGRVKKVQLSDATQGTRSPMRQIKRGNNQNNEGAVPASDCSNENDSQSPS  60

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             A E +     SSENW VLSI+G+KP+PRFNH+A V+ NKM+VVGGESG+GLL+DVQVL 
Sbjct  61   SAPEIS-----SSENWKVLSISGEKPMPRFNHAATVIENKMIVVGGESGNGLLDDVQVLR  115

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FDRFSWT+ SSKLYLSP+SLPLKIPAC+GHSLVSWGKKVLLVGGKT+P +DK+SVW FDT
Sbjct  116  FDRFSWTAASSKLYLSPSSLPLKIPACRGHSLVSWGKKVLLVGGKTEPGTDKLSVWVFDT  175

Query  892  ETECWSLME  918
            ETECWSLME
Sbjct  176  ETECWSLME  184



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score =   232 bits (591),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  531
            MF FS+RRMKLGR+KVQLSD+AQGTKSP+R  KR  +ST EA    + + S+E   Q S 
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSAQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     SG+SENWM LS+ GDKP PRFNH+AA +GNKM+VVGGESG+GLL+DVQVLN
Sbjct  60   ---------SGNSENWMGLSVGGDKPAPRFNHAAAAIGNKMIVVGGESGNGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD F+W++VSSK+YLSP+SLPL IP+ KGH LVSWGKKVLLVGGKTDP+SD+VSVW+FDT
Sbjct  111  FDSFTWSTVSSKVYLSPSSLPLMIPSWKGHCLVSWGKKVLLVGGKTDPSSDRVSVWSFDT  170

Query  892  ETECWSLME  918
            E+ECWSLM+
Sbjct  171  ESECWSLMD  179



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score =   230 bits (587),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 156/189 (83%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  531
            MF FS+RRMKLGR+KVQLSD++QGTKSP+R  KR  +ST EA    + + S+E   Q S 
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSSQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     SG+SENWM LS++GDKP PRFNH+AA +GNKM+VVGGESG+GLL+DVQVLN
Sbjct  60   ---------SGNSENWMGLSVSGDKPAPRFNHAAAAIGNKMIVVGGESGNGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD F+W++VSSK+YLSP+SLPL IP+ KGH LVSWGKKVLLVGGKTDP+SD+VSVW+FDT
Sbjct  111  FDSFTWSTVSSKVYLSPSSLPLMIPSWKGHCLVSWGKKVLLVGGKTDPSSDRVSVWSFDT  170

Query  892  ETECWSLME  918
            E+ECWSLM+
Sbjct  171  ESECWSLMD  179



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score =   230 bits (587),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 156/189 (83%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  531
            MF FS+RRMKLGR+KVQLSD++QGTKSP+R  KR  +ST EA    + + S+E   Q S 
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSSQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     SG+SENWM LS++GDKP PRFNH+AA +GNKM+VVGGESG+GLL+DVQVLN
Sbjct  60   ---------SGNSENWMGLSVSGDKPAPRFNHAAAAIGNKMIVVGGESGNGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD F+W++VSSK+YLSP+SLPL IP+ KGH LVSWGKKVLLVGGKTDP+SD+VSVW+FDT
Sbjct  111  FDSFTWSTVSSKVYLSPSSLPLMIPSWKGHCLVSWGKKVLLVGGKTDPSSDRVSVWSFDT  170

Query  892  ETECWSLME  918
            E+ECWSLM+
Sbjct  171  ESECWSLMD  179



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score =   230 bits (587),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 158/193 (82%), Gaps = 13/193 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAV---GNS-INDSEESSC  519
            MF FSRRRMKL R+K VQLS++  GT+SPIR  KR +++  E+    G S  ND + S+ 
Sbjct  3    MFSFSRRRMKLNRVKKVQLSESVHGTRSPIRPSKRNNNTIVESALPAGTSHCNDFDPST-  61

Query  520  QHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledv  699
                 A E N  +SG+SENWMVLS+AG+KP+PRFNH+AAVVGN+M+VVGGESG+GLL+DV
Sbjct  62   -----APEIN--SSGNSENWMVLSVAGEKPVPRFNHAAAVVGNRMIVVGGESGNGLLDDV  114

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVLNFD FSWTS SSKLYLSP+S PLKIP+CKGH LVSWGKK LLVGG+TDP +D+VSVW
Sbjct  115  QVLNFDNFSWTSASSKLYLSPSSFPLKIPSCKGHCLVSWGKKALLVGGRTDPGNDRVSVW  174

Query  880  AFDTETECWSLME  918
            AFDTETECWS+ME
Sbjct  175  AFDTETECWSVME  187



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score =   228 bits (580),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 157/193 (81%), Gaps = 13/193 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAV---GNS-INDSEESSC  519
            MF FSRRRMKL R+K VQLS++  GT+SPIR  KR +++  E+    G S  ND + S+ 
Sbjct  3    MFSFSRRRMKLNRVKKVQLSESVHGTRSPIRPSKRNNNTIVESALPAGTSHCNDFDPST-  61

Query  520  QHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledv  699
                 A E N  +SG+SENWMVLS+AG+KP+PRFNH+AAV+GN+M+VVGGESG+GLL+DV
Sbjct  62   -----APEIN--SSGNSENWMVLSVAGEKPVPRFNHAAAVLGNRMIVVGGESGNGLLDDV  114

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVLNFD FSWT+ SSKLYLSP S PLKIP+CKGH LVSWGKK LLVGG+TDP +D+VSVW
Sbjct  115  QVLNFDNFSWTTASSKLYLSPNSFPLKIPSCKGHCLVSWGKKALLVGGRTDPGNDRVSVW  174

Query  880  AFDTETECWSLME  918
            AFDTETECWS+ME
Sbjct  175  AFDTETECWSVME  187



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score =   228 bits (580),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 157/203 (77%), Gaps = 21/203 (10%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQ-LSDTAQGTKSPI--RHPKRFSSS--TGEAVGNSINDSEESSC  519
            MFGFSRRR K GR KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  520  QHSTGASEFNN----------CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvgg  669
             HS    E +N          C+SG SENW++LSI+GDKP PRFNH+AAV+GNK++VVGG
Sbjct  58   GHS---HEIDNEIVSSTDISSCSSGGSENWVLLSISGDKPAPRFNHAAAVIGNKIIVVGG  114

Query  670  esgsglledvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKT  849
            ES +GLL+DVQVLNF+ FSWT+ SSKLYLSP+SLPLKIPACKGHSLVS+GKK LL+GGKT
Sbjct  115  ESSTGLLDDVQVLNFETFSWTTASSKLYLSPSSLPLKIPACKGHSLVSYGKKALLIGGKT  174

Query  850  DPASDKVSVWAFDTETECWSLME  918
            DP SD++SVWAFDTE+ECWSLME
Sbjct  175  DPGSDRISVWAFDTESECWSLME  197



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score =   228 bits (580),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 157/203 (77%), Gaps = 21/203 (10%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQ-LSDTAQGTKSPI--RHPKRFSSS--TGEAVGNSINDSEESSC  519
            MFGFSRRR K GR KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  520  QHSTGASEFNN----------CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvgg  669
             HS    E +N          C+SG SENW++LSI+GDKP PRFNH+AAV+GNK++VVGG
Sbjct  58   GHS---HEIDNEIVSSTDISSCSSGGSENWVLLSISGDKPAPRFNHAAAVIGNKIIVVGG  114

Query  670  esgsglledvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKT  849
            ES +GLL+DVQVLNF+ FSWT+ SSKLYLSP+SLPLKIPACKGHSLVS+GKK LL+GGKT
Sbjct  115  ESSTGLLDDVQVLNFETFSWTTASSKLYLSPSSLPLKIPACKGHSLVSYGKKALLIGGKT  174

Query  850  DPASDKVSVWAFDTETECWSLME  918
            DP SD++SVWAFDTE+ECWSLME
Sbjct  175  DPGSDRISVWAFDTESECWSLME  197



>ref|XP_006287583.1| hypothetical protein CARUB_v10000793mg [Capsella rubella]
 gb|EOA20481.1| hypothetical protein CARUB_v10000793mg [Capsella rubella]
Length=498

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 152/189 (80%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSSEAPVAATSYSDEHDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     SG+SENWMV+S+ GDKP PRFNH+AA +GNKM+VVGGES +GLL+DVQVLN
Sbjct  60   ---------SGNSENWMVVSVGGDKPAPRFNHAAAAIGNKMIVVGGESSNGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD F+W++ SSK+YLSP+SLPLKIP+ KGH LVSWGKKVLLVGGKTDP SD+VSVWAFDT
Sbjct  111  FDTFTWSTASSKVYLSPSSLPLKIPSWKGHCLVSWGKKVLLVGGKTDPCSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score =   224 bits (570),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 155/198 (78%), Gaps = 18/198 (9%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  504
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  505  EESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsg  684
            +E+ C   + +      +S  S+NW++LSI+GDKPIPRFNH+AAV+GNK++VVGGES +G
Sbjct  59   DENVCSDISSS------SSAGSDNWVLLSISGDKPIPRFNHAAAVIGNKIIVVGGESATG  112

Query  685  lledvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASD  864
            LL+DVQVLNFD FSWT+ SSKLYLSP+SLPLKIPACKGHSLVSWG+KVLLVGGKTD  SD
Sbjct  113  LLDDVQVLNFDTFSWTTASSKLYLSPSSLPLKIPACKGHSLVSWGEKVLLVGGKTDLGSD  172

Query  865  KVSVWAFDTETECWSLME  918
            K+SVW FDT+TE WSLME
Sbjct  173  KISVWEFDTKTEHWSLME  190



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score =   223 bits (568),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SPIRH KR S S GE  V  S+N  S++ +C+  
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPIRHTKRASQSNGENVVSASVNGRSDDINCRCP  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
             GA + + C  GSSENW VL   G KP PRFNH+AAVVG+KMVVVGG+SG GL++D  VL
Sbjct  64   LGAFDLSKCGLGSSENWTVLPTEGHKPAPRFNHAAAVVGSKMVVVGGDSGHGLMDDTLVL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D  +W + + K+YLSP+   LKIPACKGHSLVSWGK VLLVGGKTDP SDK+SVW+FD
Sbjct  124  SLDNLTWATAAPKVYLSPSGHSLKIPACKGHSLVSWGKMVLLVGGKTDPVSDKISVWSFD  183

Query  889  TETECWSLME  918
             ETECW  +E
Sbjct  184  IETECWLQIE  193



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score =   222 bits (565),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 151/189 (80%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  +S+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGFKSPLRATKRADNSSNEAALAATSYSDELDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     SG+ ENWMVLS++G+KP PRFNH+AA +GNKM++VGGESG+G L+DVQVLN
Sbjct  60   ---------SGNYENWMVLSVSGEKPAPRFNHAAAAIGNKMIIVGGESGNGFLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD F+W+S SSK+YLSP+SLPL IPA KGH LVSWGKKVLLVGGKTDP SD+VSVWAFDT
Sbjct  111  FDSFTWSSASSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTDPCSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score =   220 bits (561),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 149/190 (78%), Gaps = 13/190 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRR KLGR+K VQLSD+A G  SP+R  KR        V NS N+  E+  +HS 
Sbjct  1    MFSFSRRRTKLGRVKKVQLSDSASGRASPLRQTKR--------VNNSTNEGAETEARHS-  51

Query  532  GASEFN-NCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
               E +     G++ENWMVLS+ G+KP PRFNH+AA +GNKM+VVGGESG+GLL+DVQVL
Sbjct  52   --DELDFQSPPGNAENWMVLSVGGEKPSPRFNHAAAAIGNKMIVVGGESGNGLLDDVQVL  109

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            NFD F+W + SSK+YLSP+SLPLKIPA KGH LVSWGKKVLLVGGKT+P SD+VSVWAFD
Sbjct  110  NFDTFTWAAASSKVYLSPSSLPLKIPAWKGHCLVSWGKKVLLVGGKTEPCSDRVSVWAFD  169

Query  889  TETECWSLME  918
            T++ECWSLME
Sbjct  170  TDSECWSLME  179



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score =   220 bits (561),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 152/189 (80%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     SG+SENWMVLS+ G+KP PRFNH+AA +GNKM+VVGGESGSGLL+DVQVLN
Sbjct  60   ---------SGNSENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD  +W++ SSK+YLSP+SLPL IPA KGH LVSWGKKVLLVGGKTDP+SD+VSVWAFDT
Sbjct  111  FDSCTWSTASSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTDPSSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score =   220 bits (561),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 152/189 (80%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     SG+SENWMVLS+ G+KP PRFNH+AA +GNKM+VVGGESGSGLL+DVQVLN
Sbjct  60   ---------SGNSENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD  +W++ SSK+YLSP+SLPL IPA KGH LVSWGKKVLLVGGKTDP+SD+VSVWAFDT
Sbjct  111  FDSCTWSTASSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTDPSSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score =   220 bits (561),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 152/189 (80%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     SG+SENWMVLS+ G+KP PRFNH+AA +GNKM+VVGGESGSGLL+DVQVLN
Sbjct  60   ---------SGNSENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD  +W++ SSK+YLSP+SLPL IPA KGH LVSWGKKVLLVGGKTDP+SD+VSVWAFDT
Sbjct  111  FDSCTWSTASSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTDPSSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 151/189 (80%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     S +SENWMVL + GDKP PRFNH+AA +GNKM+VVGGESG+GLL+DVQVLN
Sbjct  60   ---------SRNSENWMVLPVGGDKPAPRFNHAAAAIGNKMIVVGGESGNGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD F+W++VSSK+YLSP+SLPL IP+ KGH LVSW KKVLLVGGKTDP SD+VSVWAFDT
Sbjct  111  FDSFTWSTVSSKVYLSPSSLPLMIPSWKGHCLVSWSKKVLLVGGKTDPCSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 150/189 (79%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVGFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     S ++ENWMVL + GDKP PRFNH+AA +GNKM+VVGGESG+GLL+DVQVL 
Sbjct  60   ---------SRTTENWMVLPVGGDKPAPRFNHAAAAIGNKMIVVGGESGNGLLDDVQVLK  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD F+W++V SK+YLSP+SLPL IPA KGH LVSWGKKVLLVGGKTDP SD+VSVWAFDT
Sbjct  111  FDSFTWSTVPSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTDPCSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score =   214 bits (546),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 157/227 (69%), Gaps = 45/227 (20%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQ-LSDTAQGTKSPI--RHPKRFSSS--TGEAVGNSINDSEESSC  519
            MFGFSRRR K GR KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  520  QHSTGASEFNN----------CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvgg  669
             HS    E +N          C+SG SENW++LSI+GDKP PRFNH+AAV+GNK++VVGG
Sbjct  58   GHS---HEIDNEIVSSTDISSCSSGGSENWVLLSISGDKPAPRFNHAAAVIGNKIIVVGG  114

Query  670  esgsglledvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKT  849
            ES +GLL+DVQVLNF+ FSWT+ SSKLYLSP+SLPLKIPACKGHSLVS+GKK LL+GGKT
Sbjct  115  ESSTGLLDDVQVLNFETFSWTTASSKLYLSPSSLPLKIPACKGHSLVSYGKKALLIGGKT  174

Query  850  DPASDKVS------------------------VWAFDTETECWSLME  918
            DP SD++S                        VWAFDTE+ECWSLME
Sbjct  175  DPGSDRISGSIRGLLMYISRCEVALIIFLVFAVWAFDTESECWSLME  221



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score =   214 bits (545),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 157/227 (69%), Gaps = 45/227 (20%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQ-LSDTAQGTKSPI--RHPKRFSSS--TGEAVGNSINDSEESSC  519
            MFGFSRRR K GR KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  520  QHSTGASEFNN----------CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvgg  669
             HS    E +N          C+SG SENW++LSI+GDKP PRFNH+AAV+GNK++VVGG
Sbjct  58   GHS---HEIDNEIVSSTDISSCSSGGSENWVLLSISGDKPAPRFNHAAAVIGNKIIVVGG  114

Query  670  esgsglledvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKT  849
            ES +GLL+DVQVLNF+ FSWT+ SSKLYLSP+SLPLKIPACKGHSLVS+GKK LL+GGKT
Sbjct  115  ESSTGLLDDVQVLNFETFSWTTASSKLYLSPSSLPLKIPACKGHSLVSYGKKALLIGGKT  174

Query  850  DPASDKVS------------------------VWAFDTETECWSLME  918
            DP SD++S                        VWAFDTE+ECWSLME
Sbjct  175  DPGSDRISGSIRGLLMYISRCEVALIIFLVFAVWAFDTESECWSLME  221



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 150/189 (79%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLS++ QG KSP+R  K   +S+ EA   + + S+E   Q S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLSESVQGYKSPLRVTKLADNSSNEAAVAATSYSDEFDFQPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     SG+SENWMVLS+ G KP PRFNH+AA +GNKM+VVGGESGSGLL+DVQVLN
Sbjct  60   ---------SGNSENWMVLSVGGAKPAPRFNHAAAAIGNKMIVVGGESGSGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD  +W++ SSK+YLSP+SLPL IPA KGH LVSWGKKVLLVGGKTDP+SD+VSVWAFDT
Sbjct  111  FDSCTWSTASSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTDPSSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 150/189 (79%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E     S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVDFLPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     S ++ENWMVL + GDKP PRFNH+AA +GNKM+VVGGESG+GLL+DVQVLN
Sbjct  60   ---------SRTTENWMVLPVGGDKPAPRFNHAAAAIGNKMIVVGGESGNGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD F+W++VSSK+YLSP+SLPL IPA KGH LVSWGKKVLLVGGKT P SD+VSVWAFDT
Sbjct  111  FDSFTWSTVSSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTVPCSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 150/189 (79%), Gaps = 11/189 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E     S 
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVDFLPS-  59

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
                     S ++ENWMVL + GDKP PRFNH+AA +GNKM+VVGGESG+GLL+DVQVLN
Sbjct  60   ---------SRTTENWMVLPVGGDKPAPRFNHAAAAIGNKMIVVGGESGNGLLDDVQVLN  110

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
            FD F+W++VSSK+YLSP+SLPL IPA KGH LVSWGKKVLLVGGKT P SD+VSVWAFDT
Sbjct  111  FDSFTWSTVSSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTVPCSDRVSVWAFDT  170

Query  892  ETECWSLME  918
            ++ECWSLM+
Sbjct  171  DSECWSLMD  179



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score =   207 bits (526),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 139/190 (73%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV--GNSINDSEESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE V   +      + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
             G  + + C  GSSENW VL   G KP  RFNH+AAVVG+KMVVVGG+SG GL++D  +L
Sbjct  64   LGTFDLSKCGLGSSENWTVLPTEGHKPASRFNHAAAVVGSKMVVVGGDSGHGLMDDTLIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D  +W + ++K+YLSP+   LKIPACKGHSLVSWGK VLLVGGKTDP SDK+SVW+FD
Sbjct  124  SLDNLTWAAAATKVYLSPSGRSLKIPACKGHSLVSWGKMVLLVGGKTDPVSDKISVWSFD  183

Query  889  TETECWSLME  918
             ETECW  +E
Sbjct  184  VETECWLHIE  193



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score =   207 bits (526),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 139/190 (73%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV--GNSINDSEESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE V   +      + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
             G  + + C  GSSENW VL   G KP  RFNH+AAVVG+KMVVVGG+SG GL++D  +L
Sbjct  64   LGTFDLSKCGLGSSENWTVLPTEGHKPASRFNHAAAVVGSKMVVVGGDSGHGLMDDTLIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D  +W + ++K+YLSP+   LKIPACKGHSLVSWGK VLLVGGKTDP SDK+SVW+FD
Sbjct  124  SLDNLTWAAAATKVYLSPSGRSLKIPACKGHSLVSWGKMVLLVGGKTDPVSDKISVWSFD  183

Query  889  TETECWSLME  918
             ETECW  +E
Sbjct  184  VETECWLHIE  193



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score =   206 bits (525),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 139/190 (73%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV--GNSINDSEESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE V   +      + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
             G  + + C  GSSENW VL   G KP  RFNH+AAVVG+KMVVVGG+SG GL++D  +L
Sbjct  64   LGTFDLSKCGLGSSENWTVLPTEGHKPASRFNHAAAVVGSKMVVVGGDSGHGLMDDTLIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D  +W + ++K+YLSP+   LKIPACKGHSLVSWGK VLLVGGKTDP SDK+SVW+FD
Sbjct  124  SLDNLTWAAAATKVYLSPSGRSLKIPACKGHSLVSWGKMVLLVGGKTDPVSDKISVWSFD  183

Query  889  TETECWSLME  918
             ETECW  +E
Sbjct  184  VETECWLHIE  193



>gb|KEH32273.1| acyl-CoA-binding domain protein [Medicago truncatula]
Length=718

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 147/191 (77%), Gaps = 21/191 (11%)
 Frame = +1

Query  391  RLKVQ-LSDTAQGTKSPI--RHPKRFSSS--TGEAVGNSINDSEESSCQHSTGASEFNN-  552
            R KVQ LSD   GT+SP+  RHPKR  +S   GE   + I D+   S  HS    E +N 
Sbjct  12   RFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSSGHS---HEIDNE  65

Query  553  ---------CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
                     C+SG SENW++LSI+GDKP PRFNH+AAV+GNK++VVGGES +GLL+DVQV
Sbjct  66   IVSSTDISSCSSGGSENWVLLSISGDKPAPRFNHAAAVIGNKIIVVGGESSTGLLDDVQV  125

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            LNF+ FSWT+ SSKLYLSP+SLPLKIPACKGHSLVS+GKK LL+GGKTDP SD++SVWAF
Sbjct  126  LNFETFSWTTASSKLYLSPSSLPLKIPACKGHSLVSYGKKALLIGGKTDPGSDRISVWAF  185

Query  886  DTETECWSLME  918
            DTE+ECWSLME
Sbjct  186  DTESECWSLME  196



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 143/191 (75%), Gaps = 3/191 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV--GNSINDSEESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP R  KR + S GE V   +    S++ +C  S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPSRPTKRVNQSDGENVVSASVSGRSDDINCPCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
             GA + +  + GSS+NWMVL   G KP PRF+H+AAVVG+KMVVVGG+SG GLL+D  +L
Sbjct  64   VGAFDPSKRSLGSSDNWMVLPTEGHKPAPRFHHAAAVVGSKMVVVGGDSGRGLLDDTLIL  123

Query  709  NFDRFSWTS-VSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            + D+ +W + ++ K+ LSP+   LKIPACKGHSLVSWGK VLL+GGKTDP S K+SVW+F
Sbjct  124  SLDKLTWAAALAPKIPLSPSGCSLKIPACKGHSLVSWGKMVLLIGGKTDPVSHKISVWSF  183

Query  886  DTETECWSLME  918
            D ETECW+ +E
Sbjct  184  DVETECWAHIE  194



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score =   197 bits (502),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 139/190 (73%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSST--GEAVGNSINDSEESSCQHS  528
            +FGFSRRR KLGRLKV L+D  QGT+SPIR  KR S S    E + +S   S++ +C  S
Sbjct  4    IFGFSRRRTKLGRLKVHLADPVQGTRSPIRPSKRHSQSNEENEVLPSSSGRSDDHNCHCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + + C+  SSENW VL   G+KP PRF+H+AA+VG+KMVVVGG+S  G+L+D  +L
Sbjct  64   SRTFDLHKCSVDSSENWKVLPTYGNKPTPRFHHAAAIVGSKMVVVGGDSSHGVLDDTLIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D  +W + +S +Y SP  + LKIPAC+GH+LVSWGK  LLVGGKT+P SDK+SVW+F+
Sbjct  124  SLDTLTWATATSNVYSSPGGVSLKIPACRGHALVSWGKSALLVGGKTEPPSDKLSVWSFN  183

Query  889  TETECWSLME  918
             ETECWS +E
Sbjct  184  VETECWSHIE  193



>ref|XP_011627422.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Amborella trichopoda]
Length=721

 Score =   197 bits (501),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 143/195 (73%), Gaps = 7/195 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV---GNSIND--SEESSC  519
            MFGFSRRRMKLGRLKVQL+D+AQG +SPIRHPKR S S GE V   GN + +  S+  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLTDSAQGIRSPIRHPKRHSHSNGEGVVSTGNHLIEARSDAPNS  60

Query  520  QHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledv  699
            Q S+   + ++  SG++ENW+ LS  G KP PR NH+A V+G KM+V+GGE G  LL+DV
Sbjct  61   QSSSIGHDVSDSGSGNTENWIPLSTLGQKPEPRANHAATVIGCKMLVIGGECGGKLLDDV  120

Query  700  QVLNFDRFSWTSV--SSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVS  873
            QVL+F + +W +   +SK+YLS T +  ++P CKGHSLVSWGK V L+GGK DP+ D+VS
Sbjct  121  QVLDFSKLTWAAAKTASKVYLSQTDVMSRVPPCKGHSLVSWGKTVFLIGGKMDPSCDRVS  180

Query  874  VWAFDTETECWSLME  918
            VWAFD + E WS ++
Sbjct  181  VWAFDVDAEYWSHID  195



>ref|XP_006855461.2| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X1 [Amborella trichopoda]
Length=728

 Score =   197 bits (501),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 143/195 (73%), Gaps = 7/195 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV---GNSIND--SEESSC  519
            MFGFSRRRMKLGRLKVQL+D+AQG +SPIRHPKR S S GE V   GN + +  S+  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLTDSAQGIRSPIRHPKRHSHSNGEGVVSTGNHLIEARSDAPNS  60

Query  520  QHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledv  699
            Q S+   + ++  SG++ENW+ LS  G KP PR NH+A V+G KM+V+GGE G  LL+DV
Sbjct  61   QSSSIGHDVSDSGSGNTENWIPLSTLGQKPEPRANHAATVIGCKMLVIGGECGGKLLDDV  120

Query  700  QVLNFDRFSWTSV--SSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVS  873
            QVL+F + +W +   +SK+YLS T +  ++P CKGHSLVSWGK V L+GGK DP+ D+VS
Sbjct  121  QVLDFSKLTWAAAKTASKVYLSQTDVMSRVPPCKGHSLVSWGKTVFLIGGKMDPSCDRVS  180

Query  874  VWAFDTETECWSLME  918
            VWAFD + E WS ++
Sbjct  181  VWAFDVDAEYWSHID  195



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score =   196 bits (499),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 130/198 (66%), Gaps = 44/198 (22%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  504
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  505  EESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsg  684
            +E+ C   + +      +S  S+NW++LSI+GDKPIPRFN                    
Sbjct  59   DENVCSDISSS------SSAGSDNWVLLSISGDKPIPRFN--------------------  92

Query  685  lledvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASD  864
                  VLNFD FSWT+ SSKLYLSP+SLPLKIPACKGHSLVSWG+KVLLVGGKTD  SD
Sbjct  93   ------VLNFDTFSWTTASSKLYLSPSSLPLKIPACKGHSLVSWGEKVLLVGGKTDLGSD  146

Query  865  KVSVWAFDTETECWSLME  918
            K+SVW FDT+TE WSLME
Sbjct  147  KISVWEFDTKTEHWSLME  164



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 140/190 (74%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +GA +  N   GSSENW VL   G KP PRF+H+A+ VG+KMVVVGG+SG GLL+D  +L
Sbjct  64   SGAFDLGNRILGSSENWTVLPTEGLKPAPRFHHAASGVGSKMVVVGGDSGDGLLDDTLIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ +W + + K++LSP    LKIPACKGHSLVSWGK VLL+GGKTDP S ++SVW+FD
Sbjct  124  SLDKLTWAAAAPKVHLSPNGHSLKIPACKGHSLVSWGKMVLLIGGKTDPVSHQISVWSFD  183

Query  889  TETECWSLME  918
             ETECW+ +E
Sbjct  184  VETECWTNIE  193



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 140/190 (74%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +GA +  N   GSSENW VL   G KP PRF+H+A+ VG+KMVVVGG+SG GLL+D  +L
Sbjct  64   SGAFDLGNRILGSSENWTVLPTEGLKPAPRFHHAASGVGSKMVVVGGDSGDGLLDDTLIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ +W + + K++LSP    LKIPACKGHSLVSWGK VLL+GGKTDP S ++SVW+FD
Sbjct  124  SLDKLTWAAAAPKVHLSPNGHSLKIPACKGHSLVSWGKMVLLIGGKTDPVSHQISVWSFD  183

Query  889  TETECWSLME  918
             ETECW+ +E
Sbjct  184  VETECWTNIE  193



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 140/190 (74%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +GA +  N   GSSENW VL   G KP PRF+H+A+ VG+KMVVVGG+SG GLL+D  +L
Sbjct  64   SGAFDLGNRILGSSENWTVLPTEGLKPAPRFHHAASGVGSKMVVVGGDSGDGLLDDTLIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ +W + + K++LSP    LKIPACKGHSLVSWGK VLL+GGKTDP S ++SVW+FD
Sbjct  124  SLDKLTWAAAAPKVHLSPNGHSLKIPACKGHSLVSWGKMVLLIGGKTDPVSHQISVWSFD  183

Query  889  TETECWSLME  918
             ETECW+ +E
Sbjct  184  VETECWTNIE  193



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 136/190 (72%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE--AVGNSINDSEESSCQHS  528
            +FGFSRRR K+GRLKV L D  QGT+SPIR   + S +  E   + +S   S++ +C  S
Sbjct  4    IFGFSRRRKKIGRLKVHLKDPLQGTRSPIRSSNQLSQTNEENGGLASSSGRSDDPNCHFS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + +NC+  SS+NW +L   G+KP PRF H+A VVG+KMVVVGG+S   LL+D Q+L
Sbjct  64   SHTCDLHNCSLESSKNWNLLPTYGNKPTPRFQHAATVVGSKMVVVGGDSSHDLLDDTQIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D  +W S +SK+Y S  ++ L IPACKGH+LVSWGK  LL+GGKT+P SDK+SVW+FD
Sbjct  124  SLDSLTWASATSKVYSSTGTISLNIPACKGHTLVSWGKSALLIGGKTEPLSDKLSVWSFD  183

Query  889  TETECWSLME  918
             ETECWS +E
Sbjct  184  VETECWSHIE  193



>ref|XP_009402528.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=553

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 136/190 (72%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE--AVGNSINDSEESSCQHS  528
            +FGFSRRR K+GRLKV L D  QGT+SPIR   + S +  E   + +S   S++ +C  S
Sbjct  4    IFGFSRRRKKIGRLKVHLKDPLQGTRSPIRSSNQLSQTNEENGGLASSSGRSDDPNCHFS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + +NC+  SS+NW +L   G+KP PRF H+A VVG+KMVVVGG+S   LL+D Q+L
Sbjct  64   SHTCDLHNCSLESSKNWNLLPTYGNKPTPRFQHAATVVGSKMVVVGGDSSHDLLDDTQIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D  +W S +SK+Y S  ++ L IPACKGH+LVSWGK  LL+GGKT+P SDK+SVW+FD
Sbjct  124  SLDSLTWASATSKVYSSTGTISLNIPACKGHTLVSWGKSALLIGGKTEPLSDKLSVWSFD  183

Query  889  TETECWSLME  918
             ETECWS +E
Sbjct  184  VETECWSHIE  193



>gb|KJB72601.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=665

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            +SG+SENWMVLS+AG+ P PRFNH+A VVGNKM+VVGGES +GLL+DVQVLNFD FSWT 
Sbjct  22   SSGNSENWMVLSVAGETPEPRFNHAATVVGNKMIVVGGESANGLLDDVQVLNFDTFSWTM  81

Query  736  VSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLM  915
             SSKLYLSP++LPLKIP+CKGHSLVSWGKK LLVGG+TDPA+DKVSVW+FDTETECWS+M
Sbjct  82   ASSKLYLSPSNLPLKIPSCKGHSLVSWGKKALLVGGRTDPANDKVSVWSFDTETECWSVM  141

Query  916  E  918
            E
Sbjct  142  E  142



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score =   183 bits (465),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 116/190 (61%), Gaps = 28/190 (15%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV--GNSINDSEESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE V   +      + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
             G  + + C  GSSENW VL   G KP  RFN                          +L
Sbjct  64   LGTFDLSKCGLGSSENWTVLPTEGHKPASRFN--------------------------IL  97

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D  +W + ++K+YLSP+   LKIPACKGHSLVSWGK VLLVGGKTDP SDK+SVW+FD
Sbjct  98   SLDNLTWAAAATKVYLSPSGRSLKIPACKGHSLVSWGKMVLLVGGKTDPVSDKISVWSFD  157

Query  889  TETECWSLME  918
             ETECW  +E
Sbjct  158  VETECWLHIE  167



>gb|KJB38636.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=632

 Score =   180 bits (456),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  580  MVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYLS  759
            MVLS+AG+KP+PRFNH+AAVVGN+M+VVGGESG+GLL+DVQVLNFD FSWTS SSKLYLS
Sbjct  1    MVLSVAGEKPVPRFNHAAAVVGNRMIVVGGESGNGLLDDVQVLNFDNFSWTSASSKLYLS  60

Query  760  PTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            P+S PLKIP+CKGH LVSWGKK LLVGG+TDP +D+VSVWAFDTETECWS+ME
Sbjct  61   PSSFPLKIPSCKGHCLVSWGKKALLVGGRTDPGNDRVSVWAFDTETECWSVME  113



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 135/190 (71%), Gaps = 8/190 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +GA +  N   GSSENW VL   G KP PRF+H+A+ VG+KMVVVGG+SG GLL+D  +L
Sbjct  64   SGAFDLGNRILGSSENWTVLPTEGLKPAPRFHHAASGVGSKMVVVGGDSGDGLLDDTLIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ +W + + K++LSP    LKIPACKGHSLVSWGK VLL+GGKTDP S ++S     
Sbjct  124  SLDKLTWAAAAPKVHLSPNGHSLKIPACKGHSLVSWGKMVLLIGGKTDPVSHQIS-----  178

Query  889  TETECWSLME  918
             ETECW+ +E
Sbjct  179  -ETECWTNIE  187



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 130/190 (68%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIN-DSEESSCQHS  528
            MFGFSRRRMKLGRLK  L D   G++SP R  KRFS   GE  V  S++  +++ + + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPSRQTKRFSHPNGEDPVTTSVSGRADDLAWRCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + N     SSENW VLS  GDKP PRF+H+AA+VG+KMVV GG+SG  LL+D ++L
Sbjct  64   SDTFDLNGRAFESSENWAVLSTEGDKPTPRFDHAAAMVGSKMVVFGGDSGHRLLDDTKIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ SW SVS K+  S      K+  CKGH LV WGK V+LVGGK+DP  DK+SVW F+
Sbjct  124  SLDKLSWDSVSPKVRPSSNGRCPKLRPCKGHCLVPWGKNVILVGGKSDPPYDKISVWTFN  183

Query  889  TETECWSLME  918
            TETE WS ME
Sbjct  184  TETELWSHME  193



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 132/190 (69%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEA-VGNSIN-DSEESSCQHS  528
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE  V  S++  ++E++ + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARLTKRSSYPNGEEPVATSVSGRADENAWRCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + +     +SENW VLS  GDKP PR++H+AA+VG+KM+V GG+SG  LL+D  +L
Sbjct  64   SDTFDLSGRAFENSENWAVLSTEGDKPSPRYDHAAAMVGSKMIVFGGDSGHHLLDDTMIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ +W SV+ K+ +SP     K   CKGH LV WGK V+LVGGK++P+SD++SVW F+
Sbjct  124  SLDKLTWDSVAPKVRVSPGRRSQKFRPCKGHCLVPWGKNVILVGGKSEPSSDRISVWTFN  183

Query  889  TETECWSLME  918
            TETE WS ME
Sbjct  184  TETEIWSHME  193



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 132/190 (69%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEA-VGNSIN-DSEESSCQHS  528
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE  V  S++  ++E++ + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARLTKRSSYPNGEEPVATSVSGRADENAWRCS  63

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + +     +SENW VLS  GDKP PR++H+AA+VG+KM+V GG+SG  LL+D  +L
Sbjct  64   SDTFDLSGRAFENSENWAVLSTEGDKPSPRYDHAAAMVGSKMIVFGGDSGHHLLDDTMIL  123

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ +W SV+ K+ +SP     K   CKGH LV WGK V+LVGGK++P+SD++SVW F+
Sbjct  124  SLDKLTWDSVAPKVRVSPGRRSQKFRPCKGHCLVPWGKNVILVGGKSEPSSDRISVWTFN  183

Query  889  TETECWSLME  918
            TETE WS ME
Sbjct  184  TETEIWSHME  193



>gb|EEE52499.1| hypothetical protein OsJ_34700 [Oryza sativa Japonica Group]
Length=685

 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 133/190 (70%), Gaps = 3/190 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE  V  S++  +++ + + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPAR-TKRSSHPNGEDQVTTSVSGRADDLAWRCS  62

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + N     +SENW VLS  GDKPIPRF+H+AA+VG+KMVV GG+SG  LL+D ++L
Sbjct  63   SDTFDLNGRAFENSENWAVLSTEGDKPIPRFDHAAAMVGSKMVVFGGDSGHHLLDDTKIL  122

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ +W SV+ K+ +S      K   CKGHSLV WGK V+LVGGKTDP SD++SVW+F+
Sbjct  123  SLDKLTWDSVAPKIRVSQGGHAPKFRPCKGHSLVPWGKNVILVGGKTDPPSDRISVWSFN  182

Query  889  TETECWSLME  918
            TET+ WS +E
Sbjct  183  TETDLWSYIE  192



>gb|ABA95166.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score =   169 bits (427),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 130/195 (67%), Gaps = 7/195 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIR-----HPK--RFSSSTGEAVGNSINDSEES  513
            MFGFSRRRMKLGRLK  L D   G++SP R     HP   RF     +   +    +++ 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARTKRSSHPNFSRFVQGEDQVTTSVSGRADDL  63

Query  514  SCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglle  693
            + + S+   + N     +SENW VLS  GDKPIPRF+H+AA+VG+KMVV GG+SG  LL+
Sbjct  64   AWRCSSDTFDLNGRAFENSENWAVLSTEGDKPIPRFDHAAAMVGSKMVVFGGDSGHHLLD  123

Query  694  dvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVS  873
            D ++L+ D+ +W SV+ K+ +S      K   CKGHSLV WGK V+LVGGKTDP SD++S
Sbjct  124  DTKILSLDKLTWDSVAPKIRVSQGGHAPKFRPCKGHSLVPWGKNVILVGGKTDPPSDRIS  183

Query  874  VWAFDTETECWSLME  918
            VW+F+TET+ WS +E
Sbjct  184  VWSFNTETDLWSYIE  198



>gb|EEC68565.1| hypothetical protein OsI_36893 [Oryza sativa Indica Group]
Length=685

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 133/190 (70%), Gaps = 3/190 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE  V  S++  +++ + + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPAR-TKRSSHPNGEDQVTTSVSGRADDLAWRCS  62

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + N     +SENW VLS  GDKPIPRF+H+AA+VG+KMVV GG+SG  LL+D ++L
Sbjct  63   SDTFDLNGRAFENSENWAVLSTEGDKPIPRFDHAAAMVGSKMVVFGGDSGHHLLDDTKIL  122

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ +W S++ K+ +S      K   CKGHSLV WGK V+LVGGKTDP SD++SVW+F+
Sbjct  123  SLDKLTWDSMAPKIRVSQGGHAPKFRPCKGHSLVPWGKNVILVGGKTDPPSDRISVWSFN  182

Query  889  TETECWSLME  918
            TET+ WS +E
Sbjct  183  TETDLWSYIE  192



>dbj|BAK00700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 133/190 (70%), Gaps = 3/190 (2%)
 Frame = +1

Query  352  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSIND-SEESSCQHS  528
            NMFGFSRRRMKLGR K   SD   G++SP  H     S+ G+ +  S++  +++ + + S
Sbjct  4    NMFGFSRRRMKLGRSKGNKSDPLHGSRSPGGHLSL--SNGGDPITASVSGRADDLAYRCS  61

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            + + + +     SSENW VLS  GDKP PRF+H+AA+VG+KMVV GG+SG  LL+D ++L
Sbjct  62   SDSFDLDARALDSSENWAVLSTEGDKPAPRFSHAAAIVGSKMVVFGGDSGQHLLDDTKIL  121

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            N ++ +W S + K+  SP     K+PACKGH +VSWG  V+LVGG+++PA+D +SVW F+
Sbjct  122  NLEKLTWDSTTPKVLPSPIRSTFKLPACKGHCMVSWGNSVILVGGRSEPATDCLSVWVFN  181

Query  889  TETECWSLME  918
            TETE WSLME
Sbjct  182  TETEIWSLME  191



>dbj|BAJ86800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 133/190 (70%), Gaps = 3/190 (2%)
 Frame = +1

Query  352  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSIND-SEESSCQHS  528
            NMFGFSRRRMKLGR K   SD   G++SP  H     S+ G+ +  S++  +++ + + S
Sbjct  4    NMFGFSRRRMKLGRSKGNKSDPLHGSRSPGGHLSL--SNGGDPITASVSGRADDLAYRCS  61

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            + + + +     SSENW VLS  GDKP PRF+H+AA+VG+KMVV GG+SG  LL+D ++L
Sbjct  62   SDSFDLDARALDSSENWAVLSTEGDKPAPRFSHAAAIVGSKMVVFGGDSGQHLLDDTKIL  121

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            N ++ +W S + K+  SP     K+PACKGH +VSWG  V+LVGG+++PA+D +SVW F+
Sbjct  122  NLEKLTWDSTTPKVLPSPIRSTFKLPACKGHCMVSWGNSVILVGGRSEPATDCLSVWVFN  181

Query  889  TETECWSLME  918
            TETE WSLME
Sbjct  182  TETEIWSLME  191



>gb|AFW56515.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=202

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 127/190 (67%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIN-DSEESSCQHS  528
            MFGFSRRR+KLGR K   SD    ++S +   K  S   G +A   S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRSKGDPSDPLNSSRSSVGPSKHLSLPNGNDATMTSVSGHADDLSYRCS  60

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   +    T   SENW VLS  GDKPIPRF H+AA+V +KMVV GG+SG+ LL+D ++L
Sbjct  61   SDTFDPQGRTFDISENWTVLSTEGDKPIPRFYHAAAIVSSKMVVFGGDSGNRLLDDTKIL  120

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            N ++ +W S   K+  SP    +K+PACKGH LV WG  V+LVGGKT+PASD +SVW F+
Sbjct  121  NLEKLTWDSAPPKVCPSPNGCSMKLPACKGHCLVPWGNSVILVGGKTEPASDHLSVWTFN  180

Query  889  TETECWSLME  918
            TETE WSL+E
Sbjct  181  TETELWSLIE  190



>ref|XP_003575710.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237192.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237193.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
Length=693

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 131/190 (69%), Gaps = 3/190 (2%)
 Frame = +1

Query  352  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSIND-SEESSCQHS  528
            NMFGFSRRR+KLGR K   SD   G+++P RH     ++ G+ +  S++  +++ +   S
Sbjct  3    NMFGFSRRRIKLGRSKGHQSDPLHGSRTPGRHLSL--TNGGDPITTSVSGRADDLAYLCS  60

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            + + + +     SSENW VLS  GDKP PRF H+AA+VG+KMVV GG+SG G L+D ++L
Sbjct  61   SDSFDLDARALDSSENWAVLSTEGDKPNPRFAHAAAIVGSKMVVFGGDSGHGFLDDTKIL  120

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            N ++  W S + K+  SP+   LK+PACKGH LV W   V+LVGGKT+PASD++SVW F+
Sbjct  121  NLEKLQWDSAAPKVRPSPSGRSLKLPACKGHCLVPWRNSVILVGGKTEPASDRLSVWTFN  180

Query  889  TETECWSLME  918
             ETE WSLME
Sbjct  181  METEIWSLME  190



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 151/264 (57%), Gaps = 84/264 (32%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  504
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  505  EESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsg  684
            +E+ C   + +      +S  S+NW++LSI+GDKPIPRFNH+AAV+GNK++VVGGES +G
Sbjct  59   DENVCSDISSS------SSAGSDNWVLLSISGDKPIPRFNHAAAVIGNKIIVVGGESATG  112

Query  685  lledvQVLNFDRFS------------------------WTSVS---------SKLYLSPT  765
            LL+DVQV  ++ FS                        ++SV+         S L+LS T
Sbjct  113  LLDDVQVWYYNSFSQIIYQCRCVSPVSVSKYVFHSCKQYSSVTIISPSTLTLSILFLSKT  172

Query  766  SL---------------------------------PLKIPACKGHSLVSWGKKVLLVGGK  846
             +                                 PLKIPACKGHSLVSWG+KVLLVGGK
Sbjct  173  VMCFGAFPFYSQVLNFDTFSWTTASSKLYLSPSSLPLKIPACKGHSLVSWGEKVLLVGGK  232

Query  847  TDPASDKVSVWAFDTETECWSLME  918
            TD  SDK+SVW FDT+TE WSLME
Sbjct  233  TDLGSDKISVWEFDTKTEHWSLME  256



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915, partial [Sorghum bicolor]
Length=649

 Score =   163 bits (413),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 130/196 (66%), Gaps = 8/196 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSST------GE-AVGNSINDS-EE  510
            MFGFSRRRMKLGRLK  L D    ++SP R  KRFS         GE  +  S++   ++
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHASRSPSRTTKRFSHPNVCRFVQGEDPLTTSVSGRPDD  63

Query  511  SSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsgll  690
             S + S+   + N     SSENW VLS  GDKP+PRF+H+AA+VG+KMVV GG+SG  LL
Sbjct  64   HSWRCSSDTFDINGRAFESSENWAVLSTEGDKPVPRFDHAAAMVGSKMVVFGGDSGQCLL  123

Query  691  edvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKV  870
            +D ++L+ D+ +W SV+ K+  S     LK+  CKGH LV WGK V+LVGGK+D  SDK+
Sbjct  124  DDTKILSLDKLTWDSVAPKVRPSSNGRSLKLRPCKGHCLVPWGKNVILVGGKSDQPSDKI  183

Query  871  SVWAFDTETECWSLME  918
            SVW F+TE+E WS ME
Sbjct  184  SVWTFNTESELWSHME  199



>ref|XP_006663088.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Oryza brachyantha]
Length=684

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 130/190 (68%), Gaps = 3/190 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE  V  S++  +++ + + S
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPAR-TKRPSYPNGEDQVTTSVSGRADDLAWRCS  62

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + N     +SENW VLS  GDKPIPRF+H+AA+VG+KMVV GG+SG  LL+D ++L
Sbjct  63   SDTFDLNGRAFENSENWAVLSTDGDKPIPRFDHAAAMVGSKMVVFGGDSGHHLLDDTKIL  122

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            + D+ +W SV+ K+ +S      K   CKGH LV WGK V+LVGGKTDP SD++SVW F+
Sbjct  123  SLDKLTWDSVAPKIRVSQGGHAPKFRPCKGHCLVPWGKSVILVGGKTDPPSDRISVWTFN  182

Query  889  TETECWSLME  918
            T+ + WS +E
Sbjct  183  TDNDLWSYIE  192



>ref|XP_006663087.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Oryza brachyantha]
Length=690

 Score =   160 bits (406),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 126/195 (65%), Gaps = 7/195 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPK-------RFSSSTGEAVGNSINDSEES  513
            MFGFSRRRMKLGRLK  L D   G++SP R  +       RF     +   +    +++ 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARTKRPSYPNFSRFVQGEDQVTTSVSGRADDL  63

Query  514  SCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglle  693
            + + S+   + N     +SENW VLS  GDKPIPRF+H+AA+VG+KMVV GG+SG  LL+
Sbjct  64   AWRCSSDTFDLNGRAFENSENWAVLSTDGDKPIPRFDHAAAMVGSKMVVFGGDSGHHLLD  123

Query  694  dvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVS  873
            D ++L+ D+ +W SV+ K+ +S      K   CKGH LV WGK V+LVGGKTDP SD++S
Sbjct  124  DTKILSLDKLTWDSVAPKIRVSQGGHAPKFRPCKGHCLVPWGKSVILVGGKTDPPSDRIS  183

Query  874  VWAFDTETECWSLME  918
            VW F+T+ + WS +E
Sbjct  184  VWTFNTDNDLWSYIE  198



>gb|AFW60226.1| hypothetical protein ZEAMMB73_572222 [Zea mays]
Length=695

 Score =   160 bits (406),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 129/191 (68%), Gaps = 3/191 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSS--STGEAVGNSIN-DSEESSCQH  525
            MFGFSRRRMKLGRLK  L D   G +SP R  KR SS  +  + +  S++  +++ + + 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLAWRC  63

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
            S+   + N     SSENW VLS  GDKP PRF+H+AA+VG+KMVV GG+SG  LL+D ++
Sbjct  64   SSDTFDLNGRDFESSENWAVLSTEGDKPAPRFDHAAAMVGSKMVVFGGDSGQSLLDDTKI  123

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            L+ D+ +W SV+ K+        LK+  C+GH LVSWGK V+LVGGK+D   DK+SVW F
Sbjct  124  LSLDKLTWDSVAPKVRPPLNGRSLKLRPCRGHCLVSWGKNVILVGGKSDQPYDKISVWTF  183

Query  886  DTETECWSLME  918
            +TE+E WS ME
Sbjct  184  NTESELWSHME  194



>ref|XP_008677101.1| PREDICTED: uncharacterized protein LOC100279529 isoform X1 [Zea 
mays]
Length=695

 Score =   160 bits (405),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 129/191 (68%), Gaps = 3/191 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSS--STGEAVGNSIN-DSEESSCQH  525
            MFGFSRRRMKLGRLK  L D   G +SP R  KR SS  +  + +  S++  +++ + + 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLAWRC  63

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
            S+   + N     SSENW VLS  GDKP PRF+H+AA+VG+KMVV GG+SG  LL+D ++
Sbjct  64   SSDTFDLNGRDFESSENWAVLSTEGDKPAPRFDHAAAMVGSKMVVFGGDSGQSLLDDTKI  123

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            L+ D+ +W SV+ K+        LK+  C+GH LVSWGK V+LVGGK+D   DK+SVW F
Sbjct  124  LSLDKLTWDSVAPKVRPPLNGRSLKLRPCRGHCLVSWGKNVILVGGKSDQPYDKISVWTF  183

Query  886  DTETECWSLME  918
            +TE+E WS ME
Sbjct  184  NTESELWSHME  194



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score =   161 bits (407),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 149/264 (56%), Gaps = 84/264 (32%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  504
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  505  EESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsg  684
            +E+ C   + +      +S  S+NW++LSI+GDKPIPRFNH+AAV+GNK++VVGGES +G
Sbjct  59   DENVCSDISSS------SSAGSDNWVLLSISGDKPIPRFNHAAAVIGNKIIVVGGESATG  112

Query  685  lledvQVLNFDRFSW----------TSVSSKLY-----------LSPTSLPL--------  777
            LL+DVQV  ++ FS            SVS  ++           +SP++L L        
Sbjct  113  LLDDVQVWYYNSFSQIIYQCRCVSPVSVSKYVFHSCKQYSSVTIISPSTLTLSILFLSKT  172

Query  778  -------------------------------------KIPACKGHSLVSWGKKVLLVGGK  846
                                                 KIPACKGHSLVSWG+KVLLVGGK
Sbjct  173  VMCFGAFPFYSQVLNFDTFSWTTASSKLYLSPSSLPLKIPACKGHSLVSWGEKVLLVGGK  232

Query  847  TDPASDKVSVWAFDTETECWSLME  918
            TD  SDK+SVW FDT+TE WSLME
Sbjct  233  TDLGSDKISVWEFDTKTEHWSLME  256



>gb|AFW60227.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_572222 [Zea 
mays]
Length=716

 Score =   160 bits (405),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 129/191 (68%), Gaps = 3/191 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSS--STGEAVGNSIN-DSEESSCQH  525
            MFGFSRRRMKLGRLK  L D   G +SP R  KR SS  +  + +  S++  +++ + + 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLAWRC  63

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
            S+   + N     SSENW VLS  GDKP PRF+H+AA+VG+KMVV GG+SG  LL+D ++
Sbjct  64   SSDTFDLNGRDFESSENWAVLSTEGDKPAPRFDHAAAMVGSKMVVFGGDSGQSLLDDTKI  123

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            L+ D+ +W SV+ K+        LK+  C+GH LVSWGK V+LVGGK+D   DK+SVW F
Sbjct  124  LSLDKLTWDSVAPKVRPPLNGRSLKLRPCRGHCLVSWGKNVILVGGKSDQPYDKISVWTF  183

Query  886  DTETECWSLME  918
            +TE+E WS ME
Sbjct  184  NTESELWSHME  194



>ref|NP_001145999.1| uncharacterized protein LOC100279529 [Zea mays]
 gb|ACL53010.1| unknown [Zea mays]
Length=717

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 129/191 (68%), Gaps = 3/191 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSS--STGEAVGNSIN-DSEESSCQH  525
            MFGFSRRRMKLGRLK  L D   G +SP R  KR SS  +  + +  S++  +++ + + 
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLAWRC  63

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
            S+   + N     SSENW VLS  GDKP PRF+H+AA+VG+KMVV GG+SG  LL+D ++
Sbjct  64   SSDTFDLNGRDFESSENWAVLSTEGDKPAPRFDHAAAMVGSKMVVFGGDSGQSLLDDTKI  123

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            L+ D+ +W SV+ K+        LK+  C+GH LVSWGK V+LVGGK+D   DK+SVW F
Sbjct  124  LSLDKLTWDSVAPKVRPPLNGRSLKLRPCRGHCLVSWGKNVILVGGKSDQPYDKISVWTF  183

Query  886  DTETECWSLME  918
            +TE+E WS ME
Sbjct  184  NTESELWSHME  194



>gb|AFW56518.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=442

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 127/190 (67%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIN-DSEESSCQHS  528
            MFGFSRRR+KLGR K   SD    ++S +   K  S   G +A   S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRSKGDPSDPLNSSRSSVGPSKHLSLPNGNDATMTSVSGHADDLSYRCS  60

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   +    T   SENW VLS  GDKPIPRF H+AA+V +KMVV GG+SG+ LL+D ++L
Sbjct  61   SDTFDPQGRTFDISENWTVLSTEGDKPIPRFYHAAAIVSSKMVVFGGDSGNRLLDDTKIL  120

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            N ++ +W S   K+  SP    +K+PACKGH LV WG  V+LVGGKT+PASD +SVW F+
Sbjct  121  NLEKLTWDSAPPKVCPSPNGCSMKLPACKGHCLVPWGNSVILVGGKTEPASDHLSVWTFN  180

Query  889  TETECWSLME  918
            TETE WSL+E
Sbjct  181  TETELWSLIE  190



>ref|NP_001146281.1| uncharacterized protein LOC100279856 [Zea mays]
 gb|ACL53624.1| unknown [Zea mays]
 gb|ACN34064.1| unknown [Zea mays]
 gb|AFW56517.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=690

 Score =   157 bits (398),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 127/190 (67%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIN-DSEESSCQHS  528
            MFGFSRRR+KLGR K   SD    ++S +   K  S   G +A   S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRSKGDPSDPLNSSRSSVGPSKHLSLPNGNDATMTSVSGHADDLSYRCS  60

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   +    T   SENW VLS  GDKPIPRF H+AA+V +KMVV GG+SG+ LL+D ++L
Sbjct  61   SDTFDPQGRTFDISENWTVLSTEGDKPIPRFYHAAAIVSSKMVVFGGDSGNRLLDDTKIL  120

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            N ++ +W S   K+  SP    +K+PACKGH LV WG  V+LVGGKT+PASD +SVW F+
Sbjct  121  NLEKLTWDSAPPKVCPSPNGCSMKLPACKGHCLVPWGNSVILVGGKTEPASDHLSVWTFN  180

Query  889  TETECWSLME  918
            TETE WSL+E
Sbjct  181  TETELWSLIE  190



>gb|AFW56516.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=566

 Score =   157 bits (396),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 127/190 (67%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTG-EAVGNSIN-DSEESSCQHS  528
            MFGFSRRR+KLGR K   SD    ++S +   K  S   G +A   S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRSKGDPSDPLNSSRSSVGPSKHLSLPNGNDATMTSVSGHADDLSYRCS  60

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   +    T   SENW VLS  GDKPIPRF H+AA+V +KMVV GG+SG+ LL+D ++L
Sbjct  61   SDTFDPQGRTFDISENWTVLSTEGDKPIPRFYHAAAIVSSKMVVFGGDSGNRLLDDTKIL  120

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            N ++ +W S   K+  SP    +K+PACKGH LV WG  V+LVGGKT+PASD +SVW F+
Sbjct  121  NLEKLTWDSAPPKVCPSPNGCSMKLPACKGHCLVPWGNSVILVGGKTEPASDHLSVWTFN  180

Query  889  TETECWSLME  918
            TETE WSL+E
Sbjct  181  TETELWSLIE  190



>gb|EEE53353.1| hypothetical protein OsJ_36377 [Oryza sativa Japonica Group]
Length=549

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 127/191 (66%), Gaps = 2/191 (1%)
 Frame = +1

Query  352  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSINDS-EESSCQH  525
            NMFGFSR RM++GR K   +D    +KSP    K  S   G+  +  S++   ++ + + 
Sbjct  3    NMFGFSRSRMRIGRSKGHSTDPLDSSKSPSGLVKHLSLPNGDDQITTSVSGRVDDLAFRC  62

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
            S+   + ++    SS NW VLS  G +P PRF H+AA+VG+KMVV GG+SG  LL+D ++
Sbjct  63   SSDTYDLDDRALVSSRNWAVLSTEGSRPSPRFAHAAALVGSKMVVFGGDSGDQLLDDTKI  122

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            LN ++ +W SV+ K+  SP   P K+PACKGH LV WG  V+LVGGKT+PASD+++VW F
Sbjct  123  LNLEKLTWDSVAPKVRPSPNRRPSKLPACKGHCLVQWGNSVILVGGKTEPASDRLAVWTF  182

Query  886  DTETECWSLME  918
            + ETE WSLME
Sbjct  183  NMETEVWSLME  193



>ref|NP_001066944.1| Os12g0538800 [Oryza sativa Japonica Group]
 gb|ABA99338.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29963.1| Os12g0538800 [Oryza sativa Japonica Group]
Length=698

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 126/194 (65%), Gaps = 8/194 (4%)
 Frame = +1

Query  352  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-----AVGNSINDSEESS  516
            NMFGFSR RM++GR K   +D    +KSP    K  S   G+     +V   ++D    +
Sbjct  3    NMFGFSRSRMRIGRSKGHSTDPLDSSKSPSGLVKHLSLPNGDDQITTSVSGRVDDL---A  59

Query  517  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglled  696
             + S+   + ++    SS NW VLS  G +P PRF H+AA+VG+KMVV GG+SG  LL+D
Sbjct  60   FRCSSDTYDLDDRALVSSRNWAVLSTEGSRPSPRFAHAAALVGSKMVVFGGDSGDQLLDD  119

Query  697  vQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSV  876
             ++LN ++ +W SV+ K+  SP   P K+PACKGH LV WG  V+LVGGKT+PASD+++V
Sbjct  120  TKILNLEKLTWDSVAPKVRPSPNRRPSKLPACKGHCLVQWGNSVILVGGKTEPASDRLAV  179

Query  877  WAFDTETECWSLME  918
            W F+ ETE WSLME
Sbjct  180  WTFNMETEVWSLME  193



>gb|EEC69433.1| hypothetical protein OsI_38606 [Oryza sativa Indica Group]
Length=698

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 126/194 (65%), Gaps = 8/194 (4%)
 Frame = +1

Query  352  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-----AVGNSINDSEESS  516
            NMFGFSR RM++GR K   +D    +KSP    K  S   G+     +V   ++D    +
Sbjct  3    NMFGFSRSRMRIGRSKGHSTDPLDSSKSPSGLVKHLSLPNGDDQITTSVSGRVDDL---A  59

Query  517  CQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglled  696
             + S+   + ++    SS NW VLS  G +P PRF H+AA+VG+KMVV GG+SG  LL+D
Sbjct  60   FRCSSDTYDLDDRALVSSRNWAVLSTEGSRPSPRFAHAAALVGSKMVVFGGDSGDQLLDD  119

Query  697  vQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSV  876
             ++LN ++ +W SV+ K+  SP   P K+PACKGH LV WG  V+LVGGKT+PASD+++V
Sbjct  120  TKILNLEKLTWDSVAPKVRPSPNRRPSKLPACKGHCLVQWGNSVILVGGKTEPASDRLAV  179

Query  877  WAFDTETECWSLME  918
            W F+ ETE WSLME
Sbjct  180  WTFNMETEVWSLME  193



>ref|XP_004962833.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Setaria italica]
 ref|XP_004962834.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Setaria italica]
 ref|XP_004962835.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X3 [Setaria italica]
 ref|XP_004962836.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X4 [Setaria italica]
Length=695

 Score =   154 bits (390),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRR+KLGRLK   SD    ++S     K+ S   G+ AV  S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRLKGDQSDPLNSSRSTTGPAKQLSLPNGDDAVTTSVSGRADDLSYRCS  60

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + +  +   SENW VLS  G+KPIPRF H+AA+V +KMVV GG+SG  LL+D ++L
Sbjct  61   SDTFDLDGRSFNISENWTVLSTEGEKPIPRFYHAAAIVSSKMVVFGGDSGHHLLDDTKIL  120

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            N ++  W     K+  SP     K+PACKGH LV WG  V+LVGGKT+PASD++SVW F+
Sbjct  121  NLEKLIWDPAPPKVRPSPNGHSAKLPACKGHCLVPWGNSVILVGGKTEPASDRLSVWIFN  180

Query  889  TETECWSLME  918
            TETE WS +E
Sbjct  181  TETELWSHVE  190



>ref|XP_004962837.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X5 [Setaria italica]
Length=688

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 2/190 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRR+KLGRLK   SD    ++S     K+ S   G+ AV  S++  +++ S + S
Sbjct  1    MFGFSRRRVKLGRLKGDQSDPLNSSRSTTGPAKQLSLPNGDDAVTTSVSGRADDLSYRCS  60

Query  529  TGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVL  708
            +   + +  +   SENW VLS  G+KPIPRF H+AA+V +KMVV GG+SG  LL+D ++L
Sbjct  61   SDTFDLDGRSFNISENWTVLSTEGEKPIPRFYHAAAIVSSKMVVFGGDSGHHLLDDTKIL  120

Query  709  NFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFD  888
            N ++  W     K+  SP     K+PACKGH LV WG  V+LVGGKT+PASD++SVW F+
Sbjct  121  NLEKLIWDPAPPKVRPSPNGHSAKLPACKGHCLVPWGNSVILVGGKTEPASDRLSVWIFN  180

Query  889  TETECWSLME  918
            TETE WS +E
Sbjct  181  TETELWSHVE  190



>ref|XP_006664610.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Oryza brachyantha]
Length=698

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 127/191 (66%), Gaps = 2/191 (1%)
 Frame = +1

Query  352  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIN-DSEESSCQH  525
            NMFGFSR RMK+GR K   +D    +KSP    K  S   G+  +  S++  +++ + + 
Sbjct  3    NMFGFSRSRMKIGRSKGHSTDPLDSSKSPSGLVKHLSLPNGDDQITTSVSGRADDLAFRC  62

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQV  705
            S+   + ++    SS NW VLS  G +P PRF H+AA++G+KMVV GG++G  LL+D ++
Sbjct  63   SSDTYDLDDRALVSSRNWAVLSTEGSRPSPRFAHAAAILGSKMVVFGGDAGHQLLDDTKI  122

Query  706  LNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAF  885
            LN ++ +W SV+ K+  SP    +K+PACKGH LV WG  V+LVGGKT+P SD+++VW F
Sbjct  123  LNLEKLTWDSVTPKVRPSPNRPSMKLPACKGHCLVPWGNSVILVGGKTEPTSDRLAVWNF  182

Query  886  DTETECWSLME  918
            + ETE WSLME
Sbjct  183  NMETEVWSLME  193



>ref|XP_011012826.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=616

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVL FD+F+WTS+SSKLYLSP+SLPLKIPAC+GH LVSWGKK LL+GGKTDPASD++SVW
Sbjct  17   QVLKFDQFTWTSISSKLYLSPSSLPLKIPACRGHCLVSWGKKALLIGGKTDPASDRISVW  76

Query  880  AFDTETECWSLME  918
            AFDTETECWSL+E
Sbjct  77   AFDTETECWSLVE  89



>gb|KDO75110.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
Length=252

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVLNFDRFSWT+ SSKLYLSP+SLPLKIPAC+GHSL+SWGKKVLLVGGKTD  SD+VSVW
Sbjct  17   QVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVW  76

Query  880  AFDTETECWSLME  918
             FDTETECWS++E
Sbjct  77   TFDTETECWSVVE  89



>ref|XP_004486044.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=610

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  700  QVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVW  879
            QVLNFD FSWT+ SSKLYLSP+SLPL+IPACKGH LVSWGKK LL+GGKTD  SDK+SVW
Sbjct  17   QVLNFDTFSWTTASSKLYLSPSSLPLQIPACKGHCLVSWGKKALLIGGKTDLGSDKISVW  76

Query  880  AFDTETECWSLME  918
            AFDTETECW+LME
Sbjct  77   AFDTETECWALME  89



>gb|EMT25879.1| hypothetical protein F775_10881 [Aegilops tauschii]
Length=758

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 126/189 (67%), Gaps = 3/189 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSIND-SEESSCQHST  531
            ++  +   + L R K   SD   G++SP  H     S+ G+ +  S++  +++ + + S+
Sbjct  92   VYATAMHLLLLRRSKGHKSDPLHGSRSPGGHVSL--SNGGDPITASVSGRADDLAYRCSS  149

Query  532  GASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLN  711
             + + +     SSENW VL   GDKP PRF+H+AA+VG+KMVV GG+SG  LL+D ++LN
Sbjct  150  DSFDLDARALDSSENWAVLPTEGDKPAPRFSHAAAIVGSKMVVFGGDSGHQLLDDTKMLN  209

Query  712  FDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
             ++ +W S + K+  SP     K+PACKGH +VSWG  V+LVGG+++PA+D++SVW+F+T
Sbjct  210  LEKLTWDSTTPKVLPSPIRSTSKLPACKGHCMVSWGNSVILVGGRSEPATDRLSVWSFNT  269

Query  892  ETECWSLME  918
            ETE WSLME
Sbjct  270  ETEIWSLME  278



>gb|ERN16928.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
Length=692

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 107/153 (70%), Gaps = 4/153 (3%)
 Frame = +1

Query  466  STGEAVGNSINDSEESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVG  645
            STG  +  + +D+  S  Q S+   + ++  SG++ENW+ LS  G KP PR NH+A V+G
Sbjct  9    STGNHLIEARSDAPNS--QSSSIGHDVSDSGSGNTENWIPLSTLGQKPEPRANHAATVIG  66

Query  646  NKMvvvggesgsglledvQVLNFDRFSWTSV--SSKLYLSPTSLPLKIPACKGHSLVSWG  819
             KM+V+GGE G  LL+DVQVL+F + +W +   +SK+YLS T +  ++P CKGHSLVSWG
Sbjct  67   CKMLVIGGECGGKLLDDVQVLDFSKLTWAAAKTASKVYLSQTDVMSRVPPCKGHSLVSWG  126

Query  820  KKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            K V L+GGK DP+ D+VSVWAFD + E WS ++
Sbjct  127  KTVFLIGGKMDPSCDRVSVWAFDVDAEYWSHID  159



>gb|EMS52652.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=1002

 Score =   121 bits (304),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 89/230 (39%), Positives = 124/230 (54%), Gaps = 43/230 (19%)
 Frame = +1

Query  352  NMFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEA-VGNSINDS-EESSCQH  525
            N  G +RR  +   LK  L D   G +SP    KR S  TGE  V  S++   ++ + + 
Sbjct  102  NANGLTRRFAR--PLKGHLHDPFHGPRSPAHPTKRSSHLTGEEPVATSVSGRPDDLAWRC  159

Query  526  STGASEFNNCTSGSSENWMVLSIAGDKPIPRFN---------------------------  624
            S+   + N     +SENW VLS  GDKP PRF+                           
Sbjct  160  SSDTFDLNGRAFENSENWAVLSTDGDKPSPRFDVINHLIDVLKCIGSCDVFIIIGFYTEA  219

Query  625  ------------HSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYLSPTS  768
                        H+AA+VG+KM+V GG+SG+ LL+D ++L+ D+ +W SV+SK+ +SP  
Sbjct  220  SITHSSGYHFKQHAAAMVGSKMIVFGGDSGNHLLDDTKILSLDKLTWDSVASKVRVSPGG  279

Query  769  LPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
               +   CKGH LV W K V+LVGGKT+P+SD++SVW F+TETE WS ME
Sbjct  280  RCAQFRPCKGHCLVPWDKTVILVGGKTEPSSDRISVWTFNTETEIWSHME  329



>gb|EMS62709.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=641

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 84/118 (71%), Gaps = 9/118 (8%)
 Frame = +1

Query  565  SSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSS  744
            SSENW VL   GDKP PRF+H+AA+VG+KMVV GG+SG  LL+D ++LN ++ +W S + 
Sbjct  52   SSENWAVLPTEGDKPAPRFSHAAAIVGSKMVVFGGDSGHQLLDDTKILNLEKLTWDSTTP  111

Query  745  KLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            K+  SP     K+PACKGH +VSWG  V+LVGGK         +WAF+TETE WSLME
Sbjct  112  KVLPSPIRSTSKLPACKGHCMVSWGNSVILVGGK---------IWAFNTETEIWSLME  160



>ref|XP_010931596.1| PREDICTED: tip elongation aberrant protein 3 isoform X5 [Elaeis 
guineensis]
Length=629

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  703  VLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWA  882
            +L+ D+ +W + + K++LSP    LKIPACKGHSLVSWGK VLL+GGKTDP S ++SVW+
Sbjct  18   ILSLDKLTWAAAAPKVHLSPNGHSLKIPACKGHSLVSWGKMVLLIGGKTDPVSHQISVWS  77

Query  883  FDTETECWSLME  918
            FD ETECW+ +E
Sbjct  78   FDVETECWTNIE  89



>ref|XP_001751751.1| predicted protein [Physcomitrella patens]
 gb|EDQ83186.1| predicted protein [Physcomitrella patens]
Length=1071

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 85/121 (70%), Gaps = 7/121 (6%)
 Frame = +1

Query  568  SENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSK  747
            ++ W  L+  G KP PR+ H+AAVVG +MVVVGG++GSG   DVQVL+F +  W+ +   
Sbjct  363  AQGWNNLNTRGKKPEPRYFHAAAVVGRRMVVVGGQTGSGPSNDVQVLHFSKMMWSELGRD  422

Query  748  LYLSP-------TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
              ++        ++ P ++P C+GHSL+SWGK VLL+GG+ +PASDKV VW+FD ETECW
Sbjct  423  TPVAKGRATTLKSATPGRMPLCRGHSLISWGKTVLLIGGEMNPASDKVEVWSFDLETECW  482

Query  907  S  909
            S
Sbjct  483  S  483



>gb|EMT26901.1| hypothetical protein F775_29769 [Aegilops tauschii]
Length=612

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +1

Query  637  VVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYLSPTSLPLKIPACKGHSLVSW  816
            +VG+KM+V GG+SG+ LL+D ++L+ D+ +W SV+SK+ +SP     +   CKGH LV W
Sbjct  1    MVGSKMIVFGGDSGNHLLDDTKILSLDKLTWDSVASKVRVSPAGRRAQFRPCKGHCLVPW  60

Query  817  GKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            GK V+LVGGK++P+SD++SVW F+TETE WS ME
Sbjct  61   GKTVILVGGKSEPSSDRISVWTFNTETEIWSHME  94



>ref|XP_002975032.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
 gb|EFJ23817.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
Length=652

 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = +1

Query  568  SENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSK  747
            + NW  +  +G +P  R NH+  V+G KM+VVGGE+ +  L DV +L+  + +W+ + S 
Sbjct  68   NRNWTAIQPSGFRPQARRNHATTVIGRKMIVVGGETDNRKLNDVHMLHLGKLTWSELGSS  127

Query  748  LYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            +   P+    ++P C GHSL++WGK VLLVGG  D  +DKV+VW+FD ETE W+
Sbjct  128  VITKPSQ---QLPPCSGHSLIAWGKTVLLVGGDMDLHTDKVTVWSFDLETEHWT  178



>ref|XP_002977452.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
 gb|EFJ21456.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
Length=652

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = +1

Query  568  SENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSK  747
            + NW  +  +G +P  R NH+  V+G KM+VVGGE+ +  L DV +L+  + +W+ + S 
Sbjct  68   NRNWTAIQPSGFRPQARRNHATTVIGRKMIVVGGETDNRKLNDVHMLHLGKLTWSELGSS  127

Query  748  LYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            +   P+    ++P C GHSL++WGK VLLVGG  D  +DKV+VW+FD ETE W+
Sbjct  128  VITKPSQ---QLPPCSGHSLIAWGKTVLLVGGDMDLDTDKVTVWSFDLETEHWT  178



>ref|XP_001759823.1| predicted protein [Physcomitrella patens]
 gb|EDQ75327.1| predicted protein [Physcomitrella patens]
Length=1020

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 85/139 (61%), Gaps = 7/139 (5%)
 Frame = +1

Query  514  SCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglle  693
            S +   G+ E      G S  W  +   G+KP+PR  H+AAVVG +MVVVGG++  G   
Sbjct  283  SFEDVVGSFEITFDDVGDSHGWNNVHPRGEKPVPRQFHAAAVVGRRMVVVGGQTELGSSN  342

Query  694  dvQVLNFDRFSWTSVSSKLYLSP-------TSLPLKIPACKGHSLVSWGKKVLLVGGKTD  852
            DVQ+ +  + +W+ +     ++         + P  +P C+GHSLVSWGK VLLVGG+ +
Sbjct  343  DVQMFHLGKMTWSELGRARTVAEGQACNVKAATPGWVPRCRGHSLVSWGKTVLLVGGELN  402

Query  853  PASDKVSVWAFDTETECWS  909
            PASD+V VW+FD ETECW+
Sbjct  403  PASDRVEVWSFDVETECWT  421



>ref|XP_002442263.1| hypothetical protein SORBIDRAFT_08g017210 [Sorghum bicolor]
 gb|EES16101.1| hypothetical protein SORBIDRAFT_08g017210 [Sorghum bicolor]
Length=539

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 72/123 (59%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+ G+ + W  LS++G  P PR+ H AAVV  KM V GG      L D+QVL+F  FSW+
Sbjct  49   CSIGAYDQWTPLSVSGQLPKPRYKHGAAVVQQKMYVFGGNHNGRYLGDIQVLDFKTFSWS  108

Query  733  SVSSKLYLSPTSLPLKIP--ACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             + +K    P+    ++P  AC GHS++ WG K+L + G T   ++ +SV  FD +T  W
Sbjct  109  KLEAKSQAGPSESAGEVPFSACAGHSVIQWGNKILCLAGHTREPAESLSVKEFDPQTCTW  168

Query  907  SLM  915
            S +
Sbjct  169  STL  171



>ref|XP_001761348.1| predicted protein [Physcomitrella patens]
 gb|EDQ73737.1| predicted protein [Physcomitrella patens]
Length=631

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 4/118 (3%)
 Frame = +1

Query  577  WMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYL  756
            W+ + + G KP+ R+ H+AAVV  K+ V+GG      L DVQVL+  + SW+ V +K+  
Sbjct  158  WVPVIVTGRKPLARYQHAAAVVEGKLYVIGGNHNGRYLNDVQVLDLKKLSWSKVDTKVPE  217

Query  757  SPTS----LPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            SP S    L    P C GH L+ WG+ +L+VGG   P +D V+V AFDT +  W+ +E
Sbjct  218  SPLSSHRDLQPWFPQCAGHRLIRWGELLLVVGGHAKPGADTVTVHAFDTHSLSWTKLE  275



>gb|EMS60218.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=499

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS+ G +P PR+ H AAVV  KM V GG      L D+QVL+F   SW+
Sbjct  39   CSVAAYDQWTPLSVPGQRPKPRYKHGAAVVQEKMYVFGGNHNGRYLGDIQVLDFKSLSWS  98

Query  733  SVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSL  912
             + +K+  S ++ P+ +  C GHSL+  G K+L V G T   ++ +SV  FD +T  WS+
Sbjct  99   KLEAKIQ-SESAEPVLVAPCAGHSLIPSGNKILSVAGHTREHTESLSVKEFDPQTSTWSI  157

Query  913  M  915
            +
Sbjct  158  L  158



>ref|XP_006855517.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Amborella 
trichopoda]
 gb|ERN16984.1| hypothetical protein AMTR_s00057p00207100 [Amborella trichopoda]
Length=679

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 68/119 (57%), Gaps = 0/119 (0%)
 Frame = +1

Query  562  GSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS  741
            G  + W+  S++G +P PR+ H AA+V ++M + GG      L D+QVL+     W+ V 
Sbjct  175  GIYDQWVSPSVSGQRPKPRYEHGAAIVQDEMYIFGGNHNGRYLNDLQVLDLKTLMWSKVE  234

Query  742  SKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            +K        P+ +P C GHSL++WG K++ + G +   S+ V+V  FD +T  WS ++
Sbjct  235  AKFATESQESPMTLPPCAGHSLIAWGNKLISIAGHSKDPSETVTVREFDIQTSTWSFLK  293



>tpg|DAA55336.1| TPA: hypothetical protein ZEAMMB73_384883 [Zea mays]
Length=168

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS++G  P PR+ H A V+  KM V GG      L D+QVL+F   SW+
Sbjct  38   CSISTYDQWTPLSVSGQLPKPRYKHGAVVIQQKMYVFGGNHNGRYLGDIQVLDFKTLSWS  97

Query  733  SVSSKLYLSPTSLPLKIP--ACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             + +K    P+     +P  AC GHS++ WG K+L + G T   ++ +SV  FD +T  W
Sbjct  98   KLEAKSQAEPSESAGAVPFSACAGHSVIQWGNKILCLAGHTREPAESLSVKEFDPQTCTW  157

Query  907  SLM  915
            S +
Sbjct  158  STL  160



>tpg|DAA55334.1| TPA: hypothetical protein ZEAMMB73_384883 [Zea mays]
 tpg|DAA55335.1| TPA: hypothetical protein ZEAMMB73_384883 [Zea mays]
Length=302

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS++G  P PR+ H A V+  KM V GG      L D+QVL+F   SW+
Sbjct  38   CSISTYDQWTPLSVSGQLPKPRYKHGAVVIQQKMYVFGGNHNGRYLGDIQVLDFKTLSWS  97

Query  733  SVSSKLYLSPTSLPLKIP--ACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             + +K    P+     +P  AC GHS++ WG K+L + G T   ++ +SV  FD +T  W
Sbjct  98   KLEAKSQAEPSESAGAVPFSACAGHSVIQWGNKILCLAGHTREPAESLSVKEFDPQTCTW  157

Query  907  SLM  915
            S +
Sbjct  158  STL  160



>ref|XP_008456547.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=510

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 72/124 (58%), Gaps = 10/124 (8%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+ L ++G +P  R+ H+AAVV  K+ +VGG      L DVQVL+    SW+SV  KL
Sbjct  13   DQWVALPVSGSRPPARYKHAAAVVDQKLYIVGGSRNGRYLSDVQVLDLSNLSWSSV--KL  70

Query  751  YLSPT--------SLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             +SP         SL   +P   GHS+V W KK++++GG    +SD++ V   D ET  W
Sbjct  71   QMSPGVENSDGNGSLVEALPPTSGHSMVKWDKKLIVLGGNLKGSSDRILVHCIDLETHTW  130

Query  907  SLME  918
            S+ME
Sbjct  131  SVME  134



>ref|XP_010904810.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X2 [Elaeis guineensis]
Length=612

 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 67/118 (57%), Gaps = 2/118 (2%)
 Frame = +1

Query  562  GSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS  741
            G  + W+  SI+G  P PR+ H AA+V +KM V GG      L D+QVL+    +W+ + 
Sbjct  106  GIYDQWIAPSISGQCPKPRYAHGAAIVQDKMYVFGGNHNGRYLNDLQVLDLKSLTWSKID  165

Query  742  SKLYLSPTSLPLKIPA--CKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            +K        P+ +P   C GHSL++WG K+L VGG T   S+ ++V  FD +T  WS
Sbjct  166  AKAQTGSPESPIVLPVTPCAGHSLITWGNKILSVGGHTKDPSETITVKEFDPQTCVWS  223



>ref|XP_004150374.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
sativus]
 gb|KGN62199.1| hypothetical protein Csa_2G327510 [Cucumis sativus]
Length=509

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 72/124 (58%), Gaps = 10/124 (8%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+ L ++G +P  R+ H+AAVV  K+ +VGG      L DVQVL+    SW+SV  KL
Sbjct  13   DQWVALPVSGSRPPARYKHAAAVVDQKLYIVGGSRNGRYLSDVQVLDLSNLSWSSV--KL  70

Query  751  YLSPT--------SLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             ++P         SL   +P   GHS+V W KK++++GG    +SD++ V   D ET  W
Sbjct  71   QMNPGVENSDGNGSLVEALPPASGHSMVKWDKKLIVLGGNLKRSSDRILVHCIDLETHTW  130

Query  907  SLME  918
            S+ME
Sbjct  131  SVME  134



>ref|XP_010904809.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Elaeis guineensis]
Length=676

 Score = 81.6 bits (200),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 67/118 (57%), Gaps = 2/118 (2%)
 Frame = +1

Query  562  GSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS  741
            G  + W+  SI+G  P PR+ H AA+V +KM V GG      L D+QVL+    +W+ + 
Sbjct  170  GIYDQWIAPSISGQCPKPRYAHGAAIVQDKMYVFGGNHNGRYLNDLQVLDLKSLTWSKID  229

Query  742  SKLYLSPTSLPLKIPA--CKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            +K        P+ +P   C GHSL++WG K+L VGG T   S+ ++V  FD +T  WS
Sbjct  230  AKAQTGSPESPIVLPVTPCAGHSLITWGNKILSVGGHTKDPSETITVKEFDPQTCVWS  287



>ref|XP_008672333.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=491

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS++G  P PR+ H A V+  KM V GG      L D+QVL+F   SW+
Sbjct  38   CSISTYDQWTPLSVSGQLPKPRYKHGAVVIQQKMYVFGGNHNGRYLGDIQVLDFKTLSWS  97

Query  733  SVSSKLYLSPTSLPLKIP--ACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             + +K    P+     +P  AC GHS++ WG K+L + G T   ++ +SV  FD +T  W
Sbjct  98   KLEAKSQAEPSESAGAVPFSACAGHSVIQWGNKILCLAGHTREPAESLSVKEFDPQTCTW  157

Query  907  SLM  915
            S +
Sbjct  158  STL  160



>ref|XP_008672336.1| PREDICTED: hypothetical protein isoform X5 [Zea mays]
Length=439

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS++G  P PR+ H A V+  KM V GG      L D+QVL+F   SW+
Sbjct  38   CSISTYDQWTPLSVSGQLPKPRYKHGAVVIQQKMYVFGGNHNGRYLGDIQVLDFKTLSWS  97

Query  733  SVSSKLYLSPTSLPLKIP--ACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             + +K    P+     +P  AC GHS++ WG K+L + G T   ++ +SV  FD +T  W
Sbjct  98   KLEAKSQAEPSESAGAVPFSACAGHSVIQWGNKILCLAGHTREPAESLSVKEFDPQTCTW  157

Query  907  SLM  915
            S +
Sbjct  158  STL  160



>ref|XP_008672334.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
 ref|XP_008672335.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
 gb|ACF83870.1| unknown [Zea mays]
 tpg|DAA55333.1| TPA: hypothetical protein ZEAMMB73_384883 [Zea mays]
Length=474

 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS++G  P PR+ H A V+  KM V GG      L D+QVL+F   SW+
Sbjct  38   CSISTYDQWTPLSVSGQLPKPRYKHGAVVIQQKMYVFGGNHNGRYLGDIQVLDFKTLSWS  97

Query  733  SVSSKLYLSPTSLPLKIP--ACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             + +K    P+     +P  AC GHS++ WG K+L + G T   ++ +SV  FD +T  W
Sbjct  98   KLEAKSQAEPSESAGAVPFSACAGHSVIQWGNKILCLAGHTREPAESLSVKEFDPQTCTW  157

Query  907  SLM  915
            S +
Sbjct  158  STL  160



>ref|XP_008672331.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672337.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA55332.1| TPA: hypothetical protein ZEAMMB73_384883 [Zea mays]
Length=526

 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS++G  P PR+ H A V+  KM V GG      L D+QVL+F   SW+
Sbjct  38   CSISTYDQWTPLSVSGQLPKPRYKHGAVVIQQKMYVFGGNHNGRYLGDIQVLDFKTLSWS  97

Query  733  SVSSKLYLSPTSLPLKIP--ACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             + +K    P+     +P  AC GHS++ WG K+L + G T   ++ +SV  FD +T  W
Sbjct  98   KLEAKSQAEPSESAGAVPFSACAGHSVIQWGNKILCLAGHTREPAESLSVKEFDPQTCTW  157

Query  907  SLM  915
            S +
Sbjct  158  STL  160



>ref|XP_008672332.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=494

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS++G  P PR+ H A V+  KM V GG      L D+QVL+F   SW+
Sbjct  38   CSISTYDQWTPLSVSGQLPKPRYKHGAVVIQQKMYVFGGNHNGRYLGDIQVLDFKTLSWS  97

Query  733  SVSSKLYLSPTSLPLKIP--ACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             + +K    P+     +P  AC GHS++ WG K+L + G T   ++ +SV  FD +T  W
Sbjct  98   KLEAKSQAEPSESAGAVPFSACAGHSVIQWGNKILCLAGHTREPAESLSVKEFDPQTCTW  157

Query  907  SLM  915
            S +
Sbjct  158  STL  160



>ref|NP_001169061.1| uncharacterized protein LOC100382902 [Zea mays]
 gb|ACN31552.1| unknown [Zea mays]
Length=658

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 68/122 (56%), Gaps = 2/122 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  S + W  LS++G +P PR+ H A V+ NKM + GG      L D+Q L+    +W+ 
Sbjct  162  TVSSHDQWTPLSVSGLRPKPRYEHGATVLQNKMYIFGGNHNGRYLSDLQALDLKSLTWSK  221

Query  736  VSSKLYLSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            V +KL   P  ++   +I  C GHSL+SWG K L + G T   S+ V+V  FD  T  WS
Sbjct  222  VDAKLQAEPADSTKTTQIAPCAGHSLISWGNKFLSIAGHTKDPSEGVTVKEFDPHTCTWS  281

Query  910  LM  915
            ++
Sbjct  282  IV  283



>ref|XP_010659627.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Vitis vinifera]
 emb|CBI39496.3| unnamed protein product [Vitis vinifera]
Length=674

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 6/120 (5%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+  S++G +P PR+ H AAVV +KM + GG      L D+QVL+   ++W+ V  K 
Sbjct  173  DQWIAPSVSGQRPKPRYEHGAAVVQDKMYIFGGNHNGRYLNDLQVLDLRSWTWSKVEVKA  232

Query  751  ----YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                  SP+++PL  P+C GHSL+ W  K+L + G T   S+ + V AFD +T  WS ++
Sbjct  233  GTESLESPSTVPL--PSCAGHSLIQWENKLLSIAGHTKDPSETIQVKAFDLQTCTWSTLK  290



>ref|XP_002284019.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Vitis vinifera]
Length=675

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 6/120 (5%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+  S++G +P PR+ H AAVV +KM + GG      L D+QVL+   ++W+ V  K 
Sbjct  173  DQWIAPSVSGQRPKPRYEHGAAVVQDKMYIFGGNHNGRYLNDLQVLDLRSWTWSKVEVKA  232

Query  751  ----YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                  SP+++PL  P+C GHSL+ W  K+L + G T   S+ + V AFD +T  WS ++
Sbjct  233  GTESLESPSTVPL--PSCAGHSLIQWENKLLSIAGHTKDPSETIQVKAFDLQTCTWSTLK  290



>gb|EEC69439.1| hypothetical protein OsI_38614 [Oryza sativa Indica Group]
Length=494

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 70/124 (56%), Gaps = 3/124 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  S + W  + ++G  P PR+ H+AAVV  KM V GG      L D+QVL+F   SW+
Sbjct  41   CSISSYDQWARIPVSGPLPKPRYKHAAAVVQEKMYVFGGNHNGRYLGDMQVLDFKSLSWS  100

Query  733  SVSSKLY-LSPTSLP--LKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETEC  903
             + +K+    P+ L     +P C GH+LV WG K+L + G T   ++ +SV  FD +T  
Sbjct  101  KLEAKIQSEEPSDLTGTASLPPCAGHALVPWGNKILCLAGHTREPTESLSVKEFDPQTCT  160

Query  904  WSLM  915
            WS +
Sbjct  161  WSTL  164



>ref|NP_001152073.1| acyl-CoA binding protein [Zea mays]
 gb|ACG45648.1| acyl-CoA binding protein [Zea mays]
Length=659

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 2/118 (2%)
 Frame = +1

Query  565  SSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSS  744
            S + W  LS++G +P PR+ H A V+ NKM + GG      L D+Q L+     W+ V +
Sbjct  166  SHDEWTPLSVSGLRPKPRYEHGATVLQNKMYIFGGNHNGRYLSDLQALDLKSLIWSKVDT  225

Query  745  KLYLSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSL  912
            K    P  ++   +IP C GHSL+SWG K L + G T   S+ ++V  FD  T  WS+
Sbjct  226  KFQAEPADSTKTTQIPPCAGHSLISWGNKFLSIAGHTKDPSEGITVKEFDPHTCTWSI  283



>ref|XP_003562942.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brachypodium 
distachyon]
Length=662

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  + E W  LS +G +P PR+ H A V+ +KM + GG      L D+QVL+    SW+ 
Sbjct  166  TVSAHEEWTALSPSGQRPKPRYEHGATVLQDKMYIFGGNHNGRYLSDLQVLDLKSLSWSK  225

Query  736  VSSKLYLSPTSLP--LKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            + +KL    + L    ++  C GHSL+SWG +   + G T   SD V+V  FD  T  WS
Sbjct  226  IDAKLQAGSSDLAKTTQVSPCAGHSLISWGNRFFSIAGHTKDPSDNVTVKEFDPHTCTWS  285

Query  910  LM  915
            ++
Sbjct  286  IV  287



>gb|EEE53359.1| hypothetical protein OsJ_36386 [Oryza sativa Japonica Group]
Length=494

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 70/124 (56%), Gaps = 3/124 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  S + W  + ++G  P PR+ H+AAVV  KM V GG      L D+QVL+F   SW+
Sbjct  41   CSISSYDQWARIPVSGPLPKPRYKHAAAVVQEKMYVFGGNHNGRYLGDMQVLDFKCLSWS  100

Query  733  SVSSKLY-LSPTSLP--LKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETEC  903
             + +K+    P+ L     +P C GH+LV WG K+L + G T   ++ +SV  FD +T  
Sbjct  101  KLEAKIQSEEPSDLTGTASLPPCAGHALVPWGNKILCLAGHTREPTESLSVKEFDPQTCT  160

Query  904  WSLM  915
            WS +
Sbjct  161  WSTL  164



>tpg|DAA52360.1| TPA: hypothetical protein ZEAMMB73_733782 [Zea mays]
Length=612

 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 2/120 (2%)
 Frame = +1

Query  565  SSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSS  744
            S + W  LS++G +P PR+ H A V+ NKM + GG      L D+Q L+     W+ V +
Sbjct  119  SHDEWTPLSVSGLRPKPRYEHGATVLQNKMYIFGGNHNGRYLSDLQALDLKSLIWSKVDT  178

Query  745  KLYLSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            K    P  +++  +I  C GHSL+SWG K L + G T   S+ ++V  FD  T  WS+++
Sbjct  179  KFQAEPADSTITTQIAPCAGHSLISWGNKFLSIAGHTKDPSEGITVKEFDPHTCTWSIVK  238



>ref|NP_001066950.1| Os12g0540800 [Oryza sativa Japonica Group]
 gb|ABA99445.2| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29969.1| Os12g0540800 [Oryza sativa Japonica Group]
 dbj|BAG94637.1| unnamed protein product [Oryza sativa Japonica Group]
Length=527

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 70/124 (56%), Gaps = 3/124 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  S + W  + ++G  P PR+ H+AAVV  KM V GG      L D+QVL+F   SW+
Sbjct  41   CSISSYDQWARIPVSGPLPKPRYKHAAAVVQEKMYVFGGNHNGRYLGDMQVLDFKCLSWS  100

Query  733  SVSSKLY-LSPTSLP--LKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETEC  903
             + +K+    P+ L     +P C GH+LV WG K+L + G T   ++ +SV  FD +T  
Sbjct  101  KLEAKIQSEEPSDLTGTASLPPCAGHALVPWGNKILCLAGHTREPTESLSVKEFDPQTCT  160

Query  904  WSLM  915
            WS +
Sbjct  161  WSTL  164



>tpg|DAA52361.1| TPA: acyl-CoA binding protein [Zea mays]
Length=659

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 2/120 (2%)
 Frame = +1

Query  565  SSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSS  744
            S + W  LS++G +P PR+ H A V+ NKM + GG      L D+Q L+     W+ V +
Sbjct  166  SHDEWTPLSVSGLRPKPRYEHGATVLQNKMYIFGGNHNGRYLSDLQALDLKSLIWSKVDT  225

Query  745  KLYLSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            K    P  +++  +I  C GHSL+SWG K L + G T   S+ ++V  FD  T  WS+++
Sbjct  226  KFQAEPADSTITTQIAPCAGHSLISWGNKFLSIAGHTKDPSEGITVKEFDPHTCTWSIVK  285



>ref|XP_001764473.1| predicted protein [Physcomitrella patens]
 gb|EDQ70740.1| predicted protein [Physcomitrella patens]
Length=682

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 72/120 (60%), Gaps = 5/120 (4%)
 Frame = +1

Query  565  SSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSS  744
            S   W+ +++ G KP+ R+ HSAAVV  K+ V+GG      L DVQVL+    +W+ V +
Sbjct  174  SYREWVPVNVTGRKPLARYQHSAAVVEGKLYVIGGNHNGRYLNDVQVLDLKTLTWSKVDT  233

Query  745  KLYLSPTSL---PLK--IPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            ++  SP S    PL+  +P C GH L+ W + +L+VGG   PA++ V+V +FD  +  W+
Sbjct  234  RVPQSPFSSKQDPLQPWLPQCAGHRLIRWKELLLVVGGHAKPAAETVTVHSFDIHSLSWT  293



>ref|XP_010931617.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=609

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 6/119 (5%)
 Frame = +1

Query  562  GSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS  741
            G  + W+  SI+G +P PR+ H AA+V +KM V GG      L D+QVL+    +W+ + 
Sbjct  103  GIYDQWVAPSISGQRPKPRYAHGAAIVHDKMYVFGGNHNGRYLNDLQVLDLKSLTWSKID  162

Query  742  SKLYL----SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
            +K+      SPT +P  +  C GHSL++WG K+L V G T   S+ ++V  FD +   W
Sbjct  163  AKVQTGSPESPTIVP--VAPCAGHSLITWGNKILSVAGHTKDPSETITVKEFDPQICIW  219



>ref|XP_010931615.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010931616.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=674

 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 6/119 (5%)
 Frame = +1

Query  562  GSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS  741
            G  + W+  SI+G +P PR+ H AA+V +KM V GG      L D+QVL+    +W+ + 
Sbjct  168  GIYDQWVAPSISGQRPKPRYAHGAAIVHDKMYVFGGNHNGRYLNDLQVLDLKSLTWSKID  227

Query  742  SKLYL----SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
            +K+      SPT +P  +  C GHSL++WG K+L V G T   S+ ++V  FD +   W
Sbjct  228  AKVQTGSPESPTIVP--VAPCAGHSLITWGNKILSVAGHTKDPSETITVKEFDPQICIW  284



>ref|XP_006650861.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Oryza brachyantha]
Length=657

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 66/118 (56%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            E W  LS++G +P PR+ H A VV +KM + GG      L D+Q L+    +W+ + +KL
Sbjct  168  EEWTPLSVSGQRPKPRYEHGATVVQDKMYIFGGNHNGRYLSDLQALDLKSLTWSKIDAKL  227

Query  751  YLSPT--SLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                T  S   ++ +C GHSL+SWG K   V G T   S+ ++V  FD  T  WS+++
Sbjct  228  QAGSTDSSKSAQVSSCAGHSLISWGNKFFSVAGHTKDPSENITVKEFDPHTCTWSIVK  285



>ref|XP_001760924.1| predicted protein [Physcomitrella patens]
 gb|EDQ74313.1| predicted protein, partial [Physcomitrella patens]
Length=617

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = +1

Query  700  QVLNFDRFSWTSVSSKLYLS-------PTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPA  858
            Q+L+  R  W+ +      +         S P  +P C+GHSL+SWGK VLL+GG+ +P 
Sbjct  26   QMLHLHRMMWSELGRGRAFANGQPGNLKASTPGPLPLCRGHSLISWGKTVLLIGGELNPG  85

Query  859  SDKVSVWAFDTETECWS  909
            SD+V VW+FD E ECW+
Sbjct  86   SDRVEVWSFDLEMECWT  102



>gb|KHG13462.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=669

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   I G  P  R+ H AAVV  KM + GG      L D+ VL+F  ++W+ V +K 
Sbjct  172  DTWISPPITGQHPKARYQHGAAVVQEKMYIYGGNHNGRYLGDLHVLDFRSWTWSKVGTKA  231

Query  751  YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              SP+  P+ +  C GHSL+ WG K+L + G     S+ + V AFD +T  WS+++
Sbjct  232  VESPS--PVNVAPCAGHSLIPWGNKLLSIAGHMKDPSETIQVKAFDLQTGTWSMLK  285



>ref|XP_006664611.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Oryza brachyantha]
Length=526

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  S + W  L+ +G  P PR+ H+AAVV  KM V GG      L D+QVL+F   SW+
Sbjct  39   CSISSYDQWTRLAASGPLPKPRYKHAAAVVQEKMYVFGGNYNGRYLGDMQVLDFKSLSWS  98

Query  733  SVSSKLYLSPTSL--PLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             +  K    P+ L     +  C GH L+ WG K+L + G T   ++ +SV  FD +T  W
Sbjct  99   KLEVKSQSEPSELTGTTSLAPCAGHGLIPWGNKILCLAGHTREPTENLSVKVFDPQTCTW  158

Query  907  SLM  915
            S +
Sbjct  159  STL  161



>gb|KJB45987.1| hypothetical protein B456_007G342000 [Gossypium raimondii]
Length=650

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   I G  P  R+ H AAV+  KM + GG      L D+ VL+F  ++W+ V +K 
Sbjct  153  DTWISPPITGQNPKARYQHGAAVLQEKMYIYGGNHNGRYLGDLHVLDFRSWTWSKVGTKA  212

Query  751  YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLM  915
              SP+  P+ I  C GHSL+ WG K+L + G     S+ + V AFD +T  WS++
Sbjct  213  VESPS--PVNIAPCAGHSLIPWGNKLLSIAGHMKDPSETIQVKAFDLQTGTWSML  265



>gb|KJB45986.1| hypothetical protein B456_007G342000 [Gossypium raimondii]
Length=570

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   I G  P  R+ H AAV+  KM + GG      L D+ VL+F  ++W+ V +K 
Sbjct  153  DTWISPPITGQNPKARYQHGAAVLQEKMYIYGGNHNGRYLGDLHVLDFRSWTWSKVGTKA  212

Query  751  YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLM  915
              SP+  P+ I  C GHSL+ WG K+L + G     S+ + V AFD +T  WS++
Sbjct  213  VESPS--PVNIAPCAGHSLIPWGNKLLSIAGHMKDPSETIQVKAFDLQTGTWSML  265



>ref|XP_002463567.1| hypothetical protein SORBIDRAFT_01g002200 [Sorghum bicolor]
 gb|EER90565.1| hypothetical protein SORBIDRAFT_01g002200 [Sorghum bicolor]
Length=659

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 2/123 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  S + W  LS++G +P PR+ H A V+ NKM + GG      L D+Q L+    +W+ 
Sbjct  163  TVSSHDEWTPLSVSGLRPKPRYEHGATVLQNKMYIFGGNHNGRYLSDLQALDLKSLTWSK  222

Query  736  VSSKLYL--SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            V +KL    + ++   +I  C GHSL+SWG K L + G T   S+ ++V  FD  T  WS
Sbjct  223  VDAKLQAESADSTKTTQIAPCAGHSLISWGNKFLSIAGHTKDPSEGITVKEFDPHTCTWS  282

Query  910  LME  918
            +++
Sbjct  283  IVK  285



>gb|EMT00399.1| Acyl-CoA-binding domain-containing protein 4 [Aegilops tauschii]
Length=671

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  + E W  LS++G +P PR+ H A V+ +KM + GG      L D+QVL+    +W+ 
Sbjct  165  TVSAHEEWTALSVSGQRPKPRYEHGATVLQDKMYIFGGNHNGRYLSDLQVLDLKSLTWSK  224

Query  736  VSSKLY--LSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            V +KL    S ++   ++  C GHSL+S G K   V G T   SD ++V  FD  T  WS
Sbjct  225  VDAKLQAGTSDSAKTAQVSPCAGHSLISCGNKFFSVAGHTKDPSDSITVKEFDPHTCTWS  284

Query  910  LME  918
            +++
Sbjct  285  IVK  287



>gb|EAZ29205.1| hypothetical protein OsJ_13266 [Oryza sativa Japonica Group]
Length=676

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            E W  LS+ G +P PR+ H A VV +KM + GG      L D+Q L+    +W+ + +K 
Sbjct  168  EEWTPLSVNGQRPKPRYEHGATVVQDKMYIFGGNHNGRYLSDLQALDLKSLTWSKIDAKF  227

Query  751  YLSPT--SLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                T  S   ++ +C GHSL+SWG K   V G T   S+ ++V  FD  T  WS+++
Sbjct  228  QAGSTDSSKSAQVSSCAGHSLISWGNKFFSVAGHTKDPSENITVKEFDPHTCTWSIVK  285



>gb|AAR88580.1| putative transcription factor [Oryza sativa Japonica Group]
 gb|ABF99747.1| acyl-CoA binding family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=656

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            E W  LS+ G +P PR+ H A VV +KM + GG      L D+Q L+    +W+ + +K 
Sbjct  168  EEWTPLSVNGQRPKPRYEHGATVVQDKMYIFGGNHNGRYLSDLQALDLKSLTWSKIDAKF  227

Query  751  YLSPT--SLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                T  S   ++ +C GHSL+SWG K   V G T   S+ ++V  FD  T  WS+++
Sbjct  228  QAGSTDSSKSAQVSSCAGHSLISWGNKFFSVAGHTKDPSENITVKEFDPHTCTWSIVK  285



>ref|NP_001051819.1| Os03g0835600 [Oryza sativa Japonica Group]
 gb|ABF99748.1| acyl-CoA binding family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13733.1| Os03g0835600 [Oryza sativa Japonica Group]
Length=655

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            E W  LS+ G +P PR+ H A VV +KM + GG      L D+Q L+    +W+ + +K 
Sbjct  168  EEWTPLSVNGQRPKPRYEHGATVVQDKMYIFGGNHNGRYLSDLQALDLKSLTWSKIDAKF  227

Query  751  YLSPT--SLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                T  S   ++ +C GHSL+SWG K   V G T   S+ ++V  FD  T  WS+++
Sbjct  228  QAGSTDSSKSAQVSSCAGHSLISWGNKFFSVAGHTKDPSENITVKEFDPHTCTWSIVK  285



>gb|ABF99749.1| acyl-CoA binding family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=536

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            E W  LS+ G +P PR+ H A VV +KM + GG      L D+Q L+    +W+ + +K 
Sbjct  168  EEWTPLSVNGQRPKPRYEHGATVVQDKMYIFGGNHNGRYLSDLQALDLKSLTWSKIDAKF  227

Query  751  YLSPT--SLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                T  S   ++ +C GHSL+SWG K   V G T   S+ ++V  FD  T  WS+++
Sbjct  228  QAGSTDSSKSAQVSSCAGHSLISWGNKFFSVAGHTKDPSENITVKEFDPHTCTWSIVK  285



>ref|XP_007220663.1| hypothetical protein PRUPE_ppa004462mg [Prunus persica]
 gb|EMJ21862.1| hypothetical protein PRUPE_ppa004462mg [Prunus persica]
Length=508

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 68/129 (53%), Gaps = 3/129 (2%)
 Frame = +1

Query  541  EFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDR  720
            E N  T  + + W  L ++G +P  R+ H+A VV  K+ ++GG      L DVQV +F  
Sbjct  3    EINWQTDLAYDQWKALPVSGPRPPARYKHAAVVVDEKLYIIGGSRNGRHLSDVQVFDFRN  62

Query  721  FSWTSVSSKL---YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDT  891
              W+++  K        + L   +PA   H++V WG K+LL+GG +   SDK+ VW  D 
Sbjct  63   LLWSNIKLKPNSDKFEDSGLQEVLPAISAHNMVKWGNKILLLGGNSKKLSDKIIVWVIDL  122

Query  892  ETECWSLME  918
            ET    ++E
Sbjct  123  ETHLCGIVE  131



>ref|XP_004962830.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Setaria italica]
Length=528

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 65/119 (55%), Gaps = 3/119 (3%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS++G  P PR+ H A V+  KM V GG      L D QVL+    SW+
Sbjct  47   CSISAYDQWTPLSVSGQLPRPRYKHGAVVIQQKMYVFGGNHNGRYLGDTQVLDLKSLSWS  106

Query  733  SVSSKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
             + +K   S ++  +   AC GHSL+ WG K+L + G +   ++ +SV  FD +T  WS
Sbjct  107  MLEAK---SESAEAVSFAACAGHSLIPWGNKILCLAGHSREPTESLSVKEFDPQTCTWS  162



>ref|XP_010674725.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Beta 
vulgaris subsp. vulgaris]
Length=670

 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   ++G +P PR+ H AAVVG KM V GG      L D+QVL+   ++W+ V  K 
Sbjct  169  DQWVAPPVSGLQPKPRYEHGAAVVGEKMYVYGGNHNGRYLSDLQVLDLRAWTWSRVEVKT  228

Query  751  YLSPTSLPLKIPA--CKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                  +   IP+  C GH+L++W  K+L V G T   S+ + V  FD +T  WS+++
Sbjct  229  GAEMPEVQASIPSIPCAGHTLITWENKLLSVAGHTKDRSETIQVRVFDPQTSTWSILK  286



>ref|XP_002984630.1| hypothetical protein SELMODRAFT_20979, partial [Selaginella moellendorffii]
 gb|EFJ14275.1| hypothetical protein SELMODRAFT_20979, partial [Selaginella moellendorffii]
Length=633

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 9/121 (7%)
 Frame = +1

Query  577  WMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYL  756
            W+   ++G +P  R+ H+AAVV +KM V+GG      L DVQVL+    +W+ V  KL  
Sbjct  167  WLSPLVSGRRPAARYQHAAAVVHDKMFVIGGNHNGRYLNDVQVLDLRTLTWSKVEQKLPT  226

Query  757  SP--TSLPLKIPA------CKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSL  912
            SP  +S+P  IP+      C GHSL+   + + +VGG +  + D VSV AFDTET  WSL
Sbjct  227  SPLSSSMP-PIPSNQILSPCAGHSLIRKNRMLFVVGGHSKNSPDSVSVHAFDTETFTWSL  285

Query  913  M  915
             
Sbjct  286  F  286



>ref|XP_004144782.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Cucumis sativus]
 gb|KGN60945.1| hypothetical protein Csa_2G030060 [Cucumis sativus]
Length=671

 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   ++G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++WT + +K 
Sbjct  174  DQWISPPVSGLRPKARYEHGAAVIQDKMYIFGGNHNGRYLSDLHVLDLRSWAWTKLEAKT  233

Query  751  YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
              SP S P K+  C GHSL+ W  K+L V G T   SD + V  FD +T  WS
Sbjct  234  Q-SPESPPEKLTPCAGHSLIPWENKLLSVAGHTKDPSDAIQVRVFDVQTSTWS  285



>ref|XP_003575455.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Brachypodium distachyon]
Length=534

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 2/123 (2%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS++G  P PR+ H AAVV  K  V GG      L D+QVL+    SW+
Sbjct  41   CSVTAYDQWTPLSVSGQPPKPRYKHGAAVVQEKSYVFGGNHNGRYLGDIQVLDIKSLSWS  100

Query  733  SVSSKLYLSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
             +  K+   P  T+  + +  C GHSL+ +G K+L + G T   ++ +SV  FD +T  W
Sbjct  101  KLEGKIQSGPSETAETVSVAPCAGHSLIPYGNKILSLAGYTREPTENISVKEFDPQTCTW  160

Query  907  SLM  915
            S +
Sbjct  161  STL  163



>ref|XP_011648837.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X2 [Cucumis sativus]
Length=670

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   ++G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++WT + +K 
Sbjct  174  DQWISPPVSGLRPKARYEHGAAVIQDKMYIFGGNHNGRYLSDLHVLDLRSWAWTKLEAKT  233

Query  751  YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
              SP S P K+  C GHSL+ W  K+L V G T   SD + V  FD +T  WS
Sbjct  234  Q-SPESPPEKLTPCAGHSLIPWENKLLSVAGHTKDPSDAIQVRVFDVQTSTWS  285



>ref|XP_008800864.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Phoenix dactylifera]
Length=675

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 66/119 (55%), Gaps = 6/119 (5%)
 Frame = +1

Query  562  GSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS  741
            G  + W+  SI+G +P PR+ H AA+V +KM V GG      L D+QVL+    +W+ + 
Sbjct  169  GIYDQWVAPSISGQRPKPRYAHGAAIVHDKMYVFGGNHNGRYLNDLQVLDLKSLTWSKIE  228

Query  742  SKLYL----SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
            +K       SPT +P  +  C GH L++WG K+L V G T   S+ ++V  FD +   W
Sbjct  229  AKAQTGSPESPTIVP--VAPCAGHCLITWGNKILSVSGHTKDPSETITVKEFDLQICMW  285



>ref|XP_010550980.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Tarenaya 
hassleriana]
Length=668

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 66/118 (56%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+    +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+
Sbjct  169  DQWIAPQTSGQRPKARYEHGAAVIRDKMYIYGGNHNGRYLSDLHVLDLKNWTWSRVETKV  228

Query  751  YLSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
               P  +S P+ +  C GHSL+ W  K+L VGG T   ++ + V  FD +T  WS ++
Sbjct  229  ATEPLESSSPVTLTPCAGHSLIPWDNKLLSVGGHTKDPAESIQVKVFDPQTSTWSTLK  286



>ref|XP_010524874.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Tarenaya hassleriana]
Length=669

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W     +G +P  R+ H AAV+ +KM + GG      L D+  L+   ++W+ V +K+
Sbjct  170  DQWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLSDLHALDLKNWTWSRVETKV  229

Query  751  YLSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
               P  +S P  +  C GHSL+SW  K+L +GG T   S+ + V  FD ET  WS ++
Sbjct  230  ATEPLESSSPATLTPCAGHSLISWDSKLLSIGGHTKDPSESIQVKVFDPETSTWSTLK  287



>ref|XP_010524875.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X2 [Tarenaya hassleriana]
Length=668

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W     +G +P  R+ H AAV+ +KM + GG      L D+  L+   ++W+ V +K+
Sbjct  169  DQWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLSDLHALDLKNWTWSRVETKV  228

Query  751  YLSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
               P  +S P  +  C GHSL+SW  K+L +GG T   S+ + V  FD ET  WS ++
Sbjct  229  ATEPLESSSPATLTPCAGHSLISWDSKLLSIGGHTKDPSESIQVKVFDPETSTWSTLK  286



>ref|XP_008232327.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X2 [Prunus mume]
Length=517

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  + + W  L ++G +P  R+ H+A VV  K+ ++GG      L DVQV +F    W++
Sbjct  17   TDLAYDQWKALPVSGPRPPARYKHAAVVVDEKLYIIGGSRNGRHLSDVQVFDFRNLLWSN  76

Query  736  VSSKL---YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
            +  K        + L   +PA   H++V WG K+LL+GG +   SDK+ VW  D ET   
Sbjct  77   IKLKPNSDKFEDSGLQEVLPAISAHNMVKWGNKILLLGGNSKKLSDKIIVWVIDLETHLC  136

Query  907  SLME  918
             ++E
Sbjct  137  GILE  140



>dbj|BAJ87202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 67/122 (55%), Gaps = 2/122 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  + + W  LS++G +P PR+ H A V+ +KM V GG      L D+QVL+    +W+ 
Sbjct  47   TVSAHKEWTALSVSGQRPKPRYEHGATVLQDKMYVFGGNHNGRYLSDLQVLDLKSLTWSK  106

Query  736  VSSKLY--LSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            + +KL    S ++   ++  C GHSL+S G K   V G T   SD ++V  FD  T  WS
Sbjct  107  IDAKLQAGTSDSAKTAQVSPCAGHSLISCGNKFFSVAGHTKDPSDSITVKEFDPHTCTWS  166

Query  910  LM  915
            ++
Sbjct  167  IV  168



>ref|XP_008232325.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Prunus mume]
 ref|XP_008232326.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Prunus mume]
Length=522

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  + + W  L ++G +P  R+ H+A VV  K+ ++GG      L DVQV +F    W++
Sbjct  22   TDLAYDQWKALPVSGPRPPARYKHAAVVVDEKLYIIGGSRNGRHLSDVQVFDFRNLLWSN  81

Query  736  VSSKL---YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
            +  K        + L   +PA   H++V WG K+LL+GG +   SDK+ VW  D ET   
Sbjct  82   IKLKPNSDKFEDSGLQEVLPAISAHNMVKWGNKILLLGGNSKKLSDKIIVWVIDLETHLC  141

Query  907  SLME  918
             ++E
Sbjct  142  GILE  145



>ref|XP_010267284.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
 ref|XP_010267285.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
 ref|XP_010267286.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=519

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 9/123 (7%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+ L + G +P  R+ H+A VV  K+ + GG      L D+QVL+    +W+ +  KL
Sbjct  22   DQWVQLPVTGSRPPARYKHAAEVVDEKLYIAGGSRNGRYLSDIQVLDLRTLAWSKL--KL  79

Query  751  Y-------LSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            Y       L  +SL    PA  GHS++ WG+K+LL+GG +   SD V V   D ET  +S
Sbjct  80   YMDSNPDNLEDSSLLSAFPAISGHSMIKWGRKLLLLGGHSKDPSDYVVVRMVDLETNHYS  139

Query  910  LME  918
            +++
Sbjct  140  ILK  142



>gb|ACN39866.1| unknown [Picea sitchensis]
Length=665

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 2/116 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+ LS+ G +   R+ H+AAVV  KM V GG      L D+QVL+     W+ V +K+
Sbjct  165  DQWVSLSVTGRQLKARYEHAAAVVQEKMYVFGGNHNGRYLNDLQVLDLKSLMWSKVDTKM  224

Query  751  YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S +S  L  P C GH L+ WG K+L V G T   SD V+V +FDTE+  W +++
Sbjct  225  -ASDSSQELLSP-CAGHCLIQWGNKILAVAGHTKDPSDIVTVRSFDTESCTWCVLK  278



>ref|XP_012089029.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Jatropha curcas]
 gb|KDP23494.1| hypothetical protein JCGZ_23327 [Jatropha curcas]
Length=673

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   I+G +P  R+ H AA++ +KM + GG      L D+ VL+   ++W+ V +K+
Sbjct  170  DQWIAPPISGQRPKARYEHDAAIIQDKMYIYGGNHNGRYLNDLHVLDLRSWAWSKVDAKI  229

Query  751  YLSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                  +  P  I  C GHSL+ W  K+L + G T   S+ + V  FD +T CWS ++
Sbjct  230  EEESDGSKTPATITPCAGHSLIPWENKLLTIAGHTKDPSESIQVKVFDPQTRCWSTLK  287



>ref|XP_008354811.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Malus domestica]
 ref|XP_008354812.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Malus domestica]
Length=548

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 68/124 (55%), Gaps = 3/124 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  + + W+ L ++G +P  R+ H+A VV  K+ ++GG      L DVQV +F    W++
Sbjct  50   TDLAYDQWIALPVSGPRPPARYKHAAVVVDEKLYIIGGSRNGRNLSDVQVFDFRNLLWSN  109

Query  736  VSSKLYLSP---TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
            +  K  L     + L   +P    H++V WG K+LL+GG +  +SD++ VW  D ET   
Sbjct  110  IKLKPNLDKFEDSGLQEVLPGISAHNMVRWGNKLLLLGGNSKKSSDRIIVWFIDLETHVC  169

Query  907  SLME  918
             ++E
Sbjct  170  GIIE  173



>ref|XP_002882412.1| acyl-CoA binding protein 4, acyl-CoA-binding domain 4 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH58671.1| acyl-CoA binding protein 4, acyl-CoA-binding domain 4 [Arabidopsis 
lyrata subsp. lyrata]
Length=669

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 78/154 (51%), Gaps = 3/154 (2%)
 Frame = +1

Query  463  SSTGEAVGNSINDSEESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVV  642
            +S GE    S  +   +  Q     SE +N  S  ++ W     +G +P  R+ H AAV+
Sbjct  135  NSFGETKTISTENGRLAETQDKDVVSEDSNTVSVYNQ-WTAPQTSGQRPKARYEHGAAVI  193

Query  643  GNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYL--SPTSLPLKIPACKGHSLVSW  816
             +KM + GG      L D+ VL+   ++W+ V +K+      TS P  +  C GHSL++W
Sbjct  194  QDKMYIYGGNHNGRYLGDLHVLDLKNWTWSRVETKVATDAQETSTPTLLAPCAGHSLIAW  253

Query  817  GKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              K+L +GG T   S+ + V  FD  T  WS+++
Sbjct  254  DNKLLSIGGHTKDPSESMQVKVFDPHTSTWSMLQ  287



>emb|CDY18777.1| BnaAnng02420D [Brassica napus]
 gb|AIS76196.1| acyl-coA binding protein [Brassica napus]
Length=665

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P PR+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  170  QWTAPQTSGQRPKPRYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  229

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FDT T  WS+++
Sbjct  230  TESEETSPTLLSPCAGHSLIPWDNKLLSIGGHTKNPSESMQVRVFDTHTCTWSMLK  285



>ref|XP_004981190.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Setaria italica]
Length=661

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  S + W  LSI+G  P PR+ H A V+ +KM + GG      L D+Q L+    +W+ 
Sbjct  162  TVSSLDEWTPLSISGHHPKPRYEHGATVLQDKMYIFGGNHNGRYLSDLQALDLKSLTWSK  221

Query  736  VSSKLYL--SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            + +KL    S ++   +I  C GHSL++WG K   + G T   S+ ++V  FD  T  WS
Sbjct  222  IDAKLQAESSDSAKTSQIAPCAGHSLITWGHKFFSIAGHTKDPSEGITVKEFDPHTCTWS  281

Query  910  LM  915
            ++
Sbjct  282  IV  283



>ref|XP_004981189.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Setaria italica]
Length=662

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  S + W  LSI+G  P PR+ H A V+ +KM + GG      L D+Q L+    +W+ 
Sbjct  163  TVSSLDEWTPLSISGHHPKPRYEHGATVLQDKMYIFGGNHNGRYLSDLQALDLKSLTWSK  222

Query  736  VSSKLYL--SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
            + +KL    S ++   +I  C GHSL++WG K   + G T   S+ ++V  FD  T  WS
Sbjct  223  IDAKLQAESSDSAKTSQIAPCAGHSLITWGHKFFSIAGHTKDPSEGITVKEFDPHTCTWS  282

Query  910  LM  915
            ++
Sbjct  283  IV  284



>ref|XP_009134825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Brassica rapa]
Length=666

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 72/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  511  SSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsgll  690
            S  Q     SE  N  S  ++ W     +G +P  R+ H AAV+ +KM + GG      L
Sbjct  150  SETQDKDVVSEVTNSVSVYNQ-WTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYL  208

Query  691  edvQVLNFDRFSWTSVSSKLYL-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDK  867
             D+ VL+F  ++W+ V +K+   S  + P  +  C GHSL+ W  K+L +GG T   S+ 
Sbjct  209  GDLHVLDFKNWTWSRVETKVATESEETSPTLLSPCAGHSLIPWDNKLLSIGGHTKNPSES  268

Query  868  VSVWAFDTETECWSLME  918
            + V  FDT T  WS+++
Sbjct  269  MQVKIFDTRTCTWSMLK  285



>emb|CDX74147.1| BnaA03g29000D [Brassica napus]
Length=666

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 72/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  511  SSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsgll  690
            S  Q     SE  N  S  ++ W     +G +P  R+ H AAV+ +KM + GG      L
Sbjct  150  SETQDKDVVSEVTNSVSVYNQ-WTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYL  208

Query  691  edvQVLNFDRFSWTSVSSKLYL-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDK  867
             D+ VL+F  ++W+ V +K+   S  + P  +  C GHSL+ W  K+L +GG T   S+ 
Sbjct  209  GDLHVLDFKNWTWSRVETKVATESEETSPTLLSPCAGHSLIPWDNKLLSIGGHTKNPSES  268

Query  868  VSVWAFDTETECWSLME  918
            + V  FDT T  WS+++
Sbjct  269  MQVKIFDTRTCTWSMLK  285



>ref|XP_010088948.1| Acyl-CoA-binding domain-containing protein 4 [Morus notabilis]
 gb|EXB37163.1| Acyl-CoA-binding domain-containing protein 4 [Morus notabilis]
Length=530

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 1/116 (1%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W++  I+G +P  R+ H AA+V +KM + GG      L D+ VL+F  +SW+ +  K 
Sbjct  152  DQWILPPISGQRPKARYEHGAAIVQDKMYIYGGNHNGRYLNDLPVLDFRTWSWSRIEVKA  211

Query  751  YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S +  P+ +  C GHSL+ W  K+L V G T   S+ + V AFD +T  WS ++
Sbjct  212  G-SDSPSPVTVVPCAGHSLIPWENKLLSVAGHTKDPSETIQVKAFDLQTSSWSALK  266



>ref|XP_006289311.1| hypothetical protein CARUB_v10002793mg [Capsella rubella]
 gb|EOA22209.1| hypothetical protein CARUB_v10002793mg [Capsella rubella]
Length=668

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 77/154 (50%), Gaps = 3/154 (2%)
 Frame = +1

Query  463  SSTGEAVGNSINDSEESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVV  642
            +S GE   NS  D   +  Q      E  N  S  ++ W  L  +G  P  R+ H AAV+
Sbjct  135  ASFGEIKKNSTEDGGLTKTQDKDVVLEDPNTVSVYNQ-WTALRTSGQPPKARYEHGAAVI  193

Query  643  GNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYL--SPTSLPLKIPACKGHSLVSW  816
             +KM + GG      L D+ VL+   ++W+ V +K+      TS P K+  C GHSL+ W
Sbjct  194  QDKMYMYGGNHNGRYLGDLHVLDLKNWTWSRVETKVVTESQETSSPAKLTHCAGHSLIPW  253

Query  817  GKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              K+L VGG T   S+ + V  FD  +  WS+++
Sbjct  254  ENKLLSVGGHTKDPSESMIVKEFDLHSCSWSILK  287



>ref|XP_010485985.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Camelina sativa]
Length=669

 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 3/154 (2%)
 Frame = +1

Query  463  SSTGEAVGNSINDSEESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVV  642
            +S GE    S  + + +  Q     SE +N  S  ++ W     +G  P  R+ H AAV+
Sbjct  135  NSFGETKTISTENGQLAETQDKDVVSEESNTVSVYNQ-WTAPQTSGQPPKARYEHGAAVI  193

Query  643  GNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYLS--PTSLPLKIPACKGHSLVSW  816
             +KM + GG      L D+ VL+   ++W+ V +K+      TS P  +  C GHSL+ W
Sbjct  194  QDKMYIYGGNHNGRYLGDLHVLDLKNWTWSRVETKVATESEETSTPTLLAPCAGHSLIPW  253

Query  817  GKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
               +L +GG T   S+ + V  FDT T  WS+++
Sbjct  254  DNNLLSIGGHTKDPSESIQVKVFDTHTSTWSMLK  287



>ref|XP_010417784.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Camelina 
sativa]
Length=662

 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 3/154 (2%)
 Frame = +1

Query  463  SSTGEAVGNSINDSEESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVV  642
            +S GE    S  + + +  Q     SE +N  S  ++ W     +G  P  R+ H AAV+
Sbjct  134  NSFGETKTISTENGQLAETQDKDVVSEESNTVSVYNQ-WTAPQTSGQPPKARYEHGAAVI  192

Query  643  GNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYLS--PTSLPLKIPACKGHSLVSW  816
             +KM + GG      L D+ VL+   ++W+ V +K+      TS P  +  C GHSL+ W
Sbjct  193  QDKMYIYGGNHNGRYLGDLHVLDLKNWTWSRVETKVATESEETSTPTLLAPCAGHSLIPW  252

Query  817  GKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
               +L +GG T   S+ + V  FDT T  WS+++
Sbjct  253  DNNLLSIGGHTKDPSESIQVKVFDTHTSTWSMLK  286



>ref|XP_010464068.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=668

 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 3/154 (2%)
 Frame = +1

Query  463  SSTGEAVGNSINDSEESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVV  642
            +S GE    S  + + +  Q     SE +N  S  ++ W     +G  P  R+ H AAV+
Sbjct  134  NSFGETKTISTENGQLAETQDKDVVSEESNTVSVYNQ-WTAPQTSGQPPKARYEHGAAVI  192

Query  643  GNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYLS--PTSLPLKIPACKGHSLVSW  816
             +KM + GG      L D+ VL+   ++W+ V +K+      TS P  +  C GHSL+ W
Sbjct  193  QDKMYIYGGNHNGRYLGDLHVLDLKNWTWSRVETKVATESEETSTPTLLAPCAGHSLIPW  252

Query  817  GKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
               +L +GG T   S+ + V  FDT T  WS+++
Sbjct  253  DNNLLSIGGHTKDPSESIQVKVFDTHTSTWSMLK  286



>ref|XP_010485986.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X2 [Camelina sativa]
Length=668

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 3/154 (2%)
 Frame = +1

Query  463  SSTGEAVGNSINDSEESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVV  642
            +S GE    S  + + +  Q     SE +N  S  ++ W     +G  P  R+ H AAV+
Sbjct  134  NSFGETKTISTENGQLAETQDKDVVSEESNTVSVYNQ-WTAPQTSGQPPKARYEHGAAVI  192

Query  643  GNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYLS--PTSLPLKIPACKGHSLVSW  816
             +KM + GG      L D+ VL+   ++W+ V +K+      TS P  +  C GHSL+ W
Sbjct  193  QDKMYIYGGNHNGRYLGDLHVLDLKNWTWSRVETKVATESEETSTPTLLAPCAGHSLIPW  252

Query  817  GKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
               +L +GG T   S+ + V  FDT T  WS+++
Sbjct  253  DNNLLSIGGHTKDPSESIQVKVFDTHTSTWSMLK  286



>ref|XP_010464067.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=669

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 3/154 (2%)
 Frame = +1

Query  463  SSTGEAVGNSINDSEESSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVV  642
            +S GE    S  + + +  Q     SE +N  S  ++ W     +G  P  R+ H AAV+
Sbjct  135  NSFGETKTISTENGQLAETQDKDVVSEESNTVSVYNQ-WTAPQTSGQPPKARYEHGAAVI  193

Query  643  GNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYLS--PTSLPLKIPACKGHSLVSW  816
             +KM + GG      L D+ VL+   ++W+ V +K+      TS P  +  C GHSL+ W
Sbjct  194  QDKMYIYGGNHNGRYLGDLHVLDLKNWTWSRVETKVATESEETSTPTLLAPCAGHSLIPW  253

Query  817  GKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
               +L +GG T   S+ + V  FDT T  WS+++
Sbjct  254  DNNLLSIGGHTKDPSESIQVKVFDTHTSTWSMLK  287



>emb|CDY18797.1| BnaAnng02620D [Brassica napus]
Length=666

 Score = 72.4 bits (176),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P PR+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  171  QWTAPQTSGQRPKPRYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  230

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              +  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FDT T  WS+++
Sbjct  231  TETEETSPTLLSPCAGHSLIPWDNKLLSIGGHTKNPSESLQVRVFDTHTCTWSMLK  286



>ref|XP_006297138.1| hypothetical protein CARUB_v10013146mg [Capsella rubella]
 gb|EOA30036.1| hypothetical protein CARUB_v10013146mg [Capsella rubella]
Length=667

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 80/155 (52%), Gaps = 11/155 (7%)
 Frame = +1

Query  484  GNSINDSEESSCQHSTGA--------SEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAV  639
            GNS ++++  S ++   A        SE +N  S  ++ W     +G  P  R+ H AAV
Sbjct  133  GNSFDETKTISTENGRLAETQDKDVVSEDSNTVSVYNQ-WTAPQTSGQMPKARYEHGAAV  191

Query  640  VGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLYL--SPTSLPLKIPACKGHSLVS  813
            + +KM V GG      L D+ VL+   ++W+ V +K+      TS P  +  C GHSLV 
Sbjct  192  IKDKMYVYGGNHNGRYLGDLHVLDLKTWTWSRVETKVATESQETSTPTLLAPCAGHSLVP  251

Query  814  WGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            W   +L +GG T   S+ + V  FDT+T  WS+++
Sbjct  252  WDNNLLSIGGHTKDPSESIQVKVFDTQTSTWSILK  286



>ref|XP_008454338.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cucumis melo]
Length=671

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   ++G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++WT + +K 
Sbjct  174  DQWISPPVSGLRPKARYEHGAAVIQDKMYIFGGNHNGRYLSDLHVLDLRSWAWTKLEAKT  233

Query  751  YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
              S  S P K+  C GHSL+ W  K+L V G T   SD + V  FD +T  WS
Sbjct  234  Q-SAESPPEKLTPCAGHSLIPWENKLLSVAGHTKDPSDAIQVRVFDVQTSTWS  285



>ref|XP_008454347.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cucumis melo]
Length=670

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   ++G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++WT + +K 
Sbjct  174  DQWISPPVSGLRPKARYEHGAAVIQDKMYIFGGNHNGRYLSDLHVLDLRSWAWTKLEAKT  233

Query  751  YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
              S  S P K+  C GHSL+ W  K+L V G T   SD + V  FD +T  WS
Sbjct  234  Q-SAESPPEKLTPCAGHSLIPWENKLLSVAGHTKDPSDAIQVRVFDVQTSTWS  285



>ref|XP_008375625.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=264

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 11/128 (9%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  + + W+ L ++G +P  R+ H+A VV  K+ +VGG      L DVQV +F    W  
Sbjct  17   TDLACDQWIALPVSGPRPPARYKHAAVVVDEKLYIVGGSRNGRHLSDVQVFDFRNLLW--  74

Query  736  VSSKLYLSPTS-------LPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
              SK+ L P S       L   +P    H++V WG K+LL+GG +  +SD + VW  D E
Sbjct  75   --SKIKLKPNSBKFEDSGLQEVLPGISAHNMVRWGDKLLLLGGNSKKSSDSIIVWFIDLE  132

Query  895  TECWSLME  918
            T    ++E
Sbjct  133  THHCGIIE  140



>gb|AIS76201.1| acyl-coA binding protein [Brassica napus]
Length=665

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  170  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  229

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FDT T  WS+++
Sbjct  230  TESEETSPTLLSPCAGHSLIPWDNKLLSIGGHTKDHSESMQVKVFDTHTSTWSMLK  285



>ref|XP_008347058.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Malus domestica]
Length=514

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 11/128 (9%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  + + W+ L ++G +P  R+ H+A VV  K+ +VGG      L DVQV +F    W  
Sbjct  17   TDLACDQWIALPVSGPRPPARYKHAAVVVDEKLYIVGGSRNGRHLSDVQVFDFRNLLW--  74

Query  736  VSSKLYLSPTS-------LPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTE  894
              SK+ L P S       L   +P    H++V WG K+LL+GG +  +SD + VW  D E
Sbjct  75   --SKIKLKPNSBKFEDSGLQEVLPGISAHNMVRWGDKLLLLGGNSKKSSDSIIVWFIDLE  132

Query  895  TECWSLME  918
            T    ++E
Sbjct  133  THHCGIIE  140



>ref|XP_009147241.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Brassica rapa]
Length=668

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 8/120 (7%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  171  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  230

Query  754  -----LSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                 +SPT L   +  C GHSL+ W  K+L +GG T   S+ + V  FDT T  WS+++
Sbjct  231  TESEEISPTFL---LSPCAGHSLIPWDNKLLSIGGHTKDHSESMQVKVFDTHTSTWSMLK  287



>ref|XP_002264719.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Vitis 
vinifera]
 ref|XP_010658328.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Vitis 
vinifera]
 emb|CBI31383.3| unnamed protein product [Vitis vinifera]
Length=508

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 66/115 (57%), Gaps = 5/115 (4%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+ L ++G +P  R+ H+AAVV  K+ + GG      L DVQV +    +W+++  K+
Sbjct  13   DQWLRLPVSGPRPSARYKHAAAVVDEKLYISGGSRNGRYLSDVQVFDLRSLAWSALKLKM  72

Query  751  Y-----LSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETE  900
                  +   +L    PA  GH+++ WG K+L++GG +  +SD V+V A D ET+
Sbjct  73   ESNADKVEENNLQEVFPATSGHNMIKWGNKLLILGGHSKNSSDGVTVRAIDLETQ  127



>ref|XP_009147243.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X2 [Brassica rapa]
Length=667

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 8/120 (7%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  170  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  229

Query  754  -----LSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                 +SPT L   +  C GHSL+ W  K+L +GG T   S+ + V  FDT T  WS+++
Sbjct  230  TESEEISPTFL---LSPCAGHSLIPWDNKLLSIGGHTKDHSESMQVKVFDTHTSTWSMLK  286



>ref|XP_009346106.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009346107.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Pyrus x bretschneideri]
Length=515

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = +1

Query  556  TSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTS  735
            T  + + W+ L ++G +P  R+ H+A V   K+ ++GG      L DVQV +F    W++
Sbjct  17   TDLAYDQWLALPVSGPRPPARYKHAAVVADEKLYIIGGSHNGRNLSDVQVFDFRNLLWSN  76

Query  736  VSSKL---YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECW  906
            +  K        + L   +P    H++V WG K+LL+GG +  +SD++ VW  D ET   
Sbjct  77   IKLKPNSDKFEDSGLQEVLPGISAHNMVRWGNKLLLLGGNSRKSSDRIIVWFIDLETHVC  136

Query  907  SLME  918
             ++E
Sbjct  137  GIIE  140



>gb|AIS76200.1| acyl-coA binding protein [Brassica napus]
Length=667

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  171  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  230

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FDT T  WS+++
Sbjct  231  TESEETSPTLLSPCAGHSLIPWDNKLLSIGGHTKDHSESMQVKVFDTHTSTWSMLK  286



>ref|XP_009346105.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Pyrus x bretschneideri]
Length=548

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 82/167 (49%), Gaps = 16/167 (10%)
 Frame = +1

Query  427  TKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTGASEFNNCTSGSSENWMVLSIAGDK  606
            T+  ++   R ++S G  +   + D + S+ Q           T  + + W+ L ++G +
Sbjct  20   TRRVLKRIGRLTASMG--IEGIVKDVDTSNWQ-----------TDLAYDQWLALPVSGPR  66

Query  607  PIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL---YLSPTSLPL  777
            P  R+ H+A V   K+ ++GG      L DVQV +F    W+++  K        + L  
Sbjct  67   PPARYKHAAVVADEKLYIIGGSHNGRNLSDVQVFDFRNLLWSNIKLKPNSDKFEDSGLQE  126

Query  778  KIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
             +P    H++V WG K+LL+GG +  +SD++ VW  D ET    ++E
Sbjct  127  VLPGISAHNMVRWGNKLLLLGGNSRKSSDRIIVWFIDLETHVCGIIE  173



>emb|CDY27769.1| BnaA05g31780D [Brassica napus]
Length=666

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  170  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  229

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FDT T  WS+++
Sbjct  230  TESEETSPTLLSPCAGHSLIPWDNKLLSIGGHTKDHSESMQVKVFDTHTSTWSMLK  285



>emb|CDY05166.1| BnaC05g46370D [Brassica napus]
Length=666

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  170  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  229

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FDT T  WS+++
Sbjct  230  TESEETSPTLLSPCAGHSLIPWDNKLLSIGGHTKDHSESMQVKVFDTHTSTWSMLK  285



>gb|AIS76195.1| acyl-coA binding protein [Brassica napus]
Length=666

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  170  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  229

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FDT T  WS+++
Sbjct  230  TESEETSPTLLSPCAGHSLIPWDNKLLSIGGHTKDHSESMQVKVFDTHTSTWSMLK  285



>ref|NP_974227.1| acyl-CoA binding protein 4 [Arabidopsis thaliana]
 gb|AEE74238.1| acyl-CoA binding protein 4 [Arabidopsis thaliana]
Length=669

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 2/117 (2%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  171  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  230

Query  754  L--SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                 TS P  +  C GHSL++W  K+L +GG T   S+ + V  FD  T  WS+++
Sbjct  231  TESQETSTPTLLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTITWSMLK  287



>ref|NP_187193.3| acyl-CoA binding protein 4 [Arabidopsis thaliana]
 sp|Q9MA55.1|ACBP4_ARATH RecName: Full=Acyl-CoA-binding domain-containing protein 4; Short=Acyl-CoA 
binding protein 4 [Arabidopsis thaliana]
 gb|AAF64540.1| unknown protein [Arabidopsis thaliana]
 gb|AAP21266.1| At3g05420 [Arabidopsis thaliana]
 dbj|BAF00008.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74237.1| acyl-CoA binding protein 4 [Arabidopsis thaliana]
Length=668

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 2/117 (2%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  170  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA  229

Query  754  L--SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                 TS P  +  C GHSL++W  K+L +GG T   S+ + V  FD  T  WS+++
Sbjct  230  TESQETSTPTLLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTITWSMLK  286



>emb|CAN60660.1| hypothetical protein VITISV_040879 [Vitis vinifera]
Length=316

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 66/115 (57%), Gaps = 5/115 (4%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+ L ++G +P  R+ H+AAVV  K+ + GG      L DVQV +    +W+++  K+
Sbjct  13   DQWLRLPVSGPRPSARYKHAAAVVDEKLYISGGSRNGRYLSDVQVFDLRSLAWSALKLKM  72

Query  751  -----YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETE  900
                  +   +L    PA  GH+++ WG K+L++GG +  +SD V+V A D ET+
Sbjct  73   ESNADKVEENNLQEVFPATSGHNMIKWGNKLLILGGHSKNSSDGVTVRAIDLETQ  127



>gb|AIS76194.1| acyl-coA binding protein [Brassica napus]
Length=666

 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 70/137 (51%), Gaps = 2/137 (1%)
 Frame = +1

Query  511  SSCQHSTGASEFNNCTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsgll  690
            S  Q     SE  N  S  ++ W     +G +P  R+ H AAV+ +KM + GG      L
Sbjct  150  SETQDKDVVSEVTNSVSVYNQ-WTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYL  208

Query  691  edvQVLNFDRFSWTSVSSKLYL-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDK  867
             D+ VL+   ++W+ V +K+   S  + P  +  C GHSL+ W  K L +GG T   S+ 
Sbjct  209  GDLHVLDLKNWTWSRVETKVATESDETSPTLLSPCAGHSLIPWDNKFLSIGGHTKDPSES  268

Query  868  VSVWAFDTETECWSLME  918
            + V  FDT T  WS+++
Sbjct  269  MQVKVFDTHTCTWSMLK  285



>ref|XP_004496137.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
 ref|XP_004496138.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
 ref|XP_004496139.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=506

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            +NW+ ++++G +P  R+ H+AAVV  K+ +VGG      L DVQV +F    W+S+  K 
Sbjct  13   DNWVPVTVSGARPPARYKHAAAVVDEKLYIVGGSRNGRHLSDVQVFDFRSLMWSSLKLKA  72

Query  751  YLSP---TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTET  897
                    S    +PA  GHS++ WG+K+L++GG +  +SD V+V   D ET
Sbjct  73   NTGEDHGNSSQETLPATSGHSMIRWGEKLLVLGGNSKDSSDTVTVRYIDIET  124



>ref|XP_002512412.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF49864.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=675

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 65/123 (53%), Gaps = 12/123 (10%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   I+G +P  R+ H AAVV +KM + GG      L D+ VL+   +SW+ V +K+
Sbjct  171  DQWITPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLNDLHVLDLRSWSWSKVDAKV  230

Query  751  YL-------SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
                     SPT  P     C GHSL+SW  K+L + G T   S+ + V  FD +T  WS
Sbjct  231  EAESNESKSSPTLTP-----CAGHSLISWENKLLSIAGHTKDPSEYMQVKVFDLQTRTWS  285

Query  910  LME  918
             ++
Sbjct  286  TLK  288



>ref|XP_004307015.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469269.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=516

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 64/119 (54%), Gaps = 3/119 (3%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSV---S  741
            + W+ L ++G +P  R+ H+A VV   + +VGG      L DVQV +F    W+++   +
Sbjct  22   DQWVALPVSGSRPPARYKHAAVVVHENLYIVGGSRNGRHLSDVQVFDFRNLLWSTIKLNA  81

Query  742  SKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
            S      + +   +P    H+LV WG K+L++GG +   SDK+ VW  D ET    +ME
Sbjct  82   SSNNFEDSGVQEVVPPTSSHNLVKWGNKLLVIGGNSKKLSDKIIVWFIDLETHLSGVME  140



>ref|XP_010269461.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=675

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 2/120 (2%)
 Frame = +1

Query  562  GSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS  741
            G  + W+  SI+G +P  R+ H AAVV +KM + GG      L D+QVL+    +W+ V 
Sbjct  166  GVYDQWIAPSISGQRPKARYEHGAAVVQDKMYIFGGNHNGRYLNDLQVLDLRSLTWSKVE  225

Query  742  SKL--YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLM  915
             +     S +S P+    C GHSL+ W  K+L + G T   S+ V+V AFD +T  WS +
Sbjct  226  IRAGTESSESSSPVLSAPCAGHSLILWENKLLSIAGHTKDPSETVTVKAFDLQTCTWSTL  285



>ref|XP_009124026.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Brassica rapa]
Length=666

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P PR+ H AAV+ +KM + GG      L D+ VL+   ++W+   +K+ 
Sbjct  171  QWTAPQTSGQRPKPRYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRGETKVA  230

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FD  T  WS+++
Sbjct  231  TESEETFPTLLSPCAGHSLIPWDNKLLSIGGHTKNPSESMQVRVFDAHTCTWSMLK  286



>ref|XP_010269462.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=674

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 2/120 (2%)
 Frame = +1

Query  562  GSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS  741
            G  + W+  SI+G +P  R+ H AAVV +KM + GG      L D+QVL+    +W+ V 
Sbjct  166  GVYDQWIAPSISGQRPKARYEHGAAVVQDKMYIFGGNHNGRYLNDLQVLDLRSLTWSKVE  225

Query  742  SKL--YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLM  915
             +     S +S P+    C GHSL+ W  K+L + G T   S+ V+V AFD +T  WS +
Sbjct  226  IRAGTESSESSSPVLSAPCAGHSLILWENKLLSIAGHTKDPSETVTVKAFDLQTCTWSTL  285



>ref|XP_009124023.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Brassica rapa]
Length=665

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P PR+ H AAV+ +KM + GG      L D+ VL+   ++W+   +K+ 
Sbjct  170  QWTAPQTSGQRPKPRYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRGETKVA  229

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FD  T  WS+++
Sbjct  230  TESEETFPTLLSPCAGHSLIPWDNKLLSIGGHTKNPSESMQVRVFDAHTCTWSMLK  285



>ref|XP_010269463.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=666

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 2/120 (2%)
 Frame = +1

Query  562  GSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS  741
            G  + W+  SI+G +P  R+ H AAVV +KM + GG      L D+QVL+    +W+ V 
Sbjct  157  GVYDQWIAPSISGQRPKARYEHGAAVVQDKMYIFGGNHNGRYLNDLQVLDLRSLTWSKVE  216

Query  742  SKL--YLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLM  915
             +     S +S P+    C GHSL+ W  K+L + G T   S+ V+V AFD +T  WS +
Sbjct  217  IRAGTESSESSSPVLSAPCAGHSLILWENKLLSIAGHTKDPSETVTVKAFDLQTCTWSTL  276



>ref|XP_009124025.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Brassica rapa]
Length=583

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P PR+ H AAV+ +KM + GG      L D+ VL+   ++W+   +K+ 
Sbjct  88   QWTAPQTSGQRPKPRYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRGETKVA  147

Query  754  L-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              S  + P  +  C GHSL+ W  K+L +GG T   S+ + V  FD  T  WS+++
Sbjct  148  TESEETFPTLLSPCAGHSLIPWDNKLLSIGGHTKNPSESMQVRVFDAHTCTWSMLK  203



>ref|XP_009381939.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=669

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+  S++G +P PR+ H AAV+  KM + GG      L DVQVL+    +W+ + +K 
Sbjct  169  DQWVAPSVSGQRPKPRYAHGAAVLQEKMYIFGGNHNGRYLSDVQVLDLKSLTWSRIEAKA  228

Query  751  YLS--PTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWS  909
                  +S    +    GHSL+ WG K+L +GG T   S+ ++V  FD +T  WS
Sbjct  229  LAGSLDSSTTGSVAPSAGHSLIPWGDKILSIGGHTKDPSETITVKEFDPQTCLWS  283



>ref|XP_010259670.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Nelumbo nucifera]
Length=591

 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 65/118 (55%), Gaps = 2/118 (2%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSK-  747
            + W+  S++G  P  R+ H AAV+ +KM + GG      L D+QVL+    +W+ +  K 
Sbjct  86   DQWVAPSVSGQCPKARYEHGAAVIQDKMYIFGGNHNGRYLNDLQVLDLRSLTWSKLEVKA  145

Query  748  -LYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
                S +S P+ +  C GHSL+ W  K+L + G T   S+ V+V  FD +T  WS ++
Sbjct  146  GTEYSESSNPVSLSPCAGHSLIQWENKLLSIAGHTKDPSETVTVKVFDLQTCTWSTLK  203



>gb|KJB45284.1| hypothetical protein B456_007G298800 [Gossypium raimondii]
 gb|KJB45285.1| hypothetical protein B456_007G298800 [Gossypium raimondii]
Length=675

 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS---  741
            + W+   I G +P  R+ H AAVV +KM + GG      L D+ VL+   ++W+ V    
Sbjct  171  DQWVSPPIKGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDLNVLDLRSWTWSKVEASF  230

Query  742  -SKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
             SK   SP+  P+ I  C GHS++ W  K+L + G T   S+ + + AFD +T  WS+++
Sbjct  231  ESKSEESPS--PVNIAPCAGHSMIPWENKLLSIAGHTKDPSETIQIKAFDLQTGTWSILK  288



>gb|KJB45282.1| hypothetical protein B456_007G298800 [Gossypium raimondii]
Length=678

 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS---  741
            + W+   I G +P  R+ H AAVV +KM + GG      L D+ VL+   ++W+ V    
Sbjct  171  DQWVSPPIKGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDLNVLDLRSWTWSKVEASF  230

Query  742  -SKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
             SK   SP+  P+ I  C GHS++ W  K+L + G T   S+ + + AFD +T  WS+++
Sbjct  231  ESKSEESPS--PVNIAPCAGHSMIPWENKLLSIAGHTKDPSETIQIKAFDLQTGTWSILK  288



>gb|KJB45278.1| hypothetical protein B456_007G298800 [Gossypium raimondii]
Length=675

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVS---  741
            + W+   I G +P  R+ H AAVV +KM + GG      L D+ VL+   ++W+ V    
Sbjct  171  DQWVSPPIKGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDLNVLDLRSWTWSKVEASF  230

Query  742  -SKLYLSPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
             SK   SP+  P+ I  C GHS++ W  K+L + G T   S+ + + AFD +T  WS+++
Sbjct  231  ESKSEESPS--PVNIAPCAGHSMIPWENKLLSIAGHTKDPSETIQIKAFDLQTGTWSILK  288



>ref|XP_006577230.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Glycine max]
Length=649

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 66/117 (56%), Gaps = 5/117 (4%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   ++G  P  R+ H AAVV +K+ + GG      L D+ VL+   ++W+ + +K 
Sbjct  169  DQWIAPPVSGGNPKARYEHGAAVVQDKLYIYGGNHNGRYLNDLHVLDLRSWTWSKIEAKT  228

Query  751  YL-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
             + SPT+    IP C GHSL+ WG K+L + G T   S+ + V  FD ET  WS ++
Sbjct  229  GVESPTT---SIP-CAGHSLIPWGNKLLSIAGHTKDPSESIQVKEFDLETAAWSTLK  281



>gb|EMT16097.1| hypothetical protein F775_31985 [Aegilops tauschii]
Length=513

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 70/136 (51%), Gaps = 16/136 (12%)
 Frame = +1

Query  553  CTSGSSENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWT  732
            C+  + + W  LS+ G +P PR+   AAVV  KM V GG      L D+QVL+F   SW+
Sbjct  39   CSVAAYDQWTPLSVPGQRPKPRYKQGAAVVQEKMYVFGGNHNGRYLGDIQVLDFKSLSWS  98

Query  733  SVSSKLYLSPTSLPLKIPACKGHSLVSW---------------GKKVLLVGGKTDPASDK  867
             + +K+  S ++ P+ +  C GHSLV                 G K+L + G T   ++ 
Sbjct  99   KLEAKIQ-SESAEPVFVAPCAGHSLVIIKYCFVVISDKKLIPSGNKILSLAGHTREHTES  157

Query  868  VSVWAFDTETECWSLM  915
            +SV  FD +T  WS++
Sbjct  158  LSVKEFDPQTCTWSIL  173



>ref|XP_006577229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=657

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 66/117 (56%), Gaps = 5/117 (4%)
 Frame = +1

Query  571  ENWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKL  750
            + W+   ++G  P  R+ H AAVV +K+ + GG      L D+ VL+   ++W+ + +K 
Sbjct  168  DQWIAPPVSGGNPKARYEHGAAVVQDKLYIYGGNHNGRYLNDLHVLDLRSWTWSKIEAKT  227

Query  751  YL-SPTSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
             + SPT+    IP C GHSL+ WG K+L + G T   S+ + V  FD ET  WS ++
Sbjct  228  GVESPTT---SIP-CAGHSLIPWGNKLLSIAGHTKDPSESIQVKEFDLETAAWSTLK  280



>ref|XP_006408080.1| hypothetical protein EUTSA_v10020218mg [Eutrema salsugineum]
 gb|ESQ49533.1| hypothetical protein EUTSA_v10020218mg [Eutrema salsugineum]
Length=668

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (53%), Gaps = 2/117 (2%)
 Frame = +1

Query  574  NWMVLSIAGDKPIPRFNHSAAVVGNKMvvvggesgsglledvQVLNFDRFSWTSVSSKLY  753
             W     +G +P  R+ H AAV+ +KM + GG      L D+ VL+   ++W+ V +K+ 
Sbjct  171  QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKNWTWSRVETKVA  230

Query  754  LSP--TSLPLKIPACKGHSLVSWGKKVLLVGGKTDPASDKVSVWAFDTETECWSLME  918
              P  TS    +  C GHSL+ W  K+L +GG T   S+ + V  FD  T  WS+++
Sbjct  231  TEPQETSAQTLLSPCAGHSLIPWDNKLLSIGGHTKDPSESMQVKVFDPHTCTWSMLK  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2145599438534