BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1572

Length=1388
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002268645.1|  PREDICTED: 60S acidic ribosomal protein P0         498   5e-172   Vitis vinifera
ref|XP_002276842.1|  PREDICTED: 60S acidic ribosomal protein P0         498   9e-172   Vitis vinifera
emb|CAN80537.1|  hypothetical protein VITISV_003812                     496   4e-171   Vitis vinifera
gb|KHG25462.1|  60S acidic ribosomal P0                                 493   5e-170   Gossypium arboreum [tree cotton]
gb|KHG08087.1|  60S acidic ribosomal P0                                 493   8e-170   Gossypium arboreum [tree cotton]
gb|KJB78787.1|  hypothetical protein B456_013G019000                    491   4e-169   Gossypium raimondii
ref|XP_004149240.1|  PREDICTED: 60S acidic ribosomal protein P0         490   6e-169   Cucumis sativus [cucumbers]
gb|KJB76159.1|  hypothetical protein B456_012G076000                    490   7e-169   Gossypium raimondii
ref|XP_011076719.1|  PREDICTED: 60S acidic ribosomal protein P0         490   1e-168   Sesamum indicum [beniseed]
ref|XP_007009051.1|  Ribosomal protein L10 family protein isoform 1     489   1e-168   
gb|KJB74261.1|  hypothetical protein B456_011G283700                    488   6e-168   Gossypium raimondii
ref|XP_008463223.1|  PREDICTED: 60S acidic ribosomal protein P0         488   9e-168   Cucumis melo [Oriental melon]
ref|NP_001238374.1|  60S acidic ribosomal protein P0                    487   1e-167   Glycine max [soybeans]
ref|NP_001239676.1|  uncharacterized protein LOC100777482               486   3e-167   Glycine max [soybeans]
ref|XP_007009052.1|  Ribosomal protein L10 family protein isoform 2     485   8e-167   
ref|XP_012087750.1|  PREDICTED: 60S acidic ribosomal protein P0         485   1e-166   Jatropha curcas
ref|XP_004501267.1|  PREDICTED: 60S acidic ribosomal protein P0-like    484   2e-166   Cicer arietinum [garbanzo]
gb|KHG25720.1|  60S acidic ribosomal P0                                 484   3e-166   Gossypium arboreum [tree cotton]
ref|XP_004490967.1|  PREDICTED: 60S acidic ribosomal protein P0-like    482   1e-165   Cicer arietinum [garbanzo]
ref|XP_004490966.1|  PREDICTED: 60S acidic ribosomal protein P0-like    482   1e-165   Cicer arietinum [garbanzo]
ref|XP_010534571.1|  PREDICTED: 60S acidic ribosomal protein P0-like    482   1e-165   Tarenaya hassleriana [spider flower]
gb|EPS69246.1|  p0 ribosomal protein-like protein                       481   3e-165   Genlisea aurea
ref|XP_003603496.1|  60S acidic ribosomal protein p0                    480   7e-165   Medicago truncatula
ref|XP_010256605.1|  PREDICTED: 60S acidic ribosomal protein P0         480   8e-165   Nelumbo nucifera [Indian lotus]
ref|XP_007157498.1|  hypothetical protein PHAVU_002G074600g             480   1e-164   Phaseolus vulgaris [French bean]
ref|XP_002526873.1|  60S acidic ribosomal protein P0, putative          479   1e-164   Ricinus communis
ref|XP_011072152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    479   2e-164   
ref|XP_010534676.1|  PREDICTED: 60S acidic ribosomal protein P0-like    479   2e-164   Tarenaya hassleriana [spider flower]
ref|XP_006848156.1|  PREDICTED: 60S acidic ribosomal protein P0         479   3e-164   Amborella trichopoda
gb|AFK39880.1|  unknown                                                 479   3e-164   Medicago truncatula
ref|XP_010067511.1|  PREDICTED: 60S acidic ribosomal protein P0         479   3e-164   Eucalyptus grandis [rose gum]
ref|XP_010247657.1|  PREDICTED: 60S acidic ribosomal protein P0-like    478   4e-164   Nelumbo nucifera [Indian lotus]
emb|CDP14047.1|  unnamed protein product                                478   4e-164   Coffea canephora [robusta coffee]
ref|XP_010554654.1|  PREDICTED: 60S acidic ribosomal protein P0         478   4e-164   Tarenaya hassleriana [spider flower]
ref|XP_007153264.1|  hypothetical protein PHAVU_003G020600g             478   6e-164   Phaseolus vulgaris [French bean]
gb|AGV54296.1|  60S acidic ribosomal protein P0                         478   6e-164   Phaseolus vulgaris [French bean]
gb|ADR71235.1|  60S acidic ribosomal protein P0A                        478   7e-164   Hevea brasiliensis [jebe]
ref|XP_011042597.1|  PREDICTED: 60S acidic ribosomal protein P0-like    477   1e-163   Populus euphratica
gb|ADR71236.1|  60S acidic ribosomal protein P0B                        477   1e-163   Hevea brasiliensis [jebe]
ref|XP_010486703.1|  PREDICTED: 60S acidic ribosomal protein P0-3       477   1e-163   Camelina sativa [gold-of-pleasure]
ref|XP_010486773.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    476   2e-163   Camelina sativa [gold-of-pleasure]
gb|ACJ84880.1|  unknown                                                 476   3e-163   Medicago truncatula
ref|XP_009791710.1|  PREDICTED: 60S acidic ribosomal protein P0         476   4e-163   Nicotiana sylvestris
ref|XP_003616595.1|  60S acidic ribosomal protein p0                    476   4e-163   Medicago truncatula
ref|XP_002882720.1|  60S acidic ribosomal protein P0                    476   4e-163   
ref|NP_187531.1|  60S acidic ribosomal protein P0-2                     475   5e-163   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE71263.1|  putative 60S acidic ribosomal protein P0               476   5e-163   Trifolium pratense [peavine clover]
gb|EYU18304.1|  hypothetical protein MIMGU_mgv1a010092mg                475   7e-163   Erythranthe guttata [common monkey flower]
ref|XP_006298124.1|  hypothetical protein CARUB_v10014186mg             475   8e-163   Capsella rubella
ref|XP_010464828.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    475   9e-163   Camelina sativa [gold-of-pleasure]
gb|KJB76158.1|  hypothetical protein B456_012G076000                    474   1e-162   Gossypium raimondii
gb|EYU43500.1|  hypothetical protein MIMGU_mgv1a010103mg                474   1e-162   Erythranthe guttata [common monkey flower]
ref|XP_002884720.1|  60S acidic ribosomal protein P0                    474   1e-162   Arabidopsis lyrata subsp. lyrata
ref|NP_187734.1|  60S acidic ribosomal protein P0-3                     474   2e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435697.1|  hypothetical protein CICLE_v10032141mg             474   2e-162   Citrus clementina [clementine]
ref|XP_007222847.1|  hypothetical protein PRUPE_ppa008800mg             474   2e-162   Prunus persica
gb|ABK95701.1|  unknown                                                 474   3e-162   Populus trichocarpa [western balsam poplar]
gb|KDO69054.1|  hypothetical protein CISIN_1g020952mg                   473   3e-162   Citrus sinensis [apfelsine]
ref|XP_009389889.1|  PREDICTED: 60S acidic ribosomal protein P0         473   4e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010469822.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    473   7e-162   Camelina sativa [gold-of-pleasure]
ref|XP_009399833.1|  PREDICTED: 60S acidic ribosomal protein P0-like    472   8e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312149.1|  60S acidic ribosomal protein P0-A                  473   8e-162   Populus trichocarpa [western balsam poplar]
gb|AFK46889.1|  unknown                                                 472   1e-161   Medicago truncatula
gb|AAM65265.1|  60S acidic ribosomal protein P0-C                       472   1e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298147.1|  hypothetical protein CARUB_v10014197mg             472   1e-161   Capsella rubella
gb|AAM63644.1|  putative 60S acidic ribosomal protein P0                472   1e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409427.1|  PREDICTED: 60S acidic ribosomal protein P0-like    472   1e-161   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY07906.1|  BnaC03g36170D                                          472   2e-161   Brassica napus [oilseed rape]
ref|XP_010464557.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    471   2e-161   Camelina sativa [gold-of-pleasure]
ref|XP_009608105.1|  PREDICTED: 60S acidic ribosomal protein P0         471   2e-161   Nicotiana tomentosiformis
ref|XP_011035984.1|  PREDICTED: 60S acidic ribosomal protein P0         471   2e-161   Populus euphratica
gb|AAF34767.1|AF227622_1  60S acidic ribosomal protein PO               471   2e-161   Euphorbia esula [wolf's milk]
gb|AFK38760.1|  unknown                                                 471   3e-161   Lotus japonicus
emb|CDY53103.1|  BnaCnng24330D                                          471   4e-161   Brassica napus [oilseed rape]
ref|XP_002315165.1|  60S acidic ribosomal protein P0-A                  470   5e-161   
ref|XP_011084927.1|  PREDICTED: 60S acidic ribosomal protein P0-like    470   7e-161   Sesamum indicum [beniseed]
ref|XP_004239781.1|  PREDICTED: 60S acidic ribosomal protein P0         470   8e-161   Solanum lycopersicum
ref|XP_010486480.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    470   9e-161   Camelina sativa [gold-of-pleasure]
gb|KFK38515.1|  hypothetical protein AALP_AA3G123100                    469   1e-160   Arabis alpina [alpine rockcress]
gb|ABK94988.1|  unknown                                                 469   1e-160   Populus trichocarpa [western balsam poplar]
ref|XP_009344598.1|  PREDICTED: 60S acidic ribosomal protein P0         469   2e-160   Pyrus x bretschneideri [bai li]
ref|XP_006407706.1|  hypothetical protein EUTSA_v10021147mg             469   2e-160   Eutrema salsugineum [saltwater cress]
emb|CDX73962.1|  BnaA03g30850D                                          469   2e-160   
ref|XP_009619762.1|  PREDICTED: 60S acidic ribosomal protein P0-like    469   2e-160   Nicotiana tomentosiformis
ref|XP_009146942.1|  PREDICTED: 60S acidic ribosomal protein P0-2       469   2e-160   Brassica rapa
gb|EYU43501.1|  hypothetical protein MIMGU_mgv1a010103mg                469   2e-160   Erythranthe guttata [common monkey flower]
ref|XP_010095082.1|  60S acidic ribosomal protein P0                    468   4e-160   Morus notabilis
ref|XP_009135066.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    468   4e-160   Brassica rapa
ref|XP_008392940.1|  PREDICTED: 60S acidic ribosomal protein P0         468   5e-160   Malus domestica [apple tree]
ref|XP_009350848.1|  PREDICTED: 60S acidic ribosomal protein P0-like    468   5e-160   Pyrus x bretschneideri [bai li]
ref|XP_009764939.1|  PREDICTED: 60S acidic ribosomal protein P0-like    468   6e-160   Nicotiana sylvestris
ref|XP_010689885.1|  PREDICTED: 60S acidic ribosomal protein P0         468   7e-160   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009123454.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    468   8e-160   Brassica rapa
gb|KHN36391.1|  60S acidic ribosomal protein P0                         467   9e-160   Glycine soja [wild soybean]
ref|XP_010941551.1|  PREDICTED: 60S acidic ribosomal protein P0         467   9e-160   Elaeis guineensis
ref|XP_008360784.1|  PREDICTED: 60S acidic ribosomal protein P0         467   1e-159   Malus domestica [apple tree]
ref|NP_001275012.1|  60S acidic ribosomal protein P0-like               466   2e-159   Solanum tuberosum [potatoes]
gb|KHN34735.1|  60S acidic ribosomal protein P0                         465   7e-159   Glycine soja [wild soybean]
ref|XP_004145258.1|  PREDICTED: 60S acidic ribosomal protein P0-like    465   7e-159   Cucumis sativus [cucumbers]
ref|XP_006411245.1|  hypothetical protein EUTSA_v10016954mg             464   8e-159   Eutrema salsugineum [saltwater cress]
gb|KFK38306.1|  hypothetical protein AALP_AA3G096900                    464   1e-158   Arabis alpina [alpine rockcress]
ref|XP_007016138.1|  Ribosomal protein L10 family protein               463   4e-158   
ref|XP_010926952.1|  PREDICTED: 60S acidic ribosomal protein P0         463   4e-158   Elaeis guineensis
gb|KFK36893.1|  hypothetical protein AALP_AA4G185700                    463   4e-158   Arabis alpina [alpine rockcress]
gb|KDO69055.1|  hypothetical protein CISIN_1g020952mg                   462   5e-158   Citrus sinensis [apfelsine]
ref|XP_003538454.1|  PREDICTED: 60S acidic ribosomal protein P0-like    462   6e-158   Glycine max [soybeans]
ref|XP_004247949.1|  PREDICTED: 60S acidic ribosomal protein P0-like    462   7e-158   Solanum lycopersicum
ref|XP_008799093.1|  PREDICTED: 60S acidic ribosomal protein P0         462   7e-158   Phoenix dactylifera
ref|XP_007163525.1|  hypothetical protein PHAVU_001G241400g             462   8e-158   Phaseolus vulgaris [French bean]
ref|XP_002525622.1|  60S acidic ribosomal protein P0, putative          462   1e-157   Ricinus communis
ref|NP_181530.1|  60S acidic ribosomal protein P0-1                     461   2e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006360336.1|  PREDICTED: 60S acidic ribosomal protein P0-like    461   3e-157   Solanum tuberosum [potatoes]
emb|CDP16385.1|  unnamed protein product                                461   3e-157   Coffea canephora [robusta coffee]
gb|AID52928.1|  60S acidic ribosomal protein P0                         460   6e-157   Carthamus tinctorius
ref|XP_002881693.1|  60S acidic ribosomal protein P0                    459   2e-156   
emb|CDY24932.1|  BnaC03g22400D                                          458   3e-156   Brassica napus [oilseed rape]
ref|XP_010508934.1|  PREDICTED: 60S acidic ribosomal protein P0-1       457   1e-155   Camelina sativa [gold-of-pleasure]
ref|XP_008457380.1|  PREDICTED: 60S acidic ribosomal protein P0-like    456   1e-155   Cucumis melo [Oriental melon]
emb|CDY60988.1|  BnaA03g56530D                                          456   3e-155   Brassica napus [oilseed rape]
ref|XP_010517390.1|  PREDICTED: 60S acidic ribosomal protein P0-1...    455   4e-155   Camelina sativa [gold-of-pleasure]
ref|XP_009133397.1|  PREDICTED: 60S acidic ribosomal protein P0-1       454   8e-155   Brassica rapa
ref|XP_004307622.1|  PREDICTED: 60S acidic ribosomal protein P0         454   1e-154   Fragaria vesca subsp. vesca
ref|XP_002440235.1|  hypothetical protein SORBIDRAFT_09g028230          454   1e-154   Sorghum bicolor [broomcorn]
ref|XP_004307662.1|  PREDICTED: 60S acidic ribosomal protein P0         452   4e-154   Fragaria vesca subsp. vesca
ref|NP_001060923.1|  Os08g0130500                                       450   5e-153   
ref|XP_006659092.1|  PREDICTED: 60S acidic ribosomal protein P0-like    449   9e-153   Oryza brachyantha
gb|ABA95724.1|  60S acidic ribosomal protein P0, putative, expressed    449   1e-152   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91328.1|  60S acidic ribosomal protein P0, putative, expressed    449   1e-152   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82182.1|  hypothetical protein OsI_37384                          449   1e-152   Oryza sativa Indica Group [Indian rice]
ref|XP_004287422.1|  PREDICTED: 60S acidic ribosomal protein P0-like    444   9e-151   Fragaria vesca subsp. vesca
ref|XP_006296009.1|  hypothetical protein CARUB_v10025153mg             444   1e-150   Capsella rubella
emb|CBX25428.1|  hypothetical_protein                                   444   1e-150   Oryza glaberrima
gb|KJB19895.1|  hypothetical protein B456_003G123400                    443   3e-150   Gossypium raimondii
ref|XP_012067847.1|  PREDICTED: 60S acidic ribosomal protein P0-like    440   4e-149   Jatropha curcas
ref|XP_009799989.1|  PREDICTED: 60S acidic ribosomal protein P0-like    439   7e-149   Nicotiana sylvestris
ref|XP_010234277.1|  PREDICTED: 60S acidic ribosomal protein P0         438   3e-148   Brachypodium distachyon [annual false brome]
gb|KDO69056.1|  hypothetical protein CISIN_1g036252mg                   437   5e-148   Citrus sinensis [apfelsine]
ref|XP_006435696.1|  hypothetical protein CICLE_v10033862mg             437   5e-148   Citrus clementina [clementine]
ref|XP_004241171.1|  PREDICTED: 60S acidic ribosomal protein P0-like    436   1e-147   Solanum lycopersicum
dbj|BAJ92405.1|  predicted protein                                      436   2e-147   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009592351.1|  PREDICTED: 60S acidic ribosomal protein P0-like    436   2e-147   Nicotiana tomentosiformis
gb|ACL52455.1|  unknown                                                 436   2e-147   Zea mays [maize]
ref|NP_001141489.1|  hypothetical protein                               436   2e-147   Zea mays [maize]
ref|XP_001759592.1|  predicted protein                                  436   2e-147   
gb|EMT17099.1|  60S acidic ribosomal protein P0                         436   2e-147   
sp|P50345.1|RLA0_LUPLU  RecName: Full=60S acidic ribosomal protei...    435   3e-147   Lupinus luteus
ref|XP_001759851.1|  predicted protein                                  435   4e-147   
gb|EMT02739.1|  60S acidic ribosomal protein P0                         435   4e-147   
dbj|BAJ94456.1|  predicted protein                                      434   7e-147   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF83717.1|  unknown                                                 434   1e-146   Zea mays [maize]
ref|NP_001105482.1|  60S acidic ribosomal protein P0                    434   1e-146   Zea mays [maize]
ref|XP_002445000.1|  hypothetical protein SORBIDRAFT_07g002560          432   5e-146   Sorghum bicolor [broomcorn]
ref|XP_004972933.1|  PREDICTED: 60S acidic ribosomal protein P0-like    432   5e-146   Setaria italica
gb|ADU04571.1|  60S acidic ribosomal protein PO                         432   7e-146   Phaseolus vulgaris [French bean]
ref|XP_004958562.1|  PREDICTED: 60S acidic ribosomal protein P0-like    430   3e-145   Setaria italica
ref|XP_006350830.1|  PREDICTED: 60S acidic ribosomal protein P0-like    430   3e-145   Solanum tuberosum [potatoes]
emb|CBI25508.3|  unnamed protein product                                428   5e-145   Vitis vinifera
emb|CBI31491.3|  unnamed protein product                                427   1e-144   Vitis vinifera
emb|CAN76468.1|  hypothetical protein VITISV_030042                     426   8e-144   Vitis vinifera
ref|XP_004296403.1|  PREDICTED: 60S acidic ribosomal protein P0-like    419   5e-141   Fragaria vesca subsp. vesca
ref|XP_003573632.1|  PREDICTED: 60S acidic ribosomal protein P0-like    416   1e-139   Brachypodium distachyon [annual false brome]
ref|XP_006407705.1|  hypothetical protein EUTSA_v10021147mg             413   9e-139   
ref|XP_002983859.1|  hypothetical protein SELMODRAFT_268802             412   6e-138   Selaginella moellendorffii
ref|XP_002974292.1|  hypothetical protein SELMODRAFT_149765             410   1e-137   Selaginella moellendorffii
ref|XP_002960810.1|  hypothetical protein SELMODRAFT_437282             409   4e-137   Selaginella moellendorffii
ref|XP_010685586.1|  PREDICTED: 60S acidic ribosomal protein P0         405   2e-135   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN65663.1|  hypothetical protein VITISV_014917                     405   2e-134   Vitis vinifera
ref|NP_001078125.1|  60S acidic ribosomal protein P0-2                  399   1e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002967451.1|  hypothetical protein SELMODRAFT_87354              399   4e-133   Selaginella moellendorffii
ref|XP_002960261.1|  hypothetical protein SELMODRAFT_229877             399   5e-133   Selaginella moellendorffii
sp|P29764.1|RLA0_OXYRB  RecName: Full=60S acidic ribosomal protei...    394   8e-131   Oxybasis rubra [pigweed]
gb|AIN39821.1|  hypothetical protein                                    377   2e-125   Zoysia matrella [Japanese carpet grass]
gb|KJB74260.1|  hypothetical protein B456_011G283700                    377   3e-125   Gossypium raimondii
gb|KCW65655.1|  hypothetical protein EUGRSUZ_G03042                     371   9e-123   Eucalyptus grandis [rose gum]
gb|ABO31368.1|  60S ribosomal protein                                   364   8e-121   Gossypium hirsutum [American cotton]
emb|CDP06275.1|  unnamed protein product                                357   2e-117   Coffea canephora [robusta coffee]
gb|ADE76171.1|  unknown                                                 351   6e-115   Picea sitchensis
dbj|BAC10912.1|  putative 60S acidic ribosomal protein P0               344   2e-113   Zinnia elegans [garden zinnia]
ref|XP_005850392.1|  hypothetical protein CHLNCDRAFT_59607              348   4e-113   Chlorella variabilis
gb|KDD72928.1|  hypothetical protein H632_c2720p0                       335   9e-109   Helicosporidium sp. ATCC 50920
gb|EYU43502.1|  hypothetical protein MIMGU_mgv1a010103mg                333   3e-108   Erythranthe guttata [common monkey flower]
ref|XP_005650079.1|  hypothetical protein COCSUDRAFT_52908              335   4e-108   Coccomyxa subellipsoidea C-169
ref|XP_011402179.1|  60S acidic ribosomal protein P0-2                  328   5e-106   Auxenochlorella protothecoides
gb|KCW65657.1|  hypothetical protein EUGRSUZ_G03042                     321   1e-104   Eucalyptus grandis [rose gum]
gb|EMS52841.1|  60S acidic ribosomal protein P0                         322   6e-104   Triticum urartu
ref|XP_002279500.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    322   3e-103   Vitis vinifera
emb|CBV76074.1|  60S acidic ribosomal protein P0                        319   5e-102   Polytomella sp. Pringsheim 198.80
gb|AFW74478.1|  hypothetical protein ZEAMMB73_076912                    315   7e-102   
gb|AAD56335.1|AC009326_22  putative 60S acidic ribosomal protein,...    316   8e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KIZ02211.1|  60S acidic ribosomal protein P0                         316   1e-100   Monoraphidium neglectum
gb|ABR26209.1|  60S acidic ribosomal protein p0                         310   1e-99    Oryza sativa Indica Group [Indian rice]
gb|KHG01938.1|  60S acidic ribosomal P0-2 -like protein                 310   3e-99    Gossypium arboreum [tree cotton]
gb|KHG21849.1|  60S acidic ribosomal P0-2 -like protein                 309   3e-99    Gossypium arboreum [tree cotton]
ref|XP_001697060.1|  acidic ribosomal protein P0                        307   4e-97    Chlamydomonas reinhardtii
ref|XP_002958097.1|  hypothetical protein VOLCADRAFT_84328              303   2e-95    Volvox carteri f. nagariensis
sp|Q9DG68.1|RLA0_RANSY  RecName: Full=60S acidic ribosomal protei...    300   1e-94    Rana sylvatica
ref|XP_006612127.1|  PREDICTED: 60S acidic ribosomal protein P0-like    299   5e-94    Apis dorsata [rock honeybee]
ref|XP_623106.1|  PREDICTED: 60S acidic ribosomal protein P0 isof...    299   5e-94    Apis mellifera [bee]
ref|XP_011157010.1|  PREDICTED: 60S acidic ribosomal protein P0         299   5e-94    Solenopsis invicta [imported red fire ant]
gb|AJQ18907.1|  acidic ribosomal protein P0                             299   6e-94    Amblyomma cajennense
ref|XP_011146226.1|  PREDICTED: 60S acidic ribosomal protein P0-like    298   6e-94    Harpegnathos saltator
ref|XP_003398378.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    298   1e-93    Bombus terrestris [large earth bumblebee]
ref|XP_011266937.1|  PREDICTED: 60S acidic ribosomal protein P0         298   1e-93    Camponotus floridanus
ref|XP_003488353.1|  PREDICTED: 60S acidic ribosomal protein P0-like    297   2e-93    Bombus impatiens
gb|ABM55512.1|  putative ribosomal protein P0                           296   4e-93    Maconellicoccus hirsutus [pink hibiscus mealybug]
ref|NP_001080134.1|  ribosomal protein, large, P0                       296   6e-93    Xenopus laevis [clawed frog]
gb|AAY66850.1|  60S acidic ribosomal protein P0                         296   7e-93    Ixodes scapularis [blacklegged tick]
ref|XP_002399611.1|  60S acidic ribosomal protein P0, putative          296   7e-93    Ixodes scapularis [blacklegged tick]
ref|XP_001985147.1|  GH14667                                            296   9e-93    Drosophila grimshawi
ref|NP_989067.1|  ribosomal protein, large, P0                          295   1e-92    Xenopus tropicalis [western clawed frog]
gb|AGQ49465.1|  acidic ribosomal protein P0                             295   1e-92    Rhipicephalus microplus [cattle tick]
gb|ABV60317.1|  60S acidic ribosomal protein P0-like protein            295   1e-92    Lutzomyia longipalpis
ref|XP_011700188.1|  PREDICTED: 60S acidic ribosomal protein P0         295   2e-92    Wasmannia auropunctata
ref|XP_001958489.1|  GF10946                                            295   2e-92    Drosophila ananassae
gb|AEL28833.1|  ribosomal protein P0                                    295   2e-92    Heliconius melpomene cythera
dbj|BAN20115.1|  ribosomal protein LP0                                  295   2e-92    Riptortus pedestris
ref|XP_011146290.1|  PREDICTED: 60S acidic ribosomal protein P0-like    294   3e-92    Harpegnathos saltator
ref|XP_011208099.1|  PREDICTED: 60S acidic ribosomal protein P0         294   3e-92    Bactrocera dorsalis [papaya fruit fly]
ref|XP_011496436.1|  PREDICTED: 60S acidic ribosomal protein P0         294   3e-92    Ceratosolen solmsi marchali
dbj|BAM18929.1|  ribosomal protein LP0                                  294   3e-92    Papilio polytes
gb|ADV40160.1|  60S acidic ribosomal protein P0                         293   4e-92    Latrodectus hesperus [black widow]
ref|XP_001352888.1|  GA20389                                            294   4e-92    Drosophila pseudoobscura pseudoobscura
gb|AAL62465.1|  60S acidic ribosomal protein P0                         294   4e-92    Spodoptera frugiperda
ref|XP_004522331.1|  PREDICTED: 60S acidic ribosomal protein P0-like    294   4e-92    Ceratitis capitata [medfly]
ref|XP_002068394.1|  GK20443                                            294   4e-92    
emb|CAD29995.1|  ribosomal P0 protein                                   294   4e-92    Bombyx mori [silk moth]
ref|NP_001037123.1|  ribosomal protein P0                               294   4e-92    Bombyx mori [silk moth]
ref|XP_011196704.1|  PREDICTED: 60S acidic ribosomal protein P0         294   4e-92    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011629802.1|  PREDICTED: 60S acidic ribosomal protein P0-like    294   5e-92    Pogonomyrmex barbatus
gb|ABW16870.1|  ribosomal protein P0                                    294   5e-92    Haemaphysalis longicornis
gb|ELT92567.1|  hypothetical protein CAPTEDRAFT_167366                  293   6e-92    Capitella teleta
gb|AIW62441.1|  60S acidic ribosomal protein                            293   6e-92    Scytodes thoracica
ref|XP_008544624.1|  PREDICTED: 60S acidic ribosomal protein P0         293   6e-92    Microplitis demolitor
gb|EHJ75936.1|  ribosomal protein P0                                    293   6e-92    
ref|XP_001973718.1|  GG16244                                            293   7e-92    Drosophila erecta
ref|XP_011297993.1|  PREDICTED: 60S acidic ribosomal protein P0         293   7e-92    Fopius arisanus
ref|XP_011347099.1|  PREDICTED: 60S acidic ribosomal protein P0         293   8e-92    Ooceraea biroi
ref|XP_003743791.1|  PREDICTED: 60S acidic ribosomal protein P0-like    293   8e-92    Galendromus occidentalis
ref|NP_524211.1|  ribosomal protein LP0, isoform A                      293   1e-91    Drosophila melanogaster
gb|AJQ18906.1|  acidic ribosomal protein P0                             293   1e-91    Rhipicephalus sanguineus
ref|XP_002040897.1|  GM22429                                            293   1e-91    Drosophila sechellia
ref|XP_002095795.1|  RpLP0                                              292   1e-91    Drosophila yakuba
gb|AJQ18908.1|  acidic ribosomal protein P0                             292   2e-91    Dermacentor nitens
gb|KDR14762.1|  60S acidic ribosomal protein P0                         292   2e-91    Zootermopsis nevadensis
gb|EYU19990.1|  hypothetical protein MIMGU_mgv1a0100892mg               288   2e-91    Erythranthe guttata [common monkey flower]
gb|ACY95307.1|  ribosomal protein P0                                    291   3e-91    Manduca sexta [Carolina sphinx]
ref|XP_011871965.1|  PREDICTED: 60S acidic ribosomal protein P0         291   3e-91    Vollenhovia emeryi
ref|XP_001607606.1|  PREDICTED: 60S acidic ribosomal protein P0         291   4e-91    Nasonia vitripennis
ref|XP_003706895.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    291   4e-91    Megachile rotundata
ref|XP_012058112.1|  PREDICTED: 60S acidic ribosomal protein P0         291   4e-91    Atta cephalotes
ref|XP_011064775.1|  PREDICTED: 60S acidic ribosomal protein P0         291   4e-91    Acromyrmex echinatior
dbj|BAM17678.1|  ribosomal protein LP0                                  291   4e-91    Papilio xuthus [Chinese swallowtail]
gb|AFM87759.1|  ribosomal protein, large, P0                            291   4e-91    Callorhinchus milii [Australian ghost shark]
emb|CBM69268.1|  venom protein Ci-40b                                   291   4e-91    Chelonus inanitus
gb|AAI51696.1|  RPLP0 protein                                           291   5e-91    Bos taurus [bovine]
gb|AEE62116.1|  unknown                                                 291   6e-91    Dendroctonus ponderosae
ref|XP_011633765.1|  PREDICTED: 60S acidic ribosomal protein P0-like    290   9e-91    Pogonomyrmex barbatus
ref|XP_313349.1|  AGAP003592-PA                                         290   1e-90    Anopheles gambiae str. PEST
gb|ADT80652.1|  ribosomal protein P0                                    290   1e-90    Euphydryas aurinia [marsh fritillary]
ref|XP_011415179.1|  PREDICTED: 60S acidic ribosomal protein P0-like    289   2e-90    Crassostrea gigas
ref|XP_001851128.1|  60S acidic ribosomal protein P0                    289   3e-90    Culex quinquefasciatus
ref|XP_002425010.1|  ribosomal P0 protein, putative                     289   3e-90    Pediculus humanus corporis [human body lice]
gb|AAU84931.1|  putative acidic p0 ribosomal protein                    289   3e-90    Aphis citricidus
gb|AFM88893.1|  ribosomal protein, large, P0                            289   3e-90    Callorhinchus milii [Australian ghost shark]
gb|AFM89484.1|  ribosomal protein, large, P0                            289   4e-90    Callorhinchus milii [Australian ghost shark]
ref|XP_005987234.1|  PREDICTED: 60S acidic ribosomal protein P0         289   4e-90    Latimeria chalumnae
gb|AAF31449.1|AF220939_1  60S acidic ribosomal protein P0               288   5e-90    Sarcophaga crassipalpis
gb|AFM89472.1|  ribosomal protein, large, P0                            288   5e-90    Callorhinchus milii [Australian ghost shark]
ref|XP_005187209.1|  PREDICTED: 60S acidic ribosomal protein P0         288   5e-90    Musca domestica
gb|AFM85484.1|  ribosomal protein, large, P0                            288   6e-90    Callorhinchus milii [Australian ghost shark]
gb|AFM86948.1|  ribosomal protein, large, P0                            288   6e-90    Callorhinchus milii [Australian ghost shark]
gb|AFM85775.1|  ribosomal protein, large, P0                            288   6e-90    Callorhinchus milii [Australian ghost shark]
gb|AFM86446.1|  ribosomal protein, large, P0                            288   7e-90    Callorhinchus milii [Australian ghost shark]
gb|ETN64428.1|  60S acidic ribosomal protein P0                         288   8e-90    Anopheles darlingi [American malaria mosquito]
gb|AFM85937.1|  ribosomal protein, large, P0                            288   8e-90    Callorhinchus milii [Australian ghost shark]
gb|AFM90832.1|  ribosomal protein, large, P0                            288   8e-90    Callorhinchus milii [Australian ghost shark]
ref|XP_005107960.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    288   9e-90    Aplysia californica
ref|NP_001119687.1|  ribosomal protein LP0                              288   1e-89    Acyrthosiphon pisum
ref|XP_002047707.1|  GJ13582                                            288   1e-89    Drosophila virilis
ref|XP_002008961.1|  GI13777                                            288   1e-89    
gb|AFM87081.1|  ribosomal protein, large, P0                            288   1e-89    
gb|AEE61707.1|  unknown                                                 288   1e-89    
gb|AFM89459.1|  ribosomal protein, large, P0                            287   1e-89    
gb|AFD93397.1|  ribosomal protein P0                                    287   1e-89    
gb|AFD93398.1|  ribosomal protein P0                                    287   1e-89    
gb|EFX74249.1|  hypothetical protein DAPPUDRAFT_307348                  287   2e-89    
gb|AFD93389.1|  ribosomal protein P0                                    287   2e-89    
gb|ACQ57902.1|  60S acidic ribosomal protein P0                         287   2e-89    
dbj|BAH70543.1|  ACYPI000079                                            287   2e-89    
ref|XP_975936.1|  PREDICTED: 60S acidic ribosomal protein P0            287   2e-89    
ref|XP_012149223.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    291   2e-89    
gb|AFM86828.1|  ribosomal protein, large, P0                            287   2e-89    
gb|AFM89518.1|  ribosomal protein, large, P0                            287   2e-89    
gb|AFM86675.1|  ribosomal protein, large, P0                            287   2e-89    
gb|AFM86580.1|  ribosomal protein, large, P0                            286   2e-89    
gb|AFM87342.1|  ribosomal protein, large, P0                            286   2e-89    
gb|AFM85590.1|  ribosomal protein, large, P0                            286   2e-89    
ref|XP_006640161.1|  PREDICTED: 60S acidic ribosomal protein P0-like    286   3e-89    
gb|AFM86570.1|  ribosomal protein, large, P0                            286   3e-89    
ref|XP_001655016.1|  AAEL010821-PA                                      286   4e-89    
gb|AFM86528.1|  ribosomal protein, large, P0                            286   4e-89    
ref|NP_001187030.1|  60S acidic ribosomal protein P0                    286   4e-89    
ref|XP_011555667.1|  PREDICTED: 60S acidic ribosomal protein P0         286   5e-89    
emb|CBI15980.3|  unnamed protein product                                283   6e-89    
ref|XP_002505583.1|  predicted protein                                  285   6e-89    
gb|AFM86819.1|  ribosomal protein, large, P0                            285   8e-89    
emb|CAH04311.1|  acidic p0 ribosomal protein                            285   9e-89    
gb|AFM87161.1|  ribosomal protein, large, P0                            285   9e-89    
gb|AFM86966.1|  ribosomal protein, large, P0                            285   1e-88    
ref|XP_006784596.1|  PREDICTED: 60S acidic ribosomal protein P0-like    285   1e-88    
ref|NP_001279963.1|  ribosomal protein, large, P0                       285   1e-88    
ref|XP_008151673.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    285   1e-88    
ref|XP_002597893.1|  hypothetical protein BRAFLDRAFT_97880              285   1e-88    
ref|XP_010740438.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    285   2e-88    
gb|AFM88521.1|  ribosomal protein, large, P0                            285   2e-88    
gb|ABF69531.1|  acidic ribosomal protein P0                             284   2e-88    
ref|XP_008292997.1|  PREDICTED: 60S acidic ribosomal protein P0         284   2e-88    
ref|XP_008779152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    281   2e-88    
gb|KFQ10333.1|  60S acidic ribosomal protein P0                         283   3e-88    
dbj|BAF98695.1|  ribosomal protein LP0                                  284   3e-88    
gb|KFO65132.1|  60S acidic ribosomal protein P0                         283   3e-88    
ref|XP_008639852.1|  PREDICTED: 60S acidic ribosomal protein P0         283   3e-88    
ref|XP_007434308.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    284   3e-88    
dbj|BAH70537.1|  ACYPI000079                                            284   3e-88    
gb|AFM85706.1|  ribosomal protein, large, P0                            284   3e-88    
ref|XP_008501040.1|  PREDICTED: 60S acidic ribosomal protein P0         284   4e-88    
ref|XP_010396743.1|  PREDICTED: 60S acidic ribosomal protein P0         283   4e-88    
gb|ABU63975.1|  ribosomal protein large P0-like protein                 283   6e-88    
emb|CAH04310.1|  acidic p0 ribosomal protein                            283   6e-88    
gb|KHN76000.1|  60S acidic ribosomal protein P0                         283   6e-88    
gb|ADD21620.1|  ribosomal protein P0                                    281   6e-88    
gb|AFM86008.1|  ribosomal protein, large, P0                            283   7e-88    
gb|AAM97779.1|  ribosomal protein P0                                    283   7e-88    
ref|XP_005054917.1|  PREDICTED: 60S acidic ribosomal protein P0         283   1e-87    
ref|XP_008924020.1|  PREDICTED: 60S acidic ribosomal protein P0         282   1e-87    
ref|XP_002199561.1|  PREDICTED: 60S acidic ribosomal protein P0         282   1e-87    
ref|XP_005524479.1|  PREDICTED: 60S acidic ribosomal protein P0         282   1e-87    
ref|XP_005493516.1|  PREDICTED: 60S acidic ribosomal protein P0         282   1e-87    
gb|AHB33743.1|  60S acidic ribosomal protein P0                         282   2e-87    
ref|XP_010572856.1|  PREDICTED: 60S acidic ribosomal protein P0         282   2e-87    
gb|AFK10546.1|  ribosomal protein, large, P0                            282   2e-87    
emb|CEG01946.1|  Ribosomal protein L10/acidic P0                        281   2e-87    
gb|EYC13195.1|  hypothetical protein Y032_0044g1026                     282   2e-87    
ref|XP_011590977.1|  PREDICTED: 60S acidic ribosomal protein P0         282   2e-87    
gb|AAT44430.1|  ribosomal protein large P0-like protein                 281   2e-87    
ref|XP_010879645.1|  PREDICTED: 60S acidic ribosomal protein P0         281   2e-87    
gb|ACH70801.1|  acidic ribosomal protein P0                             281   2e-87    
ref|XP_009440587.1|  PREDICTED: 60S acidic ribosomal protein P0-like    281   3e-87    
emb|CDY67524.1|  BnaAnng24540D                                          278   3e-87    
ref|XP_009948467.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    281   3e-87    
ref|XP_008318611.1|  PREDICTED: 60S acidic ribosomal protein P0         281   3e-87    
ref|XP_009045933.1|  hypothetical protein LOTGIDRAFT_237709             281   3e-87    
gb|ADD21618.1|  ribosomal protein P0                                    281   3e-87    
gb|KFH71275.1|  large subunit ribosomal protein LP0                     281   3e-87    
gb|AEA51110.1|  60S acidic ribosomal protein P0                         280   4e-87    
ref|NP_571655.2|  60S acidic ribosomal protein P0                       281   4e-87    
emb|CDQ67134.1|  unnamed protein product                                281   5e-87    
gb|ACI68961.1|  60S acidic ribosomal protein P0                         281   5e-87    
ref|XP_001897742.1|  60S acidic ribosomal protein P0                    281   5e-87    
emb|CAA33199.1|  unnamed protein product                                281   6e-87    
emb|CDQ63253.1|  unnamed protein product                                280   7e-87    
ref|XP_009685789.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    280   7e-87    
ref|XP_005918671.1|  PREDICTED: 60S acidic ribosomal protein P0-like    280   8e-87    
ref|XP_004545259.1|  PREDICTED: 60S acidic ribosomal protein P0-like    280   8e-87    
ref|XP_003441603.1|  PREDICTED: 60S acidic ribosomal protein P0         280   8e-87    
ref|XP_003226041.1|  PREDICTED: 60S acidic ribosomal protein P0         280   9e-87    
ref|XP_006129131.1|  PREDICTED: 60S acidic ribosomal protein P0         280   1e-86    
gb|AHK09711.1|  60S acidic ribosomal protein P0                         280   1e-86    
ref|XP_004591942.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    280   1e-86    
gb|ADF97607.1|  large ribosomal protein P0                              280   1e-86    
ref|XP_009886897.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    280   2e-86    
ref|XP_001363537.1|  PREDICTED: 60S acidic ribosomal protein P0         279   2e-86    
ref|XP_001626294.1|  predicted protein                                  279   2e-86    
ref|XP_010602365.1|  PREDICTED: 60S acidic ribosomal protein P0         279   2e-86    
ref|XP_006019892.1|  PREDICTED: 60S acidic ribosomal protein P0         279   2e-86    
ref|XP_004636304.1|  PREDICTED: 60S acidic ribosomal protein P0         279   2e-86    
gb|AAH49058.1|  Rplp0 protein                                           279   2e-86    
ref|XP_008407632.1|  PREDICTED: 60S acidic ribosomal protein P0         279   2e-86    
ref|XP_004888210.1|  PREDICTED: 60S acidic ribosomal protein P0         279   3e-86    
emb|CAQ63458.1|  ribosomal protein                                      279   3e-86    
ref|XP_010967878.1|  PREDICTED: 60S acidic ribosomal protein P0         279   3e-86    
ref|XP_007554302.1|  PREDICTED: 60S acidic ribosomal protein P0         279   3e-86    
ref|XP_008468123.1|  PREDICTED: 60S acidic ribosomal protein P0         279   3e-86    
ref|NP_001239066.1|  ribosomal protein, large, P0                       279   3e-86    
ref|XP_004429976.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    279   3e-86    
ref|NP_990318.1|  60S acidic ribosomal protein P0                       279   3e-86    
ref|XP_010996948.1|  PREDICTED: 60S acidic ribosomal protein P0         279   3e-86    
ref|XP_008838692.1|  PREDICTED: 60S acidic ribosomal protein P0         279   3e-86    
ref|XP_005876332.1|  PREDICTED: 60S acidic ribosomal protein P0-like    278   3e-86    
ref|XP_006192755.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    279   3e-86    
gb|AHK09710.1|  60S acidic ribosomal protein P0                         277   4e-86    
ref|XP_005288756.1|  PREDICTED: 60S acidic ribosomal protein P0         278   4e-86    
ref|NP_001092068.1|  60S acidic ribosomal protein P0                    278   4e-86    
ref|XP_005962035.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    278   4e-86    
ref|XP_003478429.1|  PREDICTED: 60S acidic ribosomal protein P0         278   4e-86    
ref|XP_003789970.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    278   4e-86    
ref|XP_006053033.1|  PREDICTED: 60S acidic ribosomal protein P0         278   5e-86    
gb|KFZ54738.1|  60S acidic ribosomal protein P0                         276   5e-86    
gb|AHW68491.1|  60S acidic ribosomal protein P0                         277   5e-86    
ref|NP_000993.1|  60S acidic ribosomal protein P0                       278   5e-86    
ref|XP_006204865.1|  PREDICTED: 60S acidic ribosomal protein P0         278   6e-86    
gb|EHH21238.1|  hypothetical protein EGK_04254                          277   6e-86    
gb|KHJ98883.1|  ribosomal protein L10                                   284   6e-86    
gb|AIS76467.1|  large ribosomal protein P0                              278   6e-86    
gb|AAI02075.1|  Ribosomal protein, large, P0                            278   7e-86    
ref|NP_001182357.1|  acidic ribosomal phosphoprotein PO                 278   7e-86    
ref|NP_001012700.1|  60S acidic ribosomal protein P0                    278   7e-86    
gb|ACO14779.1|  60S acidic ribosomal protein P0                         278   7e-86    
ref|XP_003763170.1|  PREDICTED: 60S acidic ribosomal protein P0-like    278   7e-86    
ref|XP_001422456.1|  Cytosolic 80S ribosomal protein P0; Cytosoli...    278   8e-86    
ref|XP_005863834.1|  PREDICTED: 60S acidic ribosomal protein P0         278   9e-86    
ref|XP_001115939.2|  PREDICTED: 60S acidic ribosomal protein P0-like    276   9e-86    
ref|XP_005336874.1|  PREDICTED: 60S acidic ribosomal protein P0         277   1e-85    
ref|XP_008582193.1|  PREDICTED: 60S acidic ribosomal protein P0         277   1e-85    
ref|XP_007513516.1|  60S acidic ribosomal protein P0                    277   1e-85    
gb|AAH03833.1|  Ribosomal protein, large, P0                            277   1e-85    
gb|EPZ33240.1|  Ribosomal protein L10/acidic P0 domain-containing...    277   1e-85    
dbj|BAD96188.1|  ribosomal protein P0 variant                           277   1e-85    
gb|ABZ04250.1|  ribosomal protein rplp0                                 277   1e-85    
ref|XP_010366585.1|  PREDICTED: 60S acidic ribosomal protein P0         277   1e-85    
gb|KJH46927.1|  ribosomal protein L10                                   277   1e-85    
gb|AAH01127.1|  Ribosomal protein, large, P0                            277   1e-85    
ref|XP_005798004.1|  PREDICTED: 60S acidic ribosomal protein P0-like    277   1e-85    
gb|KFQ53080.1|  60S acidic ribosomal protein P0                         275   2e-85    
ref|XP_004996745.1|  arbp-prov protein                                  276   2e-85    
ref|XP_004664195.1|  PREDICTED: 60S acidic ribosomal protein P0         277   2e-85    
gb|ETN75251.1|  ribosomal protein L10                                   283   2e-85    
ref|XP_003135972.1|  60S acidic ribosomal protein P0                    277   2e-85    
ref|XP_005344377.1|  PREDICTED: 60S acidic ribosomal protein P0         276   2e-85    
ref|XP_005421617.1|  PREDICTED: 60S acidic ribosomal protein P0         276   2e-85    
ref|XP_004017462.2|  PREDICTED: 60S acidic ribosomal protein P0 i...    276   3e-85    
ref|XP_005396575.1|  PREDICTED: 60S acidic ribosomal protein P0         276   3e-85    
ref|XP_010177042.1|  PREDICTED: 60S acidic ribosomal protein P0         276   3e-85    
ref|XP_004611130.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    276   3e-85    
gb|ADD21619.1|  ribosomal protein P0                                    275   3e-85    
gb|ACO09070.1|  60S acidic ribosomal protein P0                         276   3e-85    
ref|XP_002930016.1|  PREDICTED: 60S acidic ribosomal protein P0         276   4e-85    
gb|AHW80376.1|  ribosomol protein P0L10e                                276   4e-85    
ref|XP_011926491.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    276   4e-85    
ref|XP_005445335.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    276   4e-85    
ref|XP_003907291.1|  PREDICTED: 60S acidic ribosomal protein P0         276   4e-85    
gb|AHK09709.1|  60S acidic ribosomal protein P0                         275   4e-85    
ref|XP_010080334.1|  PREDICTED: 60S acidic ribosomal protein P0         273   4e-85    
dbj|BAF83798.1|  unnamed protein product                                276   5e-85    
ref|NP_031501.1|  60S acidic ribosomal protein P0                       276   5e-85    
ref|XP_005709583.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    275   6e-85    
ref|XP_009285795.1|  PREDICTED: 60S acidic ribosomal protein P0         275   7e-85    
gb|ACO12290.1|  60S acidic ribosomal protein P0                         275   8e-85    
ref|XP_006745368.1|  PREDICTED: 60S acidic ribosomal protein P0         275   9e-85    
gb|AHW68488.1|  60S acidic ribosomal protein P0                         274   9e-85    
ref|XP_007643381.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    275   9e-85    
gb|AHW68489.1|  60S acidic ribosomal protein P0                         274   1e-84    
gb|ABW04139.1|  ribosomal protein LP0                                   273   1e-84    
ref|XP_003495963.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    275   1e-84    
ref|XP_003211127.2|  PREDICTED: 60S acidic ribosomal protein P0         275   1e-84    
ref|XP_006890483.1|  PREDICTED: 60S acidic ribosomal protein P0         275   1e-84    
ref|XP_004691044.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    275   1e-84    
ref|XP_008067488.1|  PREDICTED: 60S acidic ribosomal protein P0         275   1e-84    
ref|XP_003973625.1|  PREDICTED: 60S acidic ribosomal protein P0         275   1e-84    
dbj|BAD96291.1|  ribosomal protein P0 variant                           275   1e-84    
ref|XP_004709621.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    274   2e-84    
ref|XP_002719840.1|  PREDICTED: 60S acidic ribosomal protein P0         274   2e-84    
emb|CBN08637.1|  ribosomal protein, large, P0                           274   2e-84    
sp|Q9PV90.1|RLA0_DANRE  RecName: Full=60S acidic ribosomal protei...    274   2e-84    
ref|XP_003082807.1|  RLA0_MAIZE 60S acidic ribosomal protein P0 p...    274   2e-84    
ref|XP_010133581.1|  PREDICTED: 60S acidic ribosomal protein P0         273   2e-84    
ref|XP_002639809.1|  C. briggsae CBR-RPA-0 protein                      274   3e-84    
gb|AAS49563.1|  ribosomal protein Large P0                              271   3e-84    
ref|XP_007130059.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    274   3e-84    
ref|XP_005503982.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    273   3e-84    
ref|NP_492766.1|  Protein RLA-0                                         273   4e-84    
ref|XP_006865510.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    273   4e-84    
gb|EYU22330.1|  hypothetical protein MIMGU_mgv1a019166mg                270   4e-84    
ref|XP_007936405.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    273   4e-84    
ref|XP_010306195.1|  PREDICTED: 60S acidic ribosomal protein P0         272   4e-84    
gb|EGT39704.1|  hypothetical protein CAEBREN_29720                      273   5e-84    
ref|XP_002154455.2|  PREDICTED: 60S acidic ribosomal protein P0-like    273   5e-84    
gb|EPB80460.1|  ribosomal protein L10                                   278   6e-84    
ref|XP_009246581.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    272   6e-84    
ref|XP_004658356.1|  PREDICTED: 60S acidic ribosomal protein P0-like    273   7e-84    
ref|XP_004379079.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    273   8e-84    
ref|XP_004464729.1|  PREDICTED: 60S acidic ribosomal protein P0         271   8e-84    
ref|XP_003112032.1|  CRE-RPA-0 protein                                  272   9e-84    
ref|XP_003419310.1|  PREDICTED: 60S acidic ribosomal protein P0         272   9e-84    
ref|XP_007170980.1|  PREDICTED: 60S acidic ribosomal protein P0         272   1e-83    
ref|XP_004396730.1|  PREDICTED: 60S acidic ribosomal protein P0         272   1e-83    
ref|XP_004315986.1|  PREDICTED: 60S acidic ribosomal protein P0         272   1e-83    
ref|XP_004281477.1|  PREDICTED: 60S acidic ribosomal protein P0         272   2e-83    
gb|ABY87386.1|  60S acidic ribosomal protein P0                         270   2e-83    
gb|EHH66765.1|  hypothetical protein EGM_03817                          271   2e-83    
sp|Q8NHW5.1|RLA0L_HUMAN  RecName: Full=60S acidic ribosomal prote...    271   2e-83    
ref|NP_071797.1|  60S acidic ribosomal protein P0                       271   2e-83    
gb|AAS49564.1|  ribosomal protein Large P0                              269   2e-83    
ref|XP_008351783.1|  PREDICTED: uncharacterized protein LOC103415220    284   2e-83    
gb|EFB17077.1|  hypothetical protein PANDA_020357                       270   3e-83    
ref|XP_004346242.1|  ribosomal protein P0                               271   4e-83    
ref|XP_005352132.1|  PREDICTED: 60S acidic ribosomal protein P0-like    271   4e-83    
gb|EHH54874.1|  hypothetical protein EGM_03973                          271   4e-83    
ref|XP_010127000.1|  PREDICTED: 60S acidic ribosomal protein P0         269   5e-83    
gb|KFP45896.1|  60S acidic ribosomal protein P0                         269   5e-83    



>ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   498 bits (1283),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 279/321 (87%), Positives = 296/321 (92%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYDQKLCQLLDEY+QILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDQKLCQLLDEYSQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGNTA LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRLHAEKTGNTAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++AV T+YSFP ADKVKEYLKDPSKF   A     A+   A  AA+  
Sbjct  241   PHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF-AVATAPVTASDAGAAPAASKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP+EES+D+MGFSLFD
Sbjct  300   EEKKEEPQEESDDDMGFSLFD  320



>ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   498 bits (1281),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 280/321 (87%), Positives = 293/321 (91%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYDQKLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDQKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN A LNLIPLLVGNVGLIFT+GDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRLHAEKTGNQAFLNLIPLLVGNVGLIFTRGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLMEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVLS+AV TDYSFP ADKVKE+LKDPSKF   A    AAA     AA    
Sbjct  241   PHMFVNAYKNVLSVAVATDYSFPQADKVKEFLKDPSKF-AVAVAPVAAADAGGSAAPPKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera]
Length=320

 Score =   496 bits (1277),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 279/321 (87%), Positives = 293/321 (91%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYDQKLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDQKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN A LNLIPLLVGNVGLIFT+GDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRLHAEKTGNQAFLNLIPLLVGNVGLIFTRGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLMEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVLS+AV T+YSFP ADKVKE+LKDPSKF   A    AAA     AA    
Sbjct  241   PHMFVNAYKNVLSVAVATEYSFPQADKVKEFLKDPSKF-AVAVAPVAAADAGGSAAPPKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>gb|KHG25462.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   493 bits (1270),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 287/321 (89%), Positives = 302/321 (94%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA+KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKAEKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFASGVSMVTALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL++AV T+YSFP ADKVKEYL DPSKFAVAAAPVA    G+APAAA A 
Sbjct  241   PHMFINGYKNVLAVAVATEYSFPQADKVKEYLADPSKFAVAAAPVAGGGGGAAPAAAPAE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  301   EEKKPEPEEESDDDMGFSLFD  321



>gb|KHG08087.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   493 bits (1269),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 282/321 (88%), Positives = 296/321 (92%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFATGVSMVTALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVLS+AV T+YSFP ADKVKEYL DPSKFAVA A VA  A  +   A AAA
Sbjct  241   PHMFINAYKNVLSVAVATEYSFPQADKVKEYLADPSKFAVAVAAVATDAGAAQATATAAA  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  301   EEKKPEPEEESDDDMGFSLFD  321



>gb|KJB78787.1| hypothetical protein B456_013G019000 [Gossypium raimondii]
Length=321

 Score =   491 bits (1264),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 283/321 (88%), Positives = 298/321 (93%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFATGVSMVTALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVLS+AV T+YSFP ADKVKEYL DPSKFAVA A VA  A  +  AAAAAA
Sbjct  241   PHMFINAYKNVLSVAVATEYSFPQADKVKEYLADPSKFAVAVAAVATDAGAAPAAAAAAA  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  301   EEKKPEPEEESDDDMGFSLFD  321



>ref|XP_004149240.1| PREDICTED: 60S acidic ribosomal protein P0 [Cucumis sativus]
 gb|KGN50643.1| 60S acidic ribosomal protein PO [Cucumis sativus]
Length=320

 Score =   490 bits (1262),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 276/321 (86%), Positives = 301/321 (94%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K TKA+KK+AYD KLCQLLDEY+Q+L+  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1     MAIKPTKAEKKVAYDSKLCQLLDEYSQVLVVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHSEQTGNKAYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSP+VLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHMLIN YKN+L++AV TDYSFP A+KVKEYL DPSKF   A  V++A +GSAP AAAA 
Sbjct  241   PHMLINAYKNLLAVAVATDYSFPQAEKVKEYLADPSKF-AVAVAVSSADSGSAPEAAAAV  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>gb|KJB76159.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=320

 Score =   490 bits (1262),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 284/321 (88%), Positives = 297/321 (93%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDLIEKFATGVSMVTALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL++AV T+YSFP ADKVKEYL DPSKF   AA   AA  G+APAAAA  
Sbjct  241   PHMFINGYKNVLAVAVATEYSFPQADKVKEYLADPSKF-AVAAAPVAAGGGAAPAAAAPV  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  300   EEKKPEPEEESDDDMGFSLFD  320



>ref|XP_011076719.1| PREDICTED: 60S acidic ribosomal protein P0 [Sesamum indicum]
Length=321

 Score =   490 bits (1261),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 281/321 (88%), Positives = 305/321 (95%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +K++KK+ YDQKLCQLLDEYTQ+L+AVADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1     MAPKLSKSEKKVVYDQKLCQLLDEYTQVLVAVADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN AILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRMHAEKTGNNAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V+SVYDNGSVFSPEVLDLTEDDL+EKFA+GVSMVTSLSLAI+YPTLAAA
Sbjct  181   LGIRPFSYGLVVISVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLSLAIAYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++AV TDYSFP ADKVKEYL DPSKFAVAAA  AAA +G+APAAAA  
Sbjct  241   PHMFINAYKNVLAVAVATDYSFPQADKVKEYLADPSKFAVAAAAAAAADSGAAPAAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK+EP EES+D+MGFSLFD
Sbjct  301   EEKKDEPAEESDDDMGFSLFD  321



>ref|XP_007009051.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
 gb|EOY17861.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
Length=320

 Score =   489 bits (1260),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 284/321 (88%), Positives = 298/321 (93%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMVTALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++A+ T+YSFP ADKVKEYL DPSKF   AA   AA AG+APAA AA 
Sbjct  241   PHMFINAYKNVLALAIATEYSFPQADKVKEYLADPSKF-AVAAAPVAADAGAAPAAPAAV  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  300   EEKKPEPEEESDDDMGFSLFD  320



>gb|KJB74261.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=321

 Score =   488 bits (1256),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 286/321 (89%), Positives = 302/321 (94%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNEAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFATGVSMVTALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKN+L++AV T+YSFP ADKVKEYL DPSKFAVAAAPVAAA  G+APAAA A 
Sbjct  241   PHMFINGYKNILAVAVATEYSFPQADKVKEYLADPSKFAVAAAPVAAAGGGAAPAAAPAE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  301   EEKKPEPEEESDDDMGFSLFD  321



>ref|XP_008463223.1| PREDICTED: 60S acidic ribosomal protein P0 [Cucumis melo]
Length=320

 Score =   488 bits (1255),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 277/321 (86%), Positives = 301/321 (94%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K TKA+KK+AYD KLCQLLDEY+Q+L+  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1     MAIKPTKAEKKVAYDSKLCQLLDEYSQVLVVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHSEQTGNKAYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSP+VLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHMLIN YKN+L++AV TDYSFP A+KVKEYL DPSKF   A  V+AA +GSAP AAAA 
Sbjct  241   PHMLINAYKNLLAVAVATDYSFPEAEKVKEYLADPSKF-AVAVAVSAADSGSAPEAAAAV  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>ref|NP_001238374.1| 60S acidic ribosomal protein P0 [Glycine max]
 sp|P50346.1|RLA0_SOYBN RecName: Full=60S acidic ribosomal protein P0 [Glycine max]
 gb|AAB63814.1| acidic ribosomal protein P0 [Glycine max]
Length=320

 Score =   487 bits (1254),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 281/321 (88%), Positives = 296/321 (92%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA KQTKA+KKIAYD KLC L++EY QIL+  +DNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNNAYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+ KFA GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIGKFAAGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVL++AVETDYSFP ADKVKEYLKDPSKF   AA  A AAA  APAAAA  
Sbjct  241   PHMFVNAYKNVLAVAVETDYSFPEADKVKEYLKDPSKF-AVAAVAAPAAASGAPAAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>ref|NP_001239676.1| uncharacterized protein LOC100777482 [Glycine max]
 gb|ACU20858.1| unknown [Glycine max]
 gb|KHN20859.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=319

 Score =   486 bits (1251),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 280/321 (87%), Positives = 296/321 (92%), Gaps = 2/321 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA KQTKA+KKIAYD KLC L++EY QIL+  +DNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNNAYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVL++AVETDYSFP ADKVKEYLKDPSKF  A A VAA AA S   AAA  
Sbjct  241   PHMFVNAYKNVLAVAVETDYSFPEADKVKEYLKDPSKF--AVAAVAAPAAESGAPAAAKE  298

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  299   EEKKEEPAEESDDDMGFSLFD  319



>ref|XP_007009052.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
 gb|EOY17862.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
Length=321

 Score =   485 bits (1249),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 284/322 (88%), Positives = 298/322 (93%), Gaps = 2/322 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLV-GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV  546
             M+KRSIR+HAE TGNTA LNLIPLL  GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV
Sbjct  61    MMKRSIRMHAEKTGNTAFLNLIPLLQQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV  120

Query  547   APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLA  726
             APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLA
Sbjct  121   APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLA  180

Query  727   KLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAA  906
             KLGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAA
Sbjct  181   KLGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMVTALSLAISYPTLAA  240

Query  907   APHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaa  1086
             APHM IN YKNVL++A+ T+YSFP ADKVKEYL DPSKF   AA   AA AG+APAA AA
Sbjct  241   APHMFINAYKNVLALAIATEYSFPQADKVKEYLADPSKF-AVAAAPVAADAGAAPAAPAA  299

Query  1087  aeekkeepeeeseDEMGFSLFD  1152
              EEKK EPEEES+D+MGFSLFD
Sbjct  300   VEEKKPEPEEESDDDMGFSLFD  321



>ref|XP_012087750.1| PREDICTED: 60S acidic ribosomal protein P0 [Jatropha curcas]
 gb|KDP44812.1| hypothetical protein JCGZ_01312 [Jatropha curcas]
Length=321

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 284/321 (88%), Positives = 305/321 (95%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KKIAYD KLCQLLDEY+QILIA ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MAAKPSKADKKIAYDAKLCQLLDEYSQILIAQADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIRVHAE TGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRVHAEKTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSL+LA+SYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFATGVSMVTSLALAVSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             P+M IN YKNVL+++V TDY+FP A+KVKEYL+DPSKFAVAAAPVAAA AG+APAAAA  
Sbjct  241   PYMFINAYKNVLAVSVATDYTFPQAEKVKEYLEDPSKFAVAAAPVAAATAGAAPAAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  301   EEKKEEPAEESDDDMGFSLFD  321



>ref|XP_004501267.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=322

 Score =   484 bits (1246),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 274/322 (85%), Positives = 292/322 (91%), Gaps = 1/322 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKIAYD KLCQLLD+Y+QIL+  ADNVGSNQLQ+IR GLRGDSVVLMGKNT
Sbjct  1     MAVKPTKAEKKIAYDSKLCQLLDDYSQILVVHADNVGSNQLQSIRSGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN   LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEQTGNKTFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTED L+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDALIEKFAIGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHML+N YKNVL++AV T+YS P ADKVKEYLKDPSKFAVAA    AAAA  A  AAA+ 
Sbjct  241   PHMLVNAYKNVLAVAVATEYSSPEADKVKEYLKDPSKFAVAAVAAPAAAASGAAPAAASK  300

Query  1090  eekkeepeeese-DEMGFSLFD  1152
             EE K+E   E   D+MGFSLFD
Sbjct  301   EEAKKEEPAEESDDDMGFSLFD  322



>gb|KHG25720.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=320

 Score =   484 bits (1245),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 281/321 (88%), Positives = 295/321 (92%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAA 
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFASGVSMVTALSLAISYPTLAAV  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL++AV T+YSF  ADKVKEYL DPSKF   A    AAA G+APAAA  A
Sbjct  241   PHMFINGYKNVLAVAVATEYSFRQADKVKEYLADPSKF-AVATAPVAAAGGAAPAAAVPA  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  300   EEKKPEPEEESDDDMGFSLFD  320



>ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   482 bits (1241),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 276/321 (86%), Positives = 298/321 (93%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKIAYD KLCQLL+EY+QIL+  ADNVGSNQLQ+IR GLRGDSVVLMGKNT
Sbjct  1     MAPKPTKAEKKIAYDSKLCQLLEEYSQILVVHADNVGSNQLQSIRSGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN   LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRMHAEKTGNNVYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVF+PEVLDLTED L+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFTPEVLDLTEDALIEKFAIGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVL++AV T+YSFP ADKVKE+LKDPSKFAVAA    AA +G+APAAAA  
Sbjct  241   PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKFAVAAVATPAADSGAAPAAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK+EP EES+D+MGFSLFD
Sbjct  301   EEKKDEPAEESDDDMGFSLFD  321



>ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   482 bits (1241),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 276/321 (86%), Positives = 298/321 (93%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKIAYD KLCQLL+EY+QIL+  ADNVGSNQLQ+IR GLRGDSVVLMGKNT
Sbjct  1     MAPKPTKAEKKIAYDSKLCQLLEEYSQILVVHADNVGSNQLQSIRSGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN   LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRMHAEKTGNNVYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVF+PEVLDLTED L+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFTPEVLDLTEDALIEKFAIGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVL++AV T+YSFP ADKVKE+LKDPSKFAVAA    AA +G+APAAAA  
Sbjct  241   PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKFAVAAVAAPAADSGAAPAAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK+EP EES+D+MGFSLFD
Sbjct  301   EEKKDEPAEESDDDMGFSLFD  321



>ref|XP_010534571.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=321

 Score =   482 bits (1241),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 277/321 (86%), Positives = 296/321 (92%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKIAYD KLCQLLDEYTQILI  ADNVGSNQLQ+IRKGLRGDS+VLMGKNT
Sbjct  1     MAVKPTKAEKKIAYDAKLCQLLDEYTQILIVAADNVGSNQLQSIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE T N A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTDNKAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIV SVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLA+SYPTLAAA
Sbjct  181   LGIRPFSYGLIVQSVYDNGSVFSPEVLDLTEDDLMEKFAAGVSMVTALSLAVSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++AV T+Y+FP A+KVKEYLKDPSKFAVAAA       G+APAAAA  
Sbjct  241   PHMFINAYKNVLAVAVATEYTFPQAEKVKEYLKDPSKFAVAAASAGGETGGAAPAAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  301   EEKKEEPAEESDDDMGFSLFD  321



>gb|EPS69246.1| p0 ribosomal protein-like protein, partial [Genlisea aurea]
Length=329

 Score =   481 bits (1239),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 280/323 (87%), Positives = 303/323 (94%), Gaps = 1/323 (0%)
 Frame = +1

Query  187   SMAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKN  366
             SMA K +K++KKIAYDQKLCQLLDEYTQ+L+AVADNVGSNQLQ+IR+GLRGDSVVLMGKN
Sbjct  7     SMAPKISKSEKKIAYDQKLCQLLDEYTQVLVAVADNVGSNQLQSIRRGLRGDSVVLMGKN  66

Query  367   TMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV  546
             TM+KRSIR+H+E TGNTAILNLIPLL GNVGLIFTKGDLKEVSEE+ KY+VGAPARVGLV
Sbjct  67    TMMKRSIRIHSEKTGNTAILNLIPLLAGNVGLIFTKGDLKEVSEEIGKYQVGAPARVGLV  126

Query  547   APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLA  726
             APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLA
Sbjct  127   APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLA  186

Query  727   KLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAA  906
             KLGIRPFSYGLIV  VYDNGSVFSPEVL+LTEDDL+EKFA G+SMVT+LSL ISYPTLAA
Sbjct  187   KLGIRPFSYGLIVTIVYDNGSVFSPEVLNLTEDDLIEKFASGISMVTALSLGISYPTLAA  246

Query  907   APHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaag-sapaaaa  1083
             APHM IN YKNVLS+A+ETDYSFP ADKVKEYL DPSKFAVAAAPVA AA   SAPAAAA
Sbjct  247   APHMFINAYKNVLSLALETDYSFPQADKVKEYLADPSKFAVAAAPVATAADSGSAPAAAA  306

Query  1084  aaeekkeepeeeseDEMGFSLFD  1152
               EEKK+EP EES+D+MGFSLFD
Sbjct  307   KEEEKKDEPAEESDDDMGFSLFD  329



>ref|XP_003603496.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES73747.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   480 bits (1236),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 248/278 (89%), Positives = 262/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KK  YD KLCQL+DEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MAVKPTKAEKKQNYDAKLCQLIDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL+ AV T+YSFP ADKVKEYLKDPSKF
Sbjct  241   PHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_010256605.1| PREDICTED: 60S acidic ribosomal protein P0 [Nelumbo nucifera]
Length=319

 Score =   480 bits (1235),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 244/278 (88%), Positives = 264/278 (95%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD+KLC+LLD+YTQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKSSKADKKIAYDKKLCELLDQYTQILVAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IR+H+E TGNTA LNLIPLLVGNVGLIFTKGDLKEVSEEV KYKVGAPARVGLVA
Sbjct  61    MMKRTIRIHSERTGNTAFLNLIPLLVGNVGLIFTKGDLKEVSEEVGKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLI+ SVYDNGSVFSPEVLDLTEDDL+EKFA GVSM T+L+LA+SYP LAAA
Sbjct  181   LGIRPFSYGLIIQSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMATALALAVSYPMLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL++AV TDYSFP A+KVKEYLKDPSKF
Sbjct  241   PHMFVNAYKNVLAVAVATDYSFPQAEKVKEYLKDPSKF  278



>ref|XP_007157498.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
 gb|ESW29492.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
Length=321

 Score =   480 bits (1235),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 277/321 (86%), Positives = 297/321 (93%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA KQTKA+KKI+YD KLCQLLD+Y QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKQTKAEKKISYDGKLCQLLDDYGQILVVNADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN   L+LIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHAEKTGNNVYLSLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKF  GVS+VTSLSLAIS+PTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFVSGVSIVTSLSLAISFPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVLS+AVETDYS+P ADKVKEYLKDPSKFAVAA    AAA+G+  AAAA  
Sbjct  241   PHMFVNAYKNVLSVAVETDYSYPEADKVKEYLKDPSKFAVAATVAPAAASGAPAAAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  301   EEKKEEPAEESDDDMGFSLFD  321



>ref|XP_002526873.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF35504.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=320

 Score =   479 bits (1234),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 277/321 (86%), Positives = 294/321 (92%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KK+AYD KLCQLLDEY+QILI  ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MAGKPSKADKKLAYDAKLCQLLDEYSQILIVAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIRVHA+NTGN  ILNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRVHADNTGNKTILNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDLIGKFAIGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKN L+IAV T+Y+FP A+KVKEYL+DPSKF   A  VA  AA  APAAAA  
Sbjct  241   PHMFINAYKNALAIAVATEYTFPQAEKVKEYLEDPSKF-AVAVAVAPVAAAGAPAAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>ref|XP_011072152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=330

 Score =   479 bits (1234),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 247/278 (89%), Positives = 265/278 (95%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KKIAYD+KLCQL+D++TQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKLSKADKKIAYDRKLCQLIDDHTQILVAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN  ILNLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEKTGNADILNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIVLSVY++GSVFSPEVLDLTEDDL+EKFA+GVSMV SLSLAI+YPTLAAA
Sbjct  181   LGIRPFSYGLIVLSVYESGSVFSPEVLDLTEDDLVEKFAMGVSMVASLSLAITYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YKN+LS+AVETDYSFP ADKVKEYL DPSKF
Sbjct  241   PHMFINAYKNLLSVAVETDYSFPQADKVKEYLADPSKF  278



>ref|XP_010534676.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=320

 Score =   479 bits (1232),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 280/319 (88%), Positives = 299/319 (94%), Gaps = 0/319 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQLLDEYTQILI  ADNVGSNQLQ+IRKGLRGDS+VLMGKNTM+
Sbjct  2     VKPTKAEKKIAYDAKLCQLLDEYTQILIVAADNVGSNQLQSIRKGLRGDSIVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRSIR+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSIRMHAEKTGNNAYLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAKLG
Sbjct  122   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGLIV SVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+L+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLIVESVYDNGSVFSPEVLDLTEDDLMEKFAAGVSMVTALALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaee  1095
             M IN YKNVLS+A+ T+YSFP A+KVKE+LKDPSKFAVAAAPVA  A G+APAAAA  EE
Sbjct  242   MFINAYKNVLSVALATEYSFPQAEKVKEFLKDPSKFAVAAAPVAGNAGGAAPAAAAKEEE  301

Query  1096  kkeepeeeseDEMGFSLFD  1152
             KKEEP EES+D+MGFSLFD
Sbjct  302   KKEEPAEESDDDMGFSLFD  320



>ref|XP_006848156.1| PREDICTED: 60S acidic ribosomal protein P0 [Amborella trichopoda]
 gb|ERN09737.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
Length=322

 Score =   479 bits (1232),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 277/322 (86%), Positives = 302/322 (94%), Gaps = 1/322 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA+KK+AYDQKLCQLLD+Y+Q+LI  ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKTSKAEKKVAYDQKLCQLLDQYSQVLIVAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IR+H E TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRLHTEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EKF +GVSMVT+LSL+ISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFDIGVSMVTALSLSISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaa-  1086
             PHM INGYKN L+IAV TDY+F  A++VKEYLKDP+KFAVAAAPVA+ AA SAPA  AA 
Sbjct  241   PHMFINGYKNALAIAVATDYTFAQAEQVKEYLKDPTKFAVAAAPVASEAAASAPAGGAAP  300

Query  1087  aeekkeepeeeseDEMGFSLFD  1152
              EEKKEEP EES+D+MGFSLFD
Sbjct  301   VEEKKEEPAEESDDDMGFSLFD  322



>gb|AFK39880.1| unknown [Medicago truncatula]
Length=323

 Score =   479 bits (1232),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 247/278 (89%), Positives = 261/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KK  YD KLCQL+DEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MAVKPTKAEKKQNYDAKLCQLIDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGT EIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTAEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL+ AV T+YSFP ADKVKEYLKDPSKF
Sbjct  241   PHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_010067511.1| PREDICTED: 60S acidic ribosomal protein P0 [Eucalyptus grandis]
 gb|KCW65656.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=320

 Score =   479 bits (1232),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 274/318 (86%), Positives = 299/318 (94%), Gaps = 0/318 (0%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             K +KA KK+AYD KLC+L+DEY+QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNTM+K
Sbjct  3     KLSKADKKLAYDAKLCRLMDEYSQILIVAADNVGSNQLQNIRKGLRGDSLVLMGKNTMMK  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             RSIR+HAENTGN A LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63    RSIRIHAENTGNNAYLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAKLGI
Sbjct  123   VIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGI  182

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
             RPFSYGL+V SVYDNGSVFSPEVLDLTEDDL+EKFALGVSMVT+LSLAISYPTLAAAPHM
Sbjct  183   RPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLMEKFALGVSMVTALSLAISYPTLAAAPHM  242

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaeek  1098
              IN YKNVL++AVET+YS+P AD+VKE+LKDPSKFAVA AP  AA +G+APAAAA  EEK
Sbjct  243   FINAYKNVLAVAVETEYSYPHADEVKEFLKDPSKFAVAVAPAGAADSGAAPAAAAKEEEK  302

Query  1099  keepeeeseDEMGFSLFD  1152
             K+EP EES+D+MGFSLFD
Sbjct  303   KDEPAEESDDDMGFSLFD  320



>ref|XP_010247657.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nelumbo nucifera]
Length=320

 Score =   478 bits (1231),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 271/321 (84%), Positives = 292/321 (91%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +K +KK AYDQKLCQLLDEYTQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKTEKKAAYDQKLCQLLDEYTQILVASADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGL+A
Sbjct  61    MMKRSIRLHAEKTGNKAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLIA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL +LSVYDNGSVFSPEVLDLTEDDL+EKF  GVSMVT+LSLA+SYPTLAAA
Sbjct  181   LGIRPFSYGLNILSVYDNGSVFSPEVLDLTEDDLMEKFVSGVSMVTALSLAVSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVL++AV T+YS+P A++VKEYLKDPSKF   AA   AAA      AAA  
Sbjct  241   PHMFVNAYKNVLAVAVATEYSYPQAEQVKEYLKDPSKF-AVAAAPLAAAPSGGAPAAAPV  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>emb|CDP14047.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   478 bits (1230),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 285/321 (89%), Positives = 299/321 (93%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K +KA KKIAYDQKLCQLLDEY+Q+LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1     MVTKVSKADKKIAYDQKLCQLLDEYSQVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IRVHAE TGN AILNLIPLLVGNVGLIFTKGDLKE+SEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRVHAEKTGNQAILNLIPLLVGNVGLIFTKGDLKEISEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFALGVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFALGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL+IAVETDYSFP ADKVKEYL+DPSKF   AA   AAA   A  AAA  
Sbjct  241   PHMFINGYKNVLAIAVETDYSFPQADKVKEYLEDPSKF-AVAAAPVAAADSGAAPAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>ref|XP_010554654.1| PREDICTED: 60S acidic ribosomal protein P0 [Tarenaya hassleriana]
Length=320

 Score =   478 bits (1230),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 274/321 (85%), Positives = 294/321 (92%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKIAYD KLCQLLDEYTQIL+  ADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPTKAEKKIAYDAKLCQLLDEYTQILVVAADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN   LNLI LL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRMHAEKTGNNGFLNLITLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIV SVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLIVQSVYDNGSVFSPEVLDLTEDDLMEKFAAGVSMVTALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++A+ T+Y+FP A+KVKEYLKDPSK    AA ++A   G+APAAA+  
Sbjct  241   PHMFINAYKNVLAVAIATEYTFPQAEKVKEYLKDPSKL-AVAAAMSAGDGGAAPAAASKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>ref|XP_007153264.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
 gb|ESW25258.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
Length=320

 Score =   478 bits (1229),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 278/321 (87%), Positives = 294/321 (92%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKIAYD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKATKAEKKIAYDGKLCQLLEEYGQILVVNADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN   LNLIPLL+GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHSEKTGNNVYLNLIPLLIGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDLLEKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLLEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKN+LS+A+ TDYSFP ADKVKEYLKDPSKF   AA  A AAA  APAAAA  
Sbjct  241   PHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKDPSKF-AVAAVAAPAAASGAPAAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>gb|AGV54296.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   478 bits (1229),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 277/321 (86%), Positives = 293/321 (91%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKIAYD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKATKAEKKIAYDGKLCQLLEEYGQILVVNADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN   LNLIPLL+GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHSEKTGNNVYLNLIPLLIGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDLLEKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLLEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKN+LS+A+ TDYSFP ADKVKEYLKDPSKF   AA  A AAA  APAAAA  
Sbjct  241   PHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKDPSKF-AVAAVAAPAAASGAPAAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEK EEP EES+D+MGFSLFD
Sbjct  300   EEKMEEPAEESDDDMGFSLFD  320



>gb|ADR71235.1| 60S acidic ribosomal protein P0A [Hevea brasiliensis]
Length=320

 Score =   478 bits (1229),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 247/278 (89%), Positives = 262/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KKIAYD KLCQLLDEY+QILI  ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MAGKPSKADKKIAYDAKLCQLLDEYSQILIVAADNVGSNQLQNIRQGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IRVH+E TGNTA LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRVHSEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLVEKFATGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL+IAV T+YSFP A+ V+EYLKDPSKF
Sbjct  241   PHMFVNAYKNVLAIAVATEYSFPRAETVREYLKDPSKF  278



>ref|XP_011042597.1| PREDICTED: 60S acidic ribosomal protein P0-like [Populus euphratica]
Length=321

 Score =   477 bits (1228),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 272/321 (85%), Positives = 294/321 (92%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN   LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHSEKTGNKTFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIVLSVYDNGSVFSP VLDLTEDDL+EKFA G++M+TSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLIVLSVYDNGSVFSPTVLDLTEDDLVEKFATGIAMITSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKN+L++AV T+YS+P A++VKE+LKDPSKFAVAA P AAAAA     AAA  
Sbjct  241   PHMFINAYKNILAVAVATEYSYPQAEEVKEFLKDPSKFAVAAVPAAAAAAPGGAPAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  301   EEKKEEPAEESDDDMGFSLFD  321



>gb|ADR71236.1| 60S acidic ribosomal protein P0B [Hevea brasiliensis]
Length=320

 Score =   477 bits (1227),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 246/278 (88%), Positives = 262/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KK+AYD KLCQLLDEY+QILI  ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MAGKPSKADKKMAYDAKLCQLLDEYSQILIVAADNVGSNQLQNIRQGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IRVH+E TGNTA LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRVHSEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLVEKFATGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL+IAV T+YSFP A+ V+EYLKDPSKF
Sbjct  241   PHMFVNAYKNVLAIAVATEYSFPRAETVREYLKDPSKF  278



>ref|XP_010486703.1| PREDICTED: 60S acidic ribosomal protein P0-3 [Camelina sativa]
Length=323

 Score =   477 bits (1227),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 242/276 (88%), Positives = 262/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKNVL+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNVLAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_010486773.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   476 bits (1226),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 242/276 (88%), Positives = 262/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKNVL+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNVLAIAVATDYTFPQAEKVKEFLKDPSKF  277



>gb|ACJ84880.1| unknown [Medicago truncatula]
Length=323

 Score =   476 bits (1225),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 246/278 (88%), Positives = 260/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KK  YD KLCQL+DEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MAVKPTKAEKKQNYDAKLCQLIDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGT EIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTAEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGI PFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGITPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL+ AV T+YSFP ADKVKEYLKDPSKF
Sbjct  241   PHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_009791710.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana sylvestris]
Length=321

 Score =   476 bits (1224),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 280/321 (87%), Positives = 296/321 (92%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKIAYD K+CQLLDEYTQ+L+A ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKATKAEKKIAYDSKMCQLLDEYTQVLVAAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRVHAEKTGNNTILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM  N YKNVL+IAVETDYSFPLADKVKEYL+DPSKF   AA   AAA   A  AAA  
Sbjct  241   PHMFTNAYKNVLAIAVETDYSFPLADKVKEYLEDPSKFTAVAAAPVAAAGSGAAPAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK+EP EES+D+MGFSLFD
Sbjct  301   EEKKDEPAEESDDDMGFSLFD  321



>ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES99553.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   476 bits (1224),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 271/322 (84%), Positives = 291/322 (90%), Gaps = 0/322 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KK AYD KLCQLLDE+TQILI  ADNVGS QLQNIR GLRGDSVVLMGKNT
Sbjct  1     MAPKPTKAEKKQAYDVKLCQLLDEFTQILIVNADNVGSKQLQNIRGGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVF+PEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFNPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVL++AV T+YSFP ADKVKE+LKDPSKFAVAA    A  +G+ PA AAAA
Sbjct  241   PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKFAVAAVAAPADVSGATPAPAAAA  300

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
                  EPEEES+D++GF LF D
Sbjct  301   AAAAAEPEEESDDDIGFGLFGD  322



>ref|XP_002882720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score =   476 bits (1224),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 242/276 (88%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|NP_187531.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 sp|Q42112.2|RLA02_ARATH RecName: Full=60S acidic ribosomal protein P0-2 [Arabidopsis 
thaliana]
 gb|AAF14020.1|AC011436_4 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAK44040.1|AF370225_1 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAL15223.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEE74736.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=320

 Score =   475 bits (1223),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 242/276 (88%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV T+Y+FP A+KVKEYLKDPSKF
Sbjct  242   MFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  277



>dbj|BAE71263.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
 dbj|BAE71276.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
Length=321

 Score =   476 bits (1224),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 245/278 (88%), Positives = 261/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KK  YD KLCQLLDE+ QIL+  ADNVGSNQLQ+IR+GLRGDSVVLMGKNT
Sbjct  1     MAPKATKAEKKQNYDSKLCQLLDEFNQILVVNADNVGSNQLQSIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNNAFLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L IRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LAIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVLSIAV T+YSFP ADKVKE+LKDPSKF
Sbjct  241   PHMFVNAYKNVLSIAVVTEYSFPEADKVKEFLKDPSKF  278



>gb|EYU18304.1| hypothetical protein MIMGU_mgv1a010092mg [Erythranthe guttata]
Length=322

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 242/278 (87%), Positives = 263/278 (95%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA+KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1     MAPKVSKAEKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+H++NTGN AIL LI LLVGNVGLIFTKGDLKEV+EEVAK+KVGAPARVGLVA
Sbjct  61    MMKRSIRIHSDNTGNKAILALIDLLVGNVGLIFTKGDLKEVTEEVAKFKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI+KGDKVGSSEAALL+K
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VL VYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLKVYDNGSVFSPEVLDLTEDDLVGKFAMGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  241   PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  278



>ref|XP_006298124.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
 gb|EOA31022.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
Length=323

 Score =   475 bits (1222),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 241/276 (87%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_010464828.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   475 bits (1222),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 241/276 (87%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNTA+LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTAVLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>gb|KJB76158.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=315

 Score =   474 bits (1221),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 279/321 (87%), Positives = 292/321 (91%), Gaps = 6/321 (2%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEV     GAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNQAFLNLIPLLQGNVGLIFTKGDLKEVSEEV-----GAPARVGLVA  115

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  116   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  175

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  176   LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDLIEKFATGVSMVTALSLAISYPTLAAA  235

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL++AV T+YSFP ADKVKEYL DPSKF   AA   AA  G+APAAAA  
Sbjct  236   PHMFINGYKNVLAVAVATEYSFPQADKVKEYLADPSKF-AVAAAPVAAGGGAAPAAAAPV  294

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  295   EEKKPEPEEESDDDMGFSLFD  315



>gb|EYU43500.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=322

 Score =   474 bits (1221),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 242/278 (87%), Positives = 261/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1     MAPKVSKADKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+H+ENTGN AIL LI LLVGNVGLIFTKGDLKEV+EEVAK+KVGAPARVGLVA
Sbjct  61    MMKRSIRIHSENTGNKAILALIDLLVGNVGLIFTKGDLKEVTEEVAKFKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI+KGDKVGSSEAALL+K
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIVKFAMGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  241   PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  278



>ref|XP_002884720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   474 bits (1221),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 242/276 (88%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LAISYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAISYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>ref|NP_187734.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
 sp|P57691.1|RLA03_ARATH RecName: Full=60S acidic ribosomal protein P0-3 [Arabidopsis 
thaliana]
 gb|AAG50973.1|AC073395_15 60S acidic ribosomal protein, putative; 58619-59992 [Arabidopsis 
thaliana]
 gb|AAL07229.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AAM14140.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AEE75020.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
Length=323

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 241/276 (87%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+EN+GNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENSGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_006435697.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
 ref|XP_006486350.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48937.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
Length=319

 Score =   474 bits (1219),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 241/278 (87%), Positives = 262/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK +KA+KKIAYD KLCQLL+EYTQIL+A ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVY+NGSV+SPEVLDL+EDDL+EKFA  VSMVT+L+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDDLVEKFASSVSMVTALALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNV+++A+ T+YSFP ADKVKEYL DPSKF
Sbjct  241   PHMFVNAYKNVVAVALATEYSFPQADKVKEYLADPSKF  278



>ref|XP_007222847.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
 ref|XP_008222707.1| PREDICTED: 60S acidic ribosomal protein P0 [Prunus mume]
 gb|EMJ24046.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
Length=319

 Score =   474 bits (1219),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 242/278 (87%), Positives = 262/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA+KKIAYD KLCQLLDEY QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1     MAPKPSKAEKKIAYDSKLCQLLDEYGQILIVAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN   LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEKTGNNVYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V +VYDNGSVFSPEVLDLTEDDL+ KFALGVSMVTSL+LAI+YPTLAAA
Sbjct  181   LGIRPFSYGLVVQTVYDNGSVFSPEVLDLTEDDLMVKFALGVSMVTSLALAIAYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL++++ T+Y+FP A+KVKEYLKDPSKF
Sbjct  241   PHMFLNAYKNVLAVSLATEYTFPQAEKVKEYLKDPSKF  278



>gb|ABK95701.1| unknown [Populus trichocarpa]
Length=322

 Score =   474 bits (1219),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 269/322 (84%), Positives = 292/322 (91%), Gaps = 1/322 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN   LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHSEKTGNKTFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSP VLDLTEDDL+EKFA G++M+TSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPTVLDLTEDDLVEKFATGITMITSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHMLIN YKN+LS+AV T+YS+P A++VKE+LKDPSKFAVAAAP AAAAA    A AAA 
Sbjct  241   PHMLINAYKNILSVAVATEYSYPQAEEVKEFLKDPSKFAVAAAPAAAAAAAPGGAPAAAK  300

Query  1090  eekkeepeeese-DEMGFSLFD  1152
             EE+K+E   E   D+MGFSLFD
Sbjct  301   EEEKKEEPAEESDDDMGFSLFD  322



>gb|KDO69054.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=319

 Score =   473 bits (1218),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 241/278 (87%), Positives = 262/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK +KA+KKIAYD KLCQLL+EYTQIL+A ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVY+NGSV+SPEVLDL+EDDL+EKFA  VSMVT+L+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDDLVEKFASSVSMVTALALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNV+++A+ T+YSFP ADKVKEYL DPSKF
Sbjct  241   PHMFVNAYKNVVAVALATEYSFPQADKVKEYLADPSKF  278



>ref|XP_009389889.1| PREDICTED: 60S acidic ribosomal protein P0 [Musa acuminata subsp. 
malaccensis]
Length=319

 Score =   473 bits (1217),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 263/321 (82%), Positives = 292/321 (91%), Gaps = 2/321 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK +KA+KK+ YD+KLC LLDEY+++LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1     MTVKLSKAEKKVVYDKKLCSLLDEYSKVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R IR+HAE TGN   LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIRIHAEKTGNKNYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++LSVYDNGSVFSPEVLDL+EDDL+EKFA G+SMVTSLSLA+SYPTLAAA
Sbjct  181   LGIRPFSYGLVILSVYDNGSVFSPEVLDLSEDDLIEKFAAGISMVTSLSLAVSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++A+ T+Y+FP A+KVKEYLKDPSKF  A A    AA  +A   A  A
Sbjct  241   PHMFINAYKNVLAVAIATEYTFPQAEKVKEYLKDPSKF--AVAAPVVAAEAAAAPTAEPA  298

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  299   EEKKEEPAEESDDDMGFSLFD  319



>ref|XP_010469822.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   473 bits (1216),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 240/276 (87%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_009399833.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   472 bits (1215),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 263/321 (82%), Positives = 292/321 (91%), Gaps = 2/321 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK +KA+KK+ YD+KLC LLDEY+++LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1     MTVKLSKAEKKVVYDKKLCSLLDEYSKVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I++HAE TGN   LNL+PLLVGNVGLIFTKGDLKEVSEEVAKY+VGAPARVGLVA
Sbjct  61    LIRRCIKIHAEKTGNKNYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYQVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLI+LSVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSLSLA+SYPTLAAA
Sbjct  181   LGIRPFSYGLIILSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLAVSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++A+ T+Y+FP A+K+KEYLKDPSKF  A A        +A  AAA A
Sbjct  241   PHMFINAYKNVLAVAIATEYTFPQAEKIKEYLKDPSKF--AVAATPVTEEAAAAPAAAPA  298

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  299   EEKKEEPAEESDDDMGFSLFD  319



>ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEE89516.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=322

 Score =   473 bits (1216),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 268/322 (83%), Positives = 291/322 (90%), Gaps = 1/322 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN   LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHSEKTGNKTFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSP VLDLTEDDL+EKFA G++M+TSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPTVLDLTEDDLVEKFATGITMITSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKN+LS+AV T+YS+P A++VKE+LKDPSKFAVAAAP AAAAA    A AAA 
Sbjct  241   PHMFINAYKNILSVAVATEYSYPQAEEVKEFLKDPSKFAVAAAPAAAAAAAPGGAPAAAK  300

Query  1090  eekkeepeeese-DEMGFSLFD  1152
             EE+K+E   E   D+MGFSLFD
Sbjct  301   EEEKKEEPAEESDDDMGFSLFD  322



>gb|AFK46889.1| unknown [Medicago truncatula]
Length=323

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 269/322 (84%), Positives = 290/322 (90%), Gaps = 0/322 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KK AYD KLCQLLD++TQILI  ADNVGS QLQNIR GLRGDSVVLMGKN 
Sbjct  1     MAPKPTKAEKKQAYDVKLCQLLDKFTQILIVNADNVGSKQLQNIRGGLRGDSVVLMGKNA  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNNAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVF+PEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFNPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVL++AV T+YSFP ADKVKE+LKDPSKFAVAA    A  +G+ PA AAAA
Sbjct  241   PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKFAVAAVAAPADVSGATPAPAAAA  300

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
                  EPEEES+D++GF LF D
Sbjct  301   AAAAAEPEEESDDDIGFGLFGD  322



>gb|AAM65265.1| 60S acidic ribosomal protein P0-C [Arabidopsis thaliana]
Length=323

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 240/276 (87%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+EN+GNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENSGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVATNYTFPQAEKVKEFLKDPSKF  277



>ref|XP_006298147.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
 gb|EOA31045.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
Length=322

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 240/276 (87%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRMHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>gb|AAM63644.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
Length=320

 Score =   472 bits (1214),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 241/276 (87%), Positives = 260/276 (94%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGL GDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLLGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV T+Y+FP A+KVKEYLKDPSKF
Sbjct  242   MFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_009409427.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   472 bits (1214),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 265/321 (83%), Positives = 293/321 (91%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK +KA+KK+ YD+KLC LLDEY+++LIAVADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1     MTVKLSKAEKKVVYDKKLCGLLDEYSKVLIAVADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R IR+HAE TGN   LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIRIHAEKTGNKNYLNLLPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++LSVYDNGSVFSPEVLDLTEDDL+EKFA GVS+VTSLSLAISYPTL AA
Sbjct  181   LGIRPFSYGLVILSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSLVTSLSLAISYPTLVAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++A+ T+YSFP A+KVKEYLKDPSKF   AA    A   +A +++A A
Sbjct  241   PHMFINAYKNVLAVAIATEYSFPHAEKVKEYLKDPSKF-AVAAAPVVAEVAAAASSSAPA  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>emb|CDY07906.1| BnaC03g36170D [Brassica napus]
Length=323

 Score =   472 bits (1214),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 240/276 (87%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+++HAENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVKIHAENTGNTAILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I V T+Y+FP A+KVKEYLKDPSKF
Sbjct  242   MFINAYKNALAICVATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_010464557.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
 ref|XP_010464558.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   471 bits (1213),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 240/276 (87%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVVTEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_009608105.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana tomentosiformis]
Length=320

 Score =   471 bits (1213),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 279/321 (87%), Positives = 296/321 (92%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKIAYD K+CQLLDEYTQ+L+A ADNVGS QLQNIRKGLRGDS+VLMGKNT
Sbjct  1     MAPKATKAEKKIAYDSKMCQLLDEYTQVLVAAADNVGSKQLQNIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRVHAEKTGNNTILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM  N YKNVL+IAVETDYSFPLADKVKEYL+DPSKF  A      AAAGS  A AAA 
Sbjct  241   PHMFTNAYKNVLAIAVETDYSFPLADKVKEYLEDPSKF-AAVVAAPVAAAGSGAAPAAAK  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EE+KEEP E S+D+MGFSLFD
Sbjct  300   EEEKEEPAEVSDDDMGFSLFD  320



>ref|XP_011035984.1| PREDICTED: 60S acidic ribosomal protein P0 [Populus euphratica]
Length=320

 Score =   471 bits (1212),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 267/321 (83%), Positives = 289/321 (90%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHSEKTGNKAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDDL+EKFA GVSM+ SLSLA SYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLVEKFAAGVSMIASLSLATSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKN+L++AV T+YS+P A+KVKE+L+DPSKF   AA    AAA  +  AAA  
Sbjct  241   PHMFINAYKNILAVAVATEYSYPQAEKVKEFLEDPSKF-AVAAAPVTAAASGSAPAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>gb|AAF34767.1|AF227622_1 60S acidic ribosomal protein PO [Euphorbia esula]
Length=317

 Score =   471 bits (1212),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 237/273 (87%), Positives = 259/273 (95%), Gaps = 0/273 (0%)
 Frame = +1

Query  205   TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  384
             +KA+KKIAYD KLCQLLD+Y+QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+KRS
Sbjct  3     SKAEKKIAYDAKLCQLLDDYSQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRS  62

Query  385   IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  564
             +RVH+E TGNTA LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV
Sbjct  63    VRVHSEKTGNTAFLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  122

Query  565   VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRP  744
             VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAKLGIRP
Sbjct  123   VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRP  182

Query  745   FSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLI  924
             FSYGL+V +VYD+G+VFSPEVL+LTEDDL+ KFA+GVSM+TSL+L++SYPTLAAAPHM I
Sbjct  183   FSYGLVVQTVYDSGTVFSPEVLNLTEDDLMAKFAIGVSMITSLALSVSYPTLAAAPHMFI  242

Query  925   NGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             N YKNVL+IAV TDYSFP ADKVKEYL DPSKF
Sbjct  243   NAYKNVLAIAVSTDYSFPQADKVKEYLADPSKF  275



>gb|AFK38760.1| unknown [Lotus japonicus]
Length=322

 Score =   471 bits (1212),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 240/276 (87%), Positives = 262/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQLLD+YTQIL+  ADNVGSNQLQNIR+GLRGDSVVLMGKNTM+
Sbjct  2     VKPTKAEKKIAYDAKLCQLLDDYTQILVVNADNVGSNQLQNIRRGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KR++R+HAE +GN   LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRTVRIHAEKSGNNVYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAKLG
Sbjct  122   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+ KFA+GVSMVT+LSLAIS+PTLAAAPH
Sbjct  182   IRPFSYGLVVLSVYDNGSVLSPEVLDLTEDDLVGKFAIGVSMVTALSLAISFPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M +N YKN+L++A+ T+YSFP AD+VKEYLKDPSKF
Sbjct  242   MFVNAYKNILAVALATEYSFPQADEVKEYLKDPSKF  277



>emb|CDY53103.1| BnaCnng24330D [Brassica napus]
Length=323

 Score =   471 bits (1211),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 239/276 (87%), Positives = 262/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+++HAENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVKIHAENTGNTAILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_002315165.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEF01336.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=320

 Score =   470 bits (1210),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 267/321 (83%), Positives = 287/321 (89%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHSEKTGNKAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDDL++KFA GVSM+ SLSLA SYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLIDKFAAGVSMIASLSLATSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++AV T+YSFP A+KVKE+L+DPSKF   AA    AAA     AAA  
Sbjct  241   PHMFINAYKNVLAVAVATEYSFPQAEKVKEFLEDPSKF-AVAAAPVTAAASGGAPAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>ref|XP_011084927.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=315

 Score =   470 bits (1209),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 243/272 (89%), Positives = 261/272 (96%), Gaps = 0/272 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KKIAYD+KLCQL+D++TQIL+A ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKLSKADKKIAYDRKLCQLIDDHTQILVAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGNT ILNLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEKTGNTDILNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIVLSVY++GSVFSPEVLDLTEDDL+EKFA+GVSMV SLSLAI+YPTLAAA
Sbjct  181   LGIRPFSYGLIVLSVYESGSVFSPEVLDLTEDDLVEKFAMGVSMVASLSLAITYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYL  1005
             PHM IN YKN+LS+AVETDYSFP ADKVKEYL
Sbjct  241   PHMFINAYKNLLSVAVETDYSFPQADKVKEYL  272



>ref|XP_004239781.1| PREDICTED: 60S acidic ribosomal protein P0 [Solanum lycopersicum]
Length=321

 Score =   470 bits (1209),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 279/321 (87%), Positives = 298/321 (93%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKIAYD K+CQLLD++TQ+L+A ADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1     MAPKATKAEKKIAYDTKMCQLLDDFTQVLVAAADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRVHAEKTGNETILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM  N YKNVL+IA+ETDYSFPLADKVKEYL DPSKFA  AA  AAAA   A  AAA  
Sbjct  241   PHMFTNAYKNVLAIAIETDYSFPLADKVKEYLADPSKFAAVAAAPAAAAGSGAAPAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  301   EEKKEEPAEESDDDMGFSLFD  321



>ref|XP_010486480.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   470 bits (1209),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 239/276 (87%), Positives = 260/276 (94%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQ +DEYTQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDTKLCQHIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNT+ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTSILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>gb|KFK38515.1| hypothetical protein AALP_AA3G123100 [Arabis alpina]
Length=324

 Score =   469 bits (1208),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 237/276 (86%), Positives = 260/276 (94%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQILI  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLVDEYTQILIVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+ENTGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSENTGNTGILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVF P+VL+LTED L+EKFA+G+SMVTSL+LAISYPTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFKPDVLNLTEDALVEKFAVGISMVTSLALAISYPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>gb|ABK94988.1| unknown [Populus trichocarpa]
 gb|ABK95694.1| unknown [Populus trichocarpa]
Length=320

 Score =   469 bits (1207),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 266/321 (83%), Positives = 286/321 (89%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K +KA KKIAYD KLCQLLDEY+QILIA ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E T N A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHSEKTANKAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLS YDNGSVFSPEVLDLTEDDL++KFA GVSM+ SLSLA SYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLIDKFAAGVSMIASLSLATSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++AV T+YSFP A+KVKE+L+DPSKF   AA    AAA     AAA  
Sbjct  241   PHMFINAYKNVLAVAVATEYSFPQAEKVKEFLEDPSKF-AVAAAPVTAAASGGAPAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>ref|XP_009344598.1| PREDICTED: 60S acidic ribosomal protein P0 [Pyrus x bretschneideri]
Length=321

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 242/278 (87%), Positives = 260/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KKIAYD KLC LLDEY QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKPSKADKKIAYDSKLCSLLDEYGQILIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDDLMEKFASGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  241   PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|XP_006407706.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49159.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=322

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 237/276 (86%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLVDEYTQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+HAENTGNT I+NL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHAENTGNTGIMNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVL+LTEDDL+EKFA G+SMVTSL+LA+SYPT+AAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLNLTEDDLVEKFAAGISMVTSLALAVSYPTIAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>emb|CDX73962.1| BnaA03g30850D [Brassica napus]
Length=323

 Score =   469 bits (1206),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 238/276 (86%), Positives = 260/276 (94%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+++HAENTGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVKIHAENTGNTGILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I + T+Y+FP A+KVKEYLKDPSKF
Sbjct  242   MFINAYKNALAICIATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_009619762.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=323

 Score =   469 bits (1206),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 238/278 (86%), Positives = 260/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVKQTK QKK+AYDQKLC+ LD Y QILI  ADNVGS QLQNIRKGLRG+SVVLMGKNT
Sbjct  1     MAVKQTKTQKKVAYDQKLCKYLDLYNQILIVNADNVGSTQLQNIRKGLRGESVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN   LNLIPLLVGNVGLIFTKGDLKE+ EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHAEKTGNEGFLNLIPLLVGNVGLIFTKGDLKEIKEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DV+VP GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PVDVIVPTGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V+SVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVT+LSLA+SYPTLAAA
Sbjct  181   LGIRPFSYGLVVVSVYDNGSVFSPEVLDLTEDDLMEKFATGVSMVTTLSLAVSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             P+M + GYKNVL++ VET+YS+P AD+VKEYLKDPSKF
Sbjct  241   PYMFVKGYKNVLAVTVETEYSYPQADQVKEYLKDPSKF  278



>ref|XP_009146942.1| PREDICTED: 60S acidic ribosomal protein P0-2 [Brassica rapa]
 emb|CDY44688.1| BnaA05g29180D [Brassica napus]
Length=323

 Score =   469 bits (1206),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 238/276 (86%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+++HAENTGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVKIHAENTGNTGILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>gb|EYU43501.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=321

 Score =   469 bits (1206),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 241/278 (87%), Positives = 260/278 (94%), Gaps = 1/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KKIAYD+KLC LLDEYTQ+L+AVADNVGS QLQNIR  LRGDSVVLMGKNT
Sbjct  1     MAPKVSKADKKIAYDKKLCNLLDEYTQVLVAVADNVGSTQLQNIRSALRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+H+ENTGN AIL LI LL GNVGLIFTKGDLKEV+EEVAK+KVGAPARVGLVA
Sbjct  61    MMKRSIRIHSENTGNKAILALIDLL-GNVGLIFTKGDLKEVTEEVAKFKVGAPARVGLVA  119

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI+KGDKVGSSEAALL+K
Sbjct  120   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLSK  179

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  180   LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIVKFAMGVSMVTSLALAISYPTLAAA  239

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  240   PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  277



>ref|XP_010095082.1| 60S acidic ribosomal protein P0 [Morus notabilis]
 gb|EXB58188.1| 60S acidic ribosomal protein P0 [Morus notabilis]
Length=320

 Score =   468 bits (1204),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 261/321 (81%), Positives = 290/321 (90%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K +KA KKIAYD KLCQLLDEY+Q+LI  ADNVGSNQLQ+IR+GLRGDS+VLMGKNT
Sbjct  1     MVGKLSKADKKIAYDAKLCQLLDEYSQVLIVAADNVGSNQLQSIRRGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+ENTGN A LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHSENTGNKAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALL+K
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTEDDL+EKFA GVS+VTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSLVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PH   N YKNVL++AV T+Y+FP A+KVKE+L+DPSKF   +A   A A  +A   AA  
Sbjct  241   PHFFTNAYKNVLAVAVATEYTFPQAEKVKEFLEDPSKF-AVSAAPVADAGAAAAPVAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  300   EEKKEEPAEESDDDMGFSLFD  320



>ref|XP_009135066.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   468 bits (1204),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 237/276 (86%), Positives = 260/276 (94%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+++HAENTGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVKIHAENTGNTGILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PT+AAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTIAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I + T+Y+FP A+KVKEYLKDPSKF
Sbjct  242   MFINAYKNALAICIATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_008392940.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   468 bits (1204),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 239/278 (86%), Positives = 259/278 (93%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KKIAYD KLC LLDEY Q+LI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKPSKADKKIAYDSKLCSLLDEYGQVLIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+ KFA GVSMVTSL+LA+SYPTLAAA
Sbjct  181   LGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDDLMVKFASGVSMVTSLALAVSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  241   PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|XP_009350848.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pyrus x bretschneideri]
Length=321

 Score =   468 bits (1204),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 240/278 (86%), Positives = 260/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA+KKIAYD KLC LLDEY Q+LI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKPSKAEKKIAYDSKLCSLLDEYGQVLIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEVSEEV KYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEVSEEVGKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMEKFASGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  241   PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|XP_009764939.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=323

 Score =   468 bits (1203),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 236/278 (85%), Positives = 261/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVKQTK QKK+AYDQKLC+ LD Y QILI  ADNVGS QLQNIRKGLRG+SVVLMGKNT
Sbjct  1     MAVKQTKTQKKVAYDQKLCKYLDLYNQILIVNADNVGSTQLQNIRKGLRGESVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN   LNLIPLLVGNVGLIFTKGDLKE+ EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHAEKTGNEGFLNLIPLLVGNVGLIFTKGDLKEIKEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DV+VP GNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI+KGDKVGSSEAALLAK
Sbjct  121   PVDVIVPTGNTGLDPSQTSFFQVLNIPTKINKGTVEIMTPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+++SVYDNGSVFSPEVL+LTEDDL+EKFA GVSMVT+LSLA+SYPTLAAA
Sbjct  181   LGIRPFSYGLVMVSVYDNGSVFSPEVLELTEDDLMEKFATGVSMVTTLSLAVSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             P+M + GY+NVL++AVETDYS+P AD+VKEYLKDPSKF
Sbjct  241   PYMFVKGYENVLAVAVETDYSYPQADQVKEYLKDPSKF  278



>ref|XP_010689885.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=321

 Score =   468 bits (1203),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 271/321 (84%), Positives = 288/321 (90%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKIAYDQKLC LLDE++Q+LIA ADNVGSNQLQ IR GLRGDSVVLMGKNT
Sbjct  1     MAVKPTKAEKKIAYDQKLCNLLDEFSQVLIASADNVGSNQLQGIRSGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN  +  L  LLVGNVGLIFTKGDLKEV EE++KYKVGAPARVGLVA
Sbjct  61    MMKRSIRLHAEKTGNDNLRKLEQLLVGNVGLIFTKGDLKEVREEISKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIT VELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL + SVYDNGSVFSPEVLDLTE+DLL KFA GVSMVTSL LAISYPTLAAA
Sbjct  181   LGIRPFSYGLAIESVYDNGSVFSPEVLDLTEEDLLAKFASGVSMVTSLCLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL+IA+ETDY FP A+KVKEYLKDPSKFAVAA    AAAA    AAAA  
Sbjct  241   PHMFINGYKNVLAIALETDYDFPEAEKVKEYLKDPSKFAVAAPAAGAAAASGGGAAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  301   EEKKEEPAEESDDDMGFSLFD  321



>ref|XP_009123454.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   468 bits (1203),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 237/276 (86%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DE+TQIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+++HAEN+GNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVKIHAENSGNTGILNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAAPH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  242   MFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>gb|KHN36391.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=321

 Score =   467 bits (1202),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 261/321 (81%), Positives = 289/321 (90%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR GLRGDSV+LMGKNT
Sbjct  1     MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDSVILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+I++HA+NTGNT ILNLIPLLVGNVGLIFTKGD+KEV E V+KYKV APARVGLVA
Sbjct  61    MMKRTIKIHAQNTGNTTILNLIPLLVGNVGLIFTKGDVKEVKEVVSKYKVAAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI KGDKVGSSEAALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIMKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L IRPFSYGL V+SVY+NGSVFSPEVLDLTEDDL+ KFA GV MV+SLSLAISYP++AAA
Sbjct  181   LAIRPFSYGLAVVSVYENGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKN+L++AV T+YSFP ADKVKEYLKDPSKFAVA     A  +G+APAAA+  
Sbjct  241   PHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPSKFAVAVVAAPATKSGAAPAAASKV  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEE  +ES+D+MGFSLFD
Sbjct  301   EEKKEEAADESDDDMGFSLFD  321



>ref|XP_010941551.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=321

 Score =   467 bits (1202),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 269/321 (84%), Positives = 296/321 (92%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK +K++KKI YD+KLC+LLDEY+Q+LIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MTVKLSKSEKKIEYDKKLCRLLDEYSQVLIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I++HAE TGN   LNL+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKIHAEKTGNKDYLNLLPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSLSLA+SYPTL AA
Sbjct  181   LGIRPFSYGLVIQAVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMVTSLSLALSYPTLVAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++A+ T+Y+F  A+KVKEYLKDPSKFAVAA   AAAAA +APAAAA  
Sbjct  241   PHMFINAYKNVLAVAIATEYTFEQAEKVKEYLKDPSKFAVAAPVEAAAAAAAAPAAAAKE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+++MGFSLFD
Sbjct  301   EEKKEEPAEESDEDMGFSLFD  321



>ref|XP_008360784.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   467 bits (1201),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 240/278 (86%), Positives = 259/278 (93%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K +KA KKIAYD KLC LLDEY Q+LI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKPSKADKKIAYDSKLCSLLDEYGQVLIVAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN+A LNL+PLLVGNVGLIFTKGDLKEVSEEV KYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHAEKTGNSAYLNLVPLLVGNVGLIFTKGDLKEVSEEVGKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMEKFASGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  241   PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|NP_001275012.1| 60S acidic ribosomal protein P0-like [Solanum tuberosum]
 gb|ABB29933.1| P0 ribosomal protein-like [Solanum tuberosum]
 gb|ABB87111.1| P0 ribosomal protein-like [Solanum tuberosum]
Length=320

 Score =   466 bits (1199),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 277/321 (86%), Positives = 296/321 (92%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKIAYD K+CQLLD++TQ+L+A ADNVGSNQLQ+IRKGLRGDSVVLMGKNT
Sbjct  1     MAPKATKAEKKIAYDTKMCQLLDDFTQVLVAAADNVGSNQLQSIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IRVHAE TGN  ILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRVHAEKTGNETILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V+SVYDNGSVFSPEVLDLTEDDL+EKFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVVSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM  N YKNVL+IAVETDYSFPLADKVKEYL DPSKF   AA  AAAA   A  AAA  
Sbjct  241   PHMFTNAYKNVLAIAVETDYSFPLADKVKEYLADPSKF-AVAAAPAAAAGSGAAPAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP E S+D+MGFSLFD
Sbjct  300   EEKKEEPAEVSDDDMGFSLFD  320



>gb|KHN34735.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=320

 Score =   465 bits (1196),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 254/321 (79%), Positives = 283/321 (88%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR GLRGDSV+LMGKNT
Sbjct  1     MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDSVILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSI++HA+NTG+T ILNLIPLLVGNVGLIFTKGD+KEV E V+KYKV APARVGLVA
Sbjct  61    MMKRSIKIHAQNTGDTTILNLIPLLVGNVGLIFTKGDVKEVKEVVSKYKVAAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI KGDKVGSSEAALL+K
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIMKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L IRPFSYGL V+SVYDNGSVFSPEVLDLTEDDL+ KFA GV MV+SLSLAISYP++AAA
Sbjct  181   LAIRPFSYGLAVVSVYDNGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKN+L++AV T+YSFP ADKVKEYLKDPSKF   A   A A    A  AAA+ 
Sbjct  241   PHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPSKF-AVAVVAAPATKSGAAPAAASK  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
              E+K+E  +ES+D+MGFSLFD
Sbjct  300   VEEKKEEADESDDDMGFSLFD  320



>ref|XP_004145258.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
 gb|KGN65800.1| hypothetical protein Csa_1G530120 [Cucumis sativus]
Length=320

 Score =   465 bits (1196),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 234/278 (84%), Positives = 260/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M +K T+AQKK  YDQKLC+LLDEY+Q+LI  ADNVGSNQLQ+IRKGLRGDS++LMGKNT
Sbjct  1     MVLKPTRAQKKTNYDQKLCRLLDEYSQVLIVGADNVGSNQLQSIRKGLRGDSIILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+H+ENTGNTA+ NL+P LVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHSENTGNTAVTNLLPHLVGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALL+K
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIV+SVYDNGSVFSP VLDL+E+DLLEKF  GVSMV SLSLA+S+PTLAAA
Sbjct  181   LGIRPFSYGLIVVSVYDNGSVFSPAVLDLSEEDLLEKFLAGVSMVASLSLAVSFPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHMLIN YKN L+IAV T+YSF  AD++KE+LKDPSKF
Sbjct  241   PHMLINAYKNALAIAVATEYSFSEADEIKEFLKDPSKF  278



>ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
 gb|ESQ52698.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
Length=317

 Score =   464 bits (1195),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 240/278 (86%), Positives = 258/278 (93%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKI YD KLCQLL+EY QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKATKAEKKIVYDSKLCQLLNEYPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN   L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRLHAEKTGNDCFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIV SVYDNGSVFSPEVL+LTEDDL+EKFA GVS++T+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLIVESVYDNGSVFSPEVLNLTEDDLVEKFAAGVSLITALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL+IA+ T+YSFP AD VKE+LKDPSKF
Sbjct  241   PHMFLNAYKNVLAIALATEYSFPQADNVKEFLKDPSKF  278



>gb|KFK38306.1| hypothetical protein AALP_AA3G096900 [Arabis alpina]
Length=323

 Score =   464 bits (1195),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 233/276 (84%), Positives = 261/276 (95%), Gaps = 0/276 (0%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLVDEYTQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+H+E+TGNT ILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHSESTGNTGILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  181

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVF+P+VL+LTED L+EKFA+G+SMVTSL+LAISYPTLA+APH
Sbjct  182   IRPFSYGLVVQSVYDNGSVFNPDVLNLTEDALVEKFAVGISMVTSLALAISYPTLASAPH  241

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I+V T+Y+FP A++VKE+LKDPSKF
Sbjct  242   MFINAYKNALAISVATEYTFPQAEQVKEFLKDPSKF  277



>ref|XP_007016138.1| Ribosomal protein L10 family protein [Theobroma cacao]
 gb|EOY33757.1| Ribosomal protein L10 family protein [Theobroma cacao]
Length=321

 Score =   463 bits (1191),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 237/278 (85%), Positives = 257/278 (92%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M V  +K +KK  YDQKLC+LLDEY+Q+LI  ADNVGS Q+QNIRKGLRG+SVVLMGKNT
Sbjct  1     MVVNTSKREKKEKYDQKLCRLLDEYSQVLIVAADNVGSTQVQNIRKGLRGESVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAENT N AI NLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGL+A
Sbjct  61    MMKRSIRLHAENTNNEAIRNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLIA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYD+GSVFSPEVLDLTEDDL+EKFA GVSM  SLSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVLSVYDSGSVFSPEVLDLTEDDLVEKFANGVSMAASLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKN L++AV +DYSFP A+KVKEYLKDPSKF
Sbjct  241   PHMFVNAYKNALAVAVASDYSFPQAEKVKEYLKDPSKF  278



>ref|XP_010926952.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=320

 Score =   463 bits (1191),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 233/278 (84%), Positives = 261/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK +K++KK+ YD+KLC+LLDEY+Q+LIA ADNVGSNQLQNIRKGLRGDS+VLMGKNT
Sbjct  1     MTVKLSKSEKKVEYDKKLCRLLDEYSQVLIAAADNVGSNQLQNIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             MI+R I+VHA+ TGN   LNL+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    MIRRCIKVHAQKTGNKECLNLLPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ SVYDNGSVFSPEVLDLTEDDL+EKFA GVSMVTSLSLA+SYPT+AAA
Sbjct  181   LGIRPFSYGLVIQSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLALSYPTVAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YKNVL++A+ T+Y+FP A K+KE+L+DPSKF
Sbjct  241   PHMFINAYKNVLAVAIATEYTFPQAKKLKEFLEDPSKF  278



>gb|KFK36893.1| hypothetical protein AALP_AA4G185700 [Arabis alpina]
Length=318

 Score =   463 bits (1191),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 233/278 (84%), Positives = 258/278 (93%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K TK +KKI YD KLCQLL+EY QIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNT
Sbjct  1     MAIKATKGEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HA+ TGN   L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHADKTGNDCFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVYDNGSVFSP+VL+LTED L+EKFA+GVSM+T+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVESVYDNGSVFSPDVLNLTEDSLVEKFAVGVSMITALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YKNVL++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241   PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>gb|KDO69055.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=318

 Score =   462 bits (1190),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 236/272 (87%), Positives = 257/272 (94%), Gaps = 0/272 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK +KA+KKIAYD KLCQLL+EYTQIL+A ADNVGSNQLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR+IR+HAE TGNTA LNLIPLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVY+NGSV+SPEVLDL+EDDL+EKFA  VSMVT+L+LAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDDLVEKFASSVSMVTALALAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYL  1005
             PHM +N YKNV+++A+ T+YSFP ADKVKEYL
Sbjct  241   PHMFVNAYKNVVAVALATEYSFPQADKVKEYL  272



>ref|XP_003538454.1| PREDICTED: 60S acidic ribosomal protein P0-like [Glycine max]
Length=320

 Score =   462 bits (1190),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 253/321 (79%), Positives = 282/321 (88%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR GLRGDSV+LMGKNT
Sbjct  1     MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDSVILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSI++HA+NTG+T ILNLIPLLVGNVGLIFTKGD+KEV E V+KYKV APARVGLVA
Sbjct  61    MMKRSIKIHAQNTGDTTILNLIPLLVGNVGLIFTKGDVKEVKEVVSKYKVAAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI KGDKVGSSEA LL+K
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIMKGDKVGSSEAVLLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L IRPFSYGL V+SVYDNGSVFSPEVLDLTEDDL+ KFA GV MV+SLSLAISYP++AAA
Sbjct  181   LAIRPFSYGLAVVSVYDNGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKN+L++AV T+YSFP ADKVKEYLKDPSKF   A   A A    A  AAA+ 
Sbjct  241   PHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPSKF-AVAVVAAPATKSGAAPAAASK  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
              E+K+E  +ES+D+MGFSLFD
Sbjct  300   VEEKKEEADESDDDMGFSLFD  320



>ref|XP_004247949.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=320

 Score =   462 bits (1189),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 229/278 (82%), Positives = 260/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K TK++KK+ YDQKLC+ LD Y QILI  ADNVGS Q+Q IRKGLRGDSVVLMGKNT
Sbjct  1     MAIKPTKSEKKVMYDQKLCKYLDSYNQILIVNADNVGSTQMQGIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HA NTGN A LNLIPLLVGNVGLIFTKGDLKE+ EEVAKYKVGAPARVGL+A
Sbjct  61    MMKRSVRIHAGNTGNDAFLNLIPLLVGNVGLIFTKGDLKEIKEEVAKYKVGAPARVGLIA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DV+VPPGNTGLDPSQTSFFQVLNI TKINKGTVEIITPVELI+KGDKVGSSEAALL+K
Sbjct  121   PVDVIVPPGNTGLDPSQTSFFQVLNIATKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V+SVYDNGSVFSP+VLDLT++DL+EKFA GV+M+T+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVISVYDNGSVFSPQVLDLTDEDLVEKFAAGVTMITTLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM++NGYKNVL +AVET+Y++P A +VKEYLKDPSKF
Sbjct  241   PHMIVNGYKNVLGVAVETEYTYPQAQQVKEYLKDPSKF  278



>ref|XP_008799093.1| PREDICTED: 60S acidic ribosomal protein P0 [Phoenix dactylifera]
Length=320

 Score =   462 bits (1189),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 265/321 (83%), Positives = 296/321 (92%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK TKA++K+ YD+KLC+LLDEY+Q+LIA ADNVGSNQLQNIR+GLRG+SV+LMGKNT
Sbjct  1     MTVKLTKAERKLEYDKKLCRLLDEYSQVLIAAADNVGSNQLQNIRQGLRGESVILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VHAE TGN   LNL+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHAEKTGNKEYLNLLPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKG+KVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ SVY+NGSVFSPEVLDLTEDDL+EKFA G+SMVTSLSLA+SYPTLAAA
Sbjct  181   LGIRPFSYGLVIQSVYENGSVFSPEVLDLTEDDLIEKFAAGLSMVTSLSLALSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++A+ T+Y+FP A+KVKE+L+DPSKF   AAPVAAA A S PAAAA  
Sbjct  241   PHMFINAYKNVLAVAIATEYTFPQAEKVKEFLEDPSKF-AVAAPVAAAEAASTPAAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  300   EEKKAEPEEESDDDMGFSLFD  320



>ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
 gb|ESW35519.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
Length=317

 Score =   462 bits (1189),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 255/321 (79%), Positives = 286/321 (89%), Gaps = 4/321 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKAQKKIAYD KLC+LLD YTQIL+  ADNVGSNQLQNIR+GLRGDS+VLMGKNT
Sbjct  1     MAVKLTKAQKKIAYDAKLCRLLDNYTQILVVAADNVGSNQLQNIRQGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+++HAE+TGN A LNL+PLLVGNVGLIFTKGD+KEVSE VAKYKVGAPARVGL+A
Sbjct  61    MMKRSVKLHAESTGNNAFLNLVPLLVGNVGLIFTKGDVKEVSEVVAKYKVGAPARVGLIA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKG+KVGSSEAALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L IRPFSYGL+V+SVYDNGSVFSP VL+LT+DDL+  FA GVSMV+SLSLAISYPT+AAA
Sbjct  181   LAIRPFSYGLVVVSVYDNGSVFSPAVLNLTDDDLVNMFANGVSMVSSLSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
              HM  N YKNVL++AV T+YSFP AD+VKE+LKDPSKF    A    AA  +  A AAA 
Sbjct  241   LHMFANSYKNVLAVAVVTEYSFPEADEVKEFLKDPSKF----AVAVVAATATDSAPAAAK  296

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EE+K+E  EES+D+MGFSLFD
Sbjct  297   EEEKKEEPEESDDDMGFSLFD  317



>ref|XP_002525622.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF36740.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=323

 Score =   462 bits (1189),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 230/278 (83%), Positives = 263/278 (95%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKAQKK+ YD+KLC+ LDEY+QIL+  ADNVGSNQLQ+IR+GLRGDSVVLMGKNT
Sbjct  1     MAVKPTKAQKKVEYDKKLCRFLDEYSQILVVAADNVGSNQLQSIRQGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLLVGNVGLIFTKG+LKEV EE+AKYKVGAPARVGL+A
Sbjct  61    MMKRSVRLHAEKTGNNAFLNLIPLLVGNVGLIFTKGELKEVREEIAKYKVGAPARVGLIA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPV++I+KG+KVGSSE+ALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVDIIKKGEKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VL+VYD+GSVFSPEVLDLT+DDL+ KFA GVSMV SLSL++S+PT+AAA
Sbjct  181   LGIRPFSYGLVVLTVYDSGSVFSPEVLDLTDDDLVAKFASGVSMVASLSLSLSFPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +NGYKNVLS+A+ ++YSFP A+KVKEYLKDPSKF
Sbjct  241   PHMFVNGYKNVLSVAMVSEYSFPQAEKVKEYLKDPSKF  278



>ref|NP_181530.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
 sp|O04204.1|RLA01_ARATH RecName: Full=60S acidic ribosomal protein P0-1 [Arabidopsis 
thaliana]
 gb|AAB95286.1| 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAN71918.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEC09763.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
Length=317

 Score =   461 bits (1187),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 234/278 (84%), Positives = 260/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKI YD KLCQLL+EY+QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKATKAEKKIVYDSKLCQLLNEYSQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HA+ TGN A L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHADKTGNQAFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVYDNGSVF+PEVL+LTEDDL+EKFA GVSM+T+LSLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITALSLAISYPTVAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL++A+ T+YSFP A+ VKE+LKDP+KF
Sbjct  241   PHMFLNAYKNVLAVALATEYSFPQAENVKEFLKDPTKF  278



>ref|XP_006360336.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=320

 Score =   461 bits (1185),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 229/278 (82%), Positives = 262/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K TK +KK+ YDQKLC+ LD Y QILI  ADNVGS+Q+Q IRKGLRGDSVVLMGKNT
Sbjct  1     MAIKPTKFEKKVIYDQKLCKYLDSYNQILIVNADNVGSSQMQGIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HA++TGN A LNLIPLLVGNVGLIFTKGDLKE+ EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHAKSTGNDAFLNLIPLLVGNVGLIFTKGDLKEIKEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DV+VPPGNTGLDPSQTSFFQVLNIPTKIN+GTVEIITPVELI+KGDKVGSSEAALL+K
Sbjct  121   PVDVIVPPGNTGLDPSQTSFFQVLNIPTKINRGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V+SVYDNGSVFSPEVLDLT++DL+EKFA GV+M+T+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVISVYDNGSVFSPEVLDLTDEDLVEKFAAGVAMMTTLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM++NGYKNVL +A+ET+Y++P A +VKEYLKDPSKF
Sbjct  241   PHMIVNGYKNVLCVALETEYTYPQAQQVKEYLKDPSKF  278



>emb|CDP16385.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   461 bits (1185),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 234/278 (84%), Positives = 258/278 (93%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M VK +KA+KKIAYDQKLC+LLDEY+ ILI  ADNVGSNQLQNIR+GLR +SV+LMGKNT
Sbjct  1     MVVKHSKAEKKIAYDQKLCKLLDEYSHILIVGADNVGSNQLQNIRRGLRAESVILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIRVHAENTGN   L+LIPLLVGNVGLIFTKGDLKE+SEEV+KYKVGAPARVGL+A
Sbjct  61    MMKRSIRVHAENTGNKNFLSLIPLLVGNVGLIFTKGDLKEISEEVSKYKVGAPARVGLIA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIT VELI+KGDKVGSSE+ALL+K
Sbjct  121   PDDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGDKVGSSESALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LG+RPFSYGLIV +VY+NGSVFSPEVLDLTEDDL  KF +G+SM TSLSL ISYP L+AA
Sbjct  181   LGVRPFSYGLIVQAVYENGSVFSPEVLDLTEDDLAVKFLVGLSMATSLSLEISYPALSAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHMLINGYKN L+IAVET+YSFP AD+VKEYLKDPSKF
Sbjct  241   PHMLINGYKNALAIAVETEYSFPQADEVKEYLKDPSKF  278



>gb|AID52928.1| 60S acidic ribosomal protein P0 [Carthamus tinctorius]
Length=321

 Score =   460 bits (1183),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 246/275 (89%), Positives = 264/275 (96%), Gaps = 0/275 (0%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             K +KA KKIAYDQKLCQLLD+YTQ+L+A ADNVGSNQLQNIR GLRGDSV+LMGKNTM+K
Sbjct  3     KVSKADKKIAYDQKLCQLLDDYTQVLVAAADNVGSNQLQNIRHGLRGDSVILMGKNTMMK  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             RS+R+H+E TGN A LNLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVAP+D
Sbjct  63    RSVRMHSEKTGNKAFLNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPVD  122

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAKLGI
Sbjct  123   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGI  182

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
             RPFSYGL+VL+VYDNGSVFSPEVLDLTEDDL+EKFALGVSMVTSL+LAI YPT+AAAPHM
Sbjct  183   RPFSYGLVVLTVYDNGSVFSPEVLDLTEDDLIEKFALGVSMVTSLALAIHYPTIAAAPHM  242

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             LIN YKN L+IAVETDYSFPLADKVKEYL+DPSKF
Sbjct  243   LINAYKNALAIAVETDYSFPLADKVKEYLEDPSKF  277



>ref|XP_002881693.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57952.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   459 bits (1180),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 234/278 (84%), Positives = 259/278 (93%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKI YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKGTKAEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HA+ TGN A LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRLHADKTGNKAFLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVYDNGSVF+PEVL+LTEDDL+EKFA GVSM+T++SLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITAISLAISYPTVAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL++A+ T+YSFP A+ VKE+LKDP+KF
Sbjct  241   PHMFLNAYKNVLAVALATEYSFPQAENVKEFLKDPTKF  278



>emb|CDY24932.1| BnaC03g22400D [Brassica napus]
Length=319

 Score =   458 bits (1178),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/278 (85%), Positives = 257/278 (92%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKI YD KLCQLL+EY QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKATKAEKKIVYDSKLCQLLNEYPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+++HA+ TGN   LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVKLHAQKTGNDGFLNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVYDNGSVF PEVL+LTEDDL+EKFA GVS+VT+LSLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDDLVEKFAAGVSLVTALSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YKNVL++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241   PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_010508934.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Camelina sativa]
Length=318

 Score =   457 bits (1175),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/278 (84%), Positives = 256/278 (92%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKI YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKATKAEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HA+ TGN A L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHADKTGNQAFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVYDNGSVF+PEVL+LTEDDL+EKFA GVSM T+LSLAISYPTLAAA
Sbjct  181   LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMTTALSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              HM +N YKN L++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241   THMFLNAYKNALAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_008457380.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis melo]
Length=320

 Score =   456 bits (1174),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 231/275 (84%), Positives = 256/275 (93%), Gaps = 0/275 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M +K T+AQKK  YDQKLC+LLDEY+Q+LI  ADNVGSNQLQ+IRKGLRGDS++LMGKNT
Sbjct  1     MVLKPTRAQKKTNYDQKLCRLLDEYSQVLIVGADNVGSNQLQSIRKGLRGDSIILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+H+E TGNTA+ NL+P LVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHSEKTGNTAVTNLLPHLVGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALL+K
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGLIV+SVYDNGSVFSP VLDLTE+DLLEKF  GVSMV SLSLA+S+PTLAAA
Sbjct  181   LGIRPFSYGLIVVSVYDNGSVFSPAVLDLTEEDLLEKFLAGVSMVASLSLAVSFPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  1014
             PHMLIN YKN L+IAV T+YSF  AD++KE+LKDP
Sbjct  241   PHMLINAYKNALAIAVATEYSFSEADEIKEFLKDP  275



>emb|CDY60988.1| BnaA03g56530D [Brassica napus]
Length=318

 Score =   456 bits (1172),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/278 (84%), Positives = 256/278 (92%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKI YD KLCQLL+E+ QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKATKAEKKIVYDSKLCQLLNEFPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+++HA+ TGN   LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVKLHAQKTGNDGFLNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVYDNGSVF PEVL+LTEDDL+EKFA GVS+VT+ SLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDDLVEKFAAGVSLVTAFSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YKNVL++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241   PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_010517390.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Camelina sativa]
Length=318

 Score =   455 bits (1171),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 232/278 (83%), Positives = 254/278 (91%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKI YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKATKAEKKIVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HA+ TGN   LNL+PLL GNVGLIF KGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRIHADKTGNQGFLNLLPLLQGNVGLIFNKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVYDNGSVF+PEVL+LTEDDL+EKFA GVSM+T+LSLA SYPTLAAA
Sbjct  181   LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITALSLAASYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKN L +A+ T+YSFP A+ VKE++KDPSKF
Sbjct  241   PHMFLNAYKNALVVALATEYSFPQAENVKEFVKDPSKF  278



>ref|XP_009133397.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Brassica rapa]
Length=319

 Score =   454 bits (1169),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 234/278 (84%), Positives = 256/278 (92%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KKI YD KLCQLL+E+ QILI  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKATKAEKKIVYDLKLCQLLNEFPQILIVAADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+++HA+ TGN   LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVKLHAQKTGNDGFLNLMPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V SVYDNGSVF PEVL+LTEDDL+EKFA GVS+VT+ SLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDDLVEKFAAGVSLVTAFSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YKNVL++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241   PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   454 bits (1168),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 260/319 (82%), Positives = 283/319 (89%), Gaps = 1/319 (0%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             K +KA+KKI YD KLC LL++Y Q+LI  ADNVGS QLQNIRKGLRGDS VLMGKNTM+K
Sbjct  3     KLSKAEKKINYDAKLCSLLEDYGQVLIVAADNVGSTQLQNIRKGLRGDSTVLMGKNTMMK  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             RSI++HA  TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63    RSIKIHAAKTGNDAYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAKLGI
Sbjct  123   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGI  182

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
             RPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+ KFA GVS VT+L+LAISYPT+AAAPHM
Sbjct  183   RPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMIKFASGVSNVTALALAISYPTIAAAPHM  242

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaeek  1098
              +N YKNVL+IAV T+YSFP ADKVKEYL+DPSKFAV+ A  AAAA G+A  AAAA EE 
Sbjct  243   FLNAYKNVLAIAVATEYSFPQADKVKEYLEDPSKFAVSVAAPAAAAGGAAAPAAAAKEEA  302

Query  1099  keepeeese-DEMGFSLFD  1152
             K+E   E   D+MGFSLFD
Sbjct  303   KKEEPAEESDDDMGFSLFD  321



>ref|XP_002440235.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
 gb|EES18665.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
Length=319

 Score =   454 bits (1168),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 246/322 (76%), Positives = 283/322 (88%), Gaps = 3/322 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYD+KLC LLDEYT++L+A+ADNVGS QLQ+IR+GLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDKKLCALLDEYTKVLVALADNVGSKQLQDIRRGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+V+AE TGN A   L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVYAEKTGNNAFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVSPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL +++VY++GSVFSPEVLDLTE+DL+EKF+ GVSMV SLSL +SYPTLAAA
Sbjct  181   LGIRPFSYGLQIVNVYEDGSVFSPEVLDLTEEDLVEKFSAGVSMVASLSLVVSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL++AVETDYS+P AD++KEYLKDPSKFAVAA   AA +  SA       
Sbjct  241   PHMFINGYKNVLAVAVETDYSYPHADEIKEYLKDPSKFAVAAPVAAADSGASAAPKEEEK  300

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
               + +E  +    EMGFSLFDD
Sbjct  301   APESDEESDG---EMGFSLFDD  319



>ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   452 bits (1164),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 234/275 (85%), Positives = 253/275 (92%), Gaps = 0/275 (0%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             K +KA+KKI YD KLC LL++Y Q+LI  ADNVGS QLQNIRKGLRGDS VLMGKNTM+K
Sbjct  3     KLSKAEKKINYDAKLCSLLEDYGQVLIVAADNVGSTQLQNIRKGLRGDSTVLMGKNTMMK  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             RSI++HA  TGN A LNL+PLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63    RSIKIHAAKTGNDAYLNLVPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAKLGI
Sbjct  123   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGI  182

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
             RPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+ KFA GVS VT+L+LAISYPT+AAAPHM
Sbjct  183   RPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMIKFASGVSNVTALALAISYPTIAAAPHM  242

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              +N YKNVL+IAV T+YSFP ADKVKEYL+DPSKF
Sbjct  243   FLNAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF  277



>ref|NP_001060923.1| Os08g0130500 [Oryza sativa Japonica Group]
 sp|P41095.3|RLA0_ORYSJ RecName: Full=60S acidic ribosomal protein P0 [Oryza sativa Japonica 
Group]
 pdb|3J61|QQ Chain q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA04668.1| acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAC66723.1| 60S acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAF22837.1| Os08g0130500 [Oryza sativa Japonica Group]
 dbj|BAG89244.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   450 bits (1157),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 237/278 (85%), Positives = 266/278 (96%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHADNTGNKEFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYD+GSVFSPEVLDLTEDDL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241   PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>ref|XP_006659092.1| PREDICTED: 60S acidic ribosomal protein P0-like [Oryza brachyantha]
Length=319

 Score =   449 bits (1155),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 236/278 (85%), Positives = 265/278 (95%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VHAE TGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHAEQTGNKEFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241   PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>gb|ABA95724.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ19563.1| hypothetical protein OsJ_35136 [Oryza sativa Japonica Group]
Length=320

 Score =   449 bits (1155),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 236/278 (85%), Positives = 266/278 (96%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241   PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>gb|ABA91328.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAY79838.1| hypothetical protein OsI_34997 [Oryza sativa Indica Group]
 gb|EAZ41411.1| hypothetical protein OsJ_25933 [Oryza sativa Japonica Group]
Length=320

 Score =   449 bits (1155),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 236/278 (85%), Positives = 266/278 (96%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241   PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>gb|EAY82182.1| hypothetical protein OsI_37384 [Oryza sativa Indica Group]
 emb|CBX24392.1| hypothetical_protein [Oryza glaberrima]
Length=320

 Score =   449 bits (1155),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 236/278 (85%), Positives = 266/278 (96%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241   PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   444 bits (1142),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 228/275 (83%), Positives = 250/275 (91%), Gaps = 0/275 (0%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             K +KA KK  YD KLC+LLD+Y Q+L+  ADNVGS QLQNIRKGLRGDS VLMGKNTM+K
Sbjct  3     KLSKADKKTNYDAKLCKLLDDYGQVLVVAADNVGSTQLQNIRKGLRGDSTVLMGKNTMMK  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             RSI++HA  TGN A L+L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVAPID
Sbjct  63    RSIKIHAARTGNDAYLSLVPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPID  122

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEII PVELI+KGDKVGSSEAALLAKLGI
Sbjct  123   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIMPVELIKKGDKVGSSEAALLAKLGI  182

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
             RPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+ KFA GVS VT+L++A+SYPT+AAAPHM
Sbjct  183   RPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMIKFASGVSNVTALAMAVSYPTIAAAPHM  242

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              +N YKNVL+IAV T+YSFP ADKVKEYL+DPSKF
Sbjct  243   FLNAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF  277



>ref|XP_006296009.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
 gb|EOA28907.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
Length=319

 Score =   444 bits (1142),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 226/278 (81%), Positives = 252/278 (91%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KK+ YD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLR DSVVLMGKNT
Sbjct  1     MAVKVTKAEKKVVYDSKLCQLLNEYPQILVVAADNVGSTQLQNIRKGLRRDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HA+ TGN A L+L+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV 
Sbjct  61    MMKRSVRIHADETGNQAFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVT  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL V SVYDNGSVF+PEVL+LTEDDL++KFA GVSM+T+LSLA SYPTLAAA
Sbjct  181   LGIRPFSYGLAVESVYDNGSVFNPEVLNLTEDDLVDKFAAGVSMITALSLAASYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNV+++A  T+YSFP ++ VKE LKDP+ +
Sbjct  241   PHMFLNAYKNVVAVAFATEYSFPRSENVKECLKDPTSW  278



>emb|CBX25428.1| hypothetical_protein [Oryza glaberrima]
Length=322

 Score =   444 bits (1141),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 236/280 (84%), Positives = 266/280 (95%), Gaps = 2/280 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KK+AYD+KLCQLLDEYT++LIAVADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVG--APARVGL  543
             +I+R I+VHA+NTGN   L L+PLLVGNVGLIFTKGDLKEV EEVAKYKVG  APARVGL
Sbjct  61    LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGVGAPARVGL  120

Query  544   VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  723
             VAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALL
Sbjct  121   VAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALL  180

Query  724   AKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLA  903
             AKLGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+A
Sbjct  181   AKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIA  240

Query  904   AAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             AAPHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241   AAPHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  280



>gb|KJB19895.1| hypothetical protein B456_003G123400 [Gossypium raimondii]
Length=321

 Score =   443 bits (1139),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 222/278 (80%), Positives = 251/278 (90%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M +   K +KK  YDQKLC+LLDEYTQ+L+  ADNVGS Q+QNIRKGLRGDS++LMGKNT
Sbjct  1     MVLNPAKREKKSQYDQKLCRLLDEYTQVLVVAADNVGSTQMQNIRKGLRGDSIILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN A  NL+PLLVGNVG IFTKGDLKEV EE+AKYKVGAPARVGLVA
Sbjct  61    MMKRSIRLHAERTGNDAFKNLLPLLVGNVGFIFTKGDLKEVREEIAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+T VELIRKG+KVGSSEAALL+K
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTAVELIRKGEKVGSSEAALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V+SVYDNG+VFSPEVLDLTEDDL+EKF   +S VTSLSLA+S+PTLAAA
Sbjct  181   LGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDDLMEKFRSWLSNVTSLSLAVSFPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM IN YK  LS+AV T+Y+FP A+K+KEYLKDP+KF
Sbjct  241   PHMFINAYKTALSLAVATEYTFPQAEKIKEYLKDPTKF  278



>ref|XP_012067847.1| PREDICTED: 60S acidic ribosomal protein P0-like [Jatropha curcas]
 gb|KDP46515.1| hypothetical protein JCGZ_08487 [Jatropha curcas]
Length=319

 Score =   440 bits (1131),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 222/278 (80%), Positives = 256/278 (92%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K TKAQKK  YDQKLC+LLDEY+QIL+  ADNVGSNQLQ+IR+GLRGDS+VLMGKNT
Sbjct  1     MAIKPTKAQKKTQYDQKLCRLLDEYSQILVVGADNVGSNQLQSIRRGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSI++HAE TGN A  +L+PLLVGNVGL+FTKGDLKEV EE+AKYKVGAPARVGL+A
Sbjct  61    MMKRSIKLHAEKTGNDAFNSLVPLLVGNVGLVFTKGDLKEVREEIAKYKVGAPARVGLIA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPG TGLDPS TSFFQ LNIPTKINKG+VEI+T V+LI+KG+KVGSSE+ALLAK
Sbjct  121   PIDVVVPPGPTGLDPSMTSFFQALNIPTKINKGSVEIVTAVDLIKKGEKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L IRPFSYGLIV SVYDNGSVFSPEVLDLTEDDL+E+F  GVSMVTSLSL+IS+PTLAAA
Sbjct  181   LQIRPFSYGLIVFSVYDNGSVFSPEVLDLTEDDLVERFVNGVSMVTSLSLSISFPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVLS++V T+Y+FP A++VKE+L+DPSKF
Sbjct  241   PHMFLNAYKNVLSVSVATEYTFPQAEQVKEFLEDPSKF  278



>ref|XP_009799989.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=319

 Score =   439 bits (1130),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 227/278 (82%), Positives = 251/278 (90%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KK+ YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAVKVTKAEKKVNYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN A L LIP LVGNVGLIFT+GDLKEVS+EV+KYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEKTGNNAFLALIPCLVGNVGLIFTRGDLKEVSDEVSKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI  PVE+I+KG+KVGSSE+ALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEITIPVEIIKKGEKVGSSESALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGI+PFSYGLIV  VYD+GSVFSPEVLDLTEDDL+ KFA G+S V  LS+ +SYPTLAA 
Sbjct  181   LGIKPFSYGLIVQFVYDSGSVFSPEVLDLTEDDLIAKFAAGLSNVVGLSMLLSYPTLAAI  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM INGYKNVLS A+ T+YSFP A+KVKEYLKDPSKF
Sbjct  241   PHMFINGYKNVLSFAIATEYSFPQAEKVKEYLKDPSKF  278



>ref|XP_010234277.1| PREDICTED: 60S acidic ribosomal protein P0 [Brachypodium distachyon]
Length=321

 Score =   438 bits (1126),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 258/322 (80%), Positives = 288/322 (89%), Gaps = 1/322 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYD+KLCQLL+EY+++LIAVADNVGS QLQ IRKGLRGDSVVLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDKKLCQLLEEYSKVLIAVADNVGSKQLQEIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VH+E TGN   L L  LL+GNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHSEKTGNKDYLELSNLLIGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+DL++KFA GVSMV SLSLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVINNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL+IAVETDYS+P  DK+KEYLKDPSKFAVAA   AAA+ G+A AA    
Sbjct  241   PHMFINAYKNVLAIAVETDYSYPHGDKIKEYLKDPSKFAVAAPAAAAASGGAAAAAPKEE  300

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
             E+K E  EE    EMGFSLFDD
Sbjct  301   EKKDEPEEESDG-EMGFSLFDD  321



>gb|KDO69056.1| hypothetical protein CISIN_1g036252mg [Citrus sinensis]
Length=318

 Score =   437 bits (1124),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 221/278 (79%), Positives = 250/278 (90%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA + +KA+KKIAYD +LC+LL+EY+QILI  ADNVGSNQLQ+IR GLR  S+VLMGKNT
Sbjct  1     MATRLSKAEKKIAYDARLCKLLEEYSQILIVAADNVGSNQLQHIRAGLRDHSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN  +LNLIPLL GNVG+IFTKGDLKEVS+EV+K+KV APARVGLVA
Sbjct  61    MMKRSIRLHAERTGNRDLLNLIPLLQGNVGMIFTKGDLKEVSDEVSKHKVAAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGD+VGSSE+ALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDRVGSSESALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L I+PFSYGLIV+SVY+NGSV+SPEVLDLTEDD+  KF   VS V SL+L+I YPT+AAA
Sbjct  181   LAIKPFSYGLIVMSVYENGSVYSPEVLDLTEDDIATKFLEAVSRVASLALSIRYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PH  INGYKNVLS AV T+YSF  ADKVKEYLKDPSKF
Sbjct  241   PHFFINGYKNVLSFAVATEYSFSQADKVKEYLKDPSKF  278



>ref|XP_006435696.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
 ref|XP_006486351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48936.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
Length=318

 Score =   437 bits (1124),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 221/278 (79%), Positives = 250/278 (90%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA + +KA+KKIAYD +LC+LL+EY+QILI  ADNVGSNQLQ+IR GLR  S+VLMGKNT
Sbjct  1     MATRLSKAEKKIAYDARLCKLLEEYSQILIVAADNVGSNQLQHIRAGLRDHSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN  +LNLIPLL GNVG+IFTKGDLKEVS+EV+K+KV APARVGLVA
Sbjct  61    MMKRSIRLHAERTGNRDLLNLIPLLQGNVGMIFTKGDLKEVSDEVSKHKVAAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGD+VGSSE+ALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDRVGSSESALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L I+PFSYGLIV+SVY+NGSV+SPEVLDLTEDD+  KF   VS V SL+L+I YPT+AAA
Sbjct  181   LAIKPFSYGLIVMSVYENGSVYSPEVLDLTEDDIATKFLEAVSRVASLALSIRYPTIAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PH  INGYKNVLS AV T+YSF  ADKVKEYLKDPSKF
Sbjct  241   PHFFINGYKNVLSFAVATEYSFSQADKVKEYLKDPSKF  278



>ref|XP_004241171.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=318

 Score =   436 bits (1121),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/278 (80%), Positives = 251/278 (90%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KK+ YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAVKVTKAEKKVNYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN A L LI  LVGNVGLIFTKGDLKEVS+EV+KYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEKTGNNAFLALIECLVGNVGLIFTKGDLKEVSDEVSKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVE+I+KG+KVGSSE+ALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVEIIKKGEKVGSSESALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L I+PFSYGLIV SVYDNGSVFSPEVL+LT++DL+ +FA G++ V  LS+ ++YPTLAA 
Sbjct  181   LLIKPFSYGLIVQSVYDNGSVFSPEVLELTDNDLVARFAAGLTNVVGLSMTLNYPTLAAI  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PH+ IN YKNVLS A+ T+YSFP A+KVKEYLKDPSKF
Sbjct  241   PHIFINSYKNVLSFAIATEYSFPQAEKVKEYLKDPSKF  278



>dbj|BAJ92405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   436 bits (1121),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 249/322 (77%), Positives = 284/322 (88%), Gaps = 2/322 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYDQKLCQLL+EYT++LIAVADNVGS QLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDQKLCQLLEEYTKVLIAVADNVGSKQLQEIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VH+E TGN   L L  LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHSEKTGNKDFLELSNLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI  PVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEITIPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+DL++KFA GVSMV SLSLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVICNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTMAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVL++A+ETDYS+  ADK+KEYLKDPSKFAVAA   AA+   +A A     
Sbjct  241   PHMFLNAYKNVLAVALETDYSYDHADKIKEYLKDPSKFAVAAPAAAASGGAAAAAPKEEE  300

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
             ++++ E E +   EMGFSLFDD
Sbjct  301   KKEEPEEESDG--EMGFSLFDD  320



>ref|XP_009592351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=319

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 223/278 (80%), Positives = 250/278 (90%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TK +KK+ YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAVKVTKGEKKVNYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN + L LIP LVGNVGLIFT+GDLKEVS+EV+KYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEKTGNNSFLALIPCLVGNVGLIFTRGDLKEVSDEVSKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKIN+GTVEI  PVE+I+KG+KVGSSE+ALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINRGTVEITIPVEIIKKGEKVGSSESALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGI+PFSYGLIV  VYD+GSVFSPEVLDLTE+DL+ KFA G+S V  LS+ +SYPTLAA 
Sbjct  181   LGIKPFSYGLIVQFVYDSGSVFSPEVLDLTENDLIAKFAAGLSNVVGLSMLLSYPTLAAI  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM INGYKNVLS A+ T+YSFP A+KVKEYLKDPSKF
Sbjct  241   PHMFINGYKNVLSFAIATEYSFPQAEKVKEYLKDPSKF  278



>gb|ACL52455.1| unknown [Zea mays]
Length=319

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 258/322 (80%), Positives = 289/322 (90%), Gaps = 3/322 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL V SVY++GSVFSPEVLDL+E+DL+EKFA GVSMV SLSLA+SYPTLAA 
Sbjct  181   LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLALSYPTLAAV  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF   A    AAAA S+ AAA   
Sbjct  241   PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF---AVAAPAAAADSSAAAAPKE  297

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
             EEK  EP EES++EMGFSLFDD
Sbjct  298   EEKAPEPAEESDEEMGFSLFDD  319



>ref|NP_001141489.1| hypothetical protein [Zea mays]
 gb|ACF86473.1| unknown [Zea mays]
 gb|AFW61287.1| hypothetical protein ZEAMMB73_391125 [Zea mays]
Length=319

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 257/322 (80%), Positives = 288/322 (89%), Gaps = 3/322 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL V SVY++GSVFSPEVLDL+E+DL+EKFA GVSMV SLSLA+SYPTLAA 
Sbjct  181   LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLALSYPTLAAV  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF   A     AAA S+ AAA   
Sbjct  241   PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF---AVAAPVAAADSSAAAAPKE  297

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
             EEK  EP EES++EMGFSLFDD
Sbjct  298   EEKAPEPAEESDEEMGFSLFDD  319



>ref|XP_001759592.1| predicted protein [Physcomitrella patens]
 gb|EDQ75504.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 247/321 (77%), Positives = 278/321 (87%), Gaps = 2/321 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K TKA+KK  YD+KL QLL+EY+Q+LI  ADNVGS QLQ IRKGLR DS+VLMGKNT
Sbjct  1     MGFKGTKAEKKALYDKKLVQLLEEYSQVLICAADNVGSKQLQEIRKGLRPDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN     L+P LVGNVGLIFTKGDLKEV EE+AKYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEKTGNKDYEELLPALVGNVGLIFTKGDLKEVREEIAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEII PVEL+ KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIAPVELVHKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V+++YDNGSVF+PEVLDLTEDDLL+KFA GVS V ++SLA++YPTLAA 
Sbjct  181   LGIRPFSYGLVVVNIYDNGSVFAPEVLDLTEDDLLDKFAAGVSTVAAVSLALNYPTLAAV  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PH  +N YKN+L+IAVET+YSFPLA+K KEYLKDPSKF  A A   AA   S+  AAAA 
Sbjct  241   PHSFVNSYKNLLAIAVETEYSFPLAEKTKEYLKDPSKF--AVAAAPAATESSSAPAAAAK  298

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EE+K E +EES+D+MGFSLFD
Sbjct  299   EEEKVEEKEESDDDMGFSLFD  319



>gb|EMT17099.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=320

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 249/322 (77%), Positives = 283/322 (88%), Gaps = 2/322 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYDQKLCQLL+EYT++LIAVADNVGS QLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDQKLCQLLEEYTKVLIAVADNVGSKQLQEIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VH+E TGN   L L  LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHSEKTGNKDFLELSNLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI  PVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEITIPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+DL++KFA GVSMV SLSLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVICNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTMAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVL++A+ETDYS+  ADK+KEYLKDPSKFAVAA   AA+   +A A     
Sbjct  241   PHMFLNAYKNVLAVALETDYSYDHADKIKEYLKDPSKFAVAAPAAAASGGAAAAAPKEEE  300

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
             ++ + E E +   EMGFSLFDD
Sbjct  301   KKDEPEEESDG--EMGFSLFDD  320



>sp|P50345.1|RLA0_LUPLU RecName: Full=60S acidic ribosomal protein P0 [Lupinus luteus]
 emb|CAA63786.1| P0 ribosomal protein [Lupinus luteus]
Length=322

 Score =   435 bits (1119),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 259/322 (80%), Positives = 279/322 (87%), Gaps = 0/322 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKI YD KLCQLLDEYTQIL+  ADNVGS QLQNIR+GLRGDSVVLMGKNT
Sbjct  1     MAPKATKAEKKIVYDGKLCQLLDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLL+GNVGLIFTKG LKEVSEEVAKYKVGAPA VGLVA
Sbjct  61    MMKRSVRIHAEKTGNQAFLNLIPLLIGNVGLIFTKGYLKEVSEEVAKYKVGAPACVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVF PEVLDLTEDDLLEKFA+GVS       +   P  +AA
Sbjct  181   LGIRPFSYGLVVLSVYDNGSVFKPEVLDLTEDDLLEKFAIGVSQCYFSDTSHFIPNPSAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PH+ IN YKNVL++AV T+YSFP AD+VKEYLKDPSKFA  AA  A AA   A  AAAA 
Sbjct  241   PHVFINAYKNVLAVAVATEYSFPQADEVKEYLKDPSKFAAVAAAAAPAADSGAAPAAAAK  300

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
              EK+EEP EES+DEMGF LFD+
Sbjct  301   AEKEEEPAEESDDEMGFGLFDE  322



>ref|XP_001759851.1| predicted protein [Physcomitrella patens]
 gb|EDQ75355.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   435 bits (1118),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 247/321 (77%), Positives = 280/321 (87%), Gaps = 3/321 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K TKA+KK+ YD+KL QLL+EYTQ+LI  ADNVGS QLQ+IRKGLR DS+VLMGKNT
Sbjct  1     MGFKGTKAEKKVLYDKKLIQLLEEYTQVLICAADNVGSKQLQSIRKGLRPDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN     L+P LVGNVGLIFTKGDLKEV EE+ KYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEKTGNKDYEELLPALVGNVGLIFTKGDLKEVREEIGKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEII PVEL+ KGDKVGSSEAALLAK
Sbjct  121   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIAPVELVHKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V+++YDNGS+F+PEVLDLTEDDLL+KFA GVS V ++SLA++YPTLAA 
Sbjct  181   LGIRPFSYGLVVVNIYDNGSLFAPEVLDLTEDDLLDKFAAGVSTVAAVSLALNYPTLAAV  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PH  +N YKN+L+IAVET+YSFPLA+K KEYLKDPSKF   AA  A  AA SA  AAAA 
Sbjct  241   PHSFVNAYKNLLAIAVETEYSFPLAEKTKEYLKDPSKF---AAATAPVAAESAAPAAAAK  297

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EE+K E +EES+D+MGFSLFD
Sbjct  298   EEEKPEEKEESDDDMGFSLFD  318



>gb|EMT02739.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=322

 Score =   435 bits (1118),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 220/279 (79%), Positives = 253/279 (91%), Gaps = 1/279 (0%)
 Frame = +1

Query  190   MAVKQ-TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKN  366
             MA+K+ +K  KK AYDQKLCQLLDEY+++L+A ADNVGS+QL  IR+G+RG+SV+LMGKN
Sbjct  1     MAIKKPSKTDKKHAYDQKLCQLLDEYSRVLVASADNVGSSQLAEIRRGIRGESVMLMGKN  60

Query  367   TMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLV  546
             T+I+R I  HAE +GN  +  LIPLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGL+
Sbjct  61    TLIRRCIAAHAERSGNADVKALIPLLQGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLI  120

Query  547   APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLA  726
             APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG+VEI+  V+LI+KGDKVGSSEA LLA
Sbjct  121   APIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGSVEIVAHVDLIKKGDKVGSSEATLLA  180

Query  727   KLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAA  906
             KLGIRPFSYGL++ +VY +GSVFSPEVLDLTE+DL+EKFA GVSMV SLSLA+SYPTLAA
Sbjct  181   KLGIRPFSYGLVITNVYGDGSVFSPEVLDLTEEDLMEKFACGVSMVASLSLAVSYPTLAA  240

Query  907   APHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             APHM +NGYKNVL++AVETDYSFP AD++KEYLKDPSKF
Sbjct  241   APHMFLNGYKNVLALAVETDYSFPHADQIKEYLKDPSKF  279



>dbj|BAJ94456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   434 bits (1117),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 230/278 (83%), Positives = 258/278 (93%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYDQKLCQLL+EYT++LIAVADNVGS QLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDQKLCQLLEEYTKVLIAVADNVGSKQLQEIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+VH+E TGN   L L  LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVHSEKTGNKDFLELSNLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI  PVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEITIPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL++ +VYD+GSVFSPEVLDLTE+DL++KFA GVSMV SLSLAISYPT+AAA
Sbjct  181   LGIRPFSYGLVICNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTMAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM +N YKNVL++A+ETDYS+  ADK+KEYLKDPSKF
Sbjct  241   PHMFLNAYKNVLAVALETDYSYDHADKIKEYLKDPSKF  278



>gb|ACF83717.1| unknown [Zea mays]
 gb|AFW74477.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   434 bits (1115),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 233/278 (84%), Positives = 260/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL V SVY++GSVFSPEVLDL+E+DL+EKFA GVSMV SLSLAISYPTLAA 
Sbjct  181   LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAV  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF
Sbjct  241   PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>ref|NP_001105482.1| 60S acidic ribosomal protein P0 [Zea mays]
 sp|O24573.3|RLA0_MAIZE RecName: Full=60S acidic ribosomal protein P0 [Zea mays]
 emb|CAA69256.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   434 bits (1115),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 233/278 (84%), Positives = 260/278 (94%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL V SVY++GSVFSPEVLDL+E+DL+EKFA GVSMV SLSLAISYPTLAA 
Sbjct  181   LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAV  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF
Sbjct  241   PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>ref|XP_002445000.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
 gb|EES14495.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
Length=319

 Score =   432 bits (1111),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 232/278 (83%), Positives = 259/278 (93%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1     MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+ +AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKAYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL V +VY++GSVFSPEVLDL+E+DL+EKFA GVSMV SLSLAISYPTLAA 
Sbjct  181   LGIRPFSYGLQVTNVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAV  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF
Sbjct  241   PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>ref|XP_004972933.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   432 bits (1111),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 256/322 (80%), Positives = 287/322 (89%), Gaps = 3/322 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KK AYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1     MAIKRTKAEKKQAYDRKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+ +A+ TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKAYADKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL +++VY++GSVFSPEVLDLTEDDL+EKFA GVSMV SLSLA+SYPTLAAA
Sbjct  181   LGIRPFSYGLQIVNVYEDGSVFSPEVLDLTEDDLVEKFATGVSMVASLSLALSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF   A     AA GS  AAA   
Sbjct  241   PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF---AVAAPVAAVGSGAAAAPKE  297

Query  1090  eekkeepeeeseDEMGFSLFDD  1155
             EEK  EP EES++EMGFSLFDD
Sbjct  298   EEKAPEPAEESDEEMGFSLFDD  319



>gb|ADU04571.1| 60S acidic ribosomal protein PO [Phaseolus vulgaris]
 gb|AGV54610.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   432 bits (1110),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 257/321 (80%), Positives = 272/321 (85%), Gaps = 1/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA K TKA+KKIAYD KLCQLL+EY QIL+  ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAPKATKAEKKIAYDGKLCQLLEEYGQILVVNADNVGSTQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H+E TGN   LNLIPLL+GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHSEKTGNNVYLNLIPLLIGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKG+KVGSSE   LA 
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSELHCLAS  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L  RP   GL  L       VFSPE  DLTEDDLLEKFA GVSMVT LSLAISYPTLAAA
Sbjct  181   LAFRPSHMGLGALLFIKMAPVFSPEGPDLTEDDLLEKFAAGVSMVTFLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKN+LS+A+ TDYSFP ADKVKEYLKDPSKF   AA  A AAA  APAAAA  
Sbjct  241   PHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKDPSKF-AVAAVAAPAAASGAPAAAAKE  299

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEK EEP EES+D+MGFSLFD
Sbjct  300   EEKMEEPAEESDDDMGFSLFD  320



>ref|XP_004958562.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   430 bits (1106),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 255/321 (79%), Positives = 288/321 (90%), Gaps = 2/321 (1%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MA+K+TKA+KK AYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1     MAIKRTKAEKKQAYDRKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             +I+R I+ +A+ TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LIRRCIKAYADKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121   PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL V++VY++GSVFSPEVLDLTE+DL+EKFA GVSMV SLSLA+SYPTLAAA
Sbjct  181   LGIRPFSYGLQVINVYEDGSVFSPEVLDLTEEDLIEKFATGVSMVASLSLALSYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF  AAA   A+A   A AA    
Sbjct  241   PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF--AAAAPVASADSGAAAAPKEE  298

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             E+K EEP EES+D+MGFSLFD
Sbjct  299   EKKAEEPAEESDDDMGFSLFD  319



>ref|XP_006350830.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=318

 Score =   430 bits (1105),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 248/276 (90%), Gaps = 0/276 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK TKA+KK +YD+KLC+LLD Y QILI  ADNVGSNQLQ IRKGLRGDS+VLMGKNT
Sbjct  1     MAVKVTKAEKKASYDKKLCKLLDTYQQILIVGADNVGSNQLQMIRKGLRGDSIVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRSIR+HAE TGN A L LI  LVGNVGLIFTKGDLKEVS+EV+KYKVGAPARVGLVA
Sbjct  61    MMKRSIRIHAEKTGNNAFLALIECLVGNVGLIFTKGDLKEVSDEVSKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVE+I+KG+KVGSSE+ALL+K
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVEIIKKGEKVGSSESALLSK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L I+PFSYGLIV SVYDNGSVFSPEVL+LT++DL+ +FA G++ V  LS+ + YPTLAA 
Sbjct  181   LLIKPFSYGLIVQSVYDNGSVFSPEVLELTDNDLVARFAAGLTNVVGLSMILDYPTLAAI  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  1017
             PHM IN YKNVLS A+ T+YSFP A+KVKEYLK+PS
Sbjct  241   PHMFINSYKNVLSFAIATEYSFPQAEKVKEYLKNPS  276



>emb|CBI25508.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   428 bits (1101),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 252/321 (79%), Positives = 268/321 (83%), Gaps = 29/321 (9%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYDQKLCQLLDEY+QILIA ADN                         
Sbjct  1     MAVKPSKADKKIAYDQKLCQLLDEYSQILIAAADN-------------------------  35

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
                RSIR+HAE TGNTA LNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  36    ---RSIRLHAEKTGNTAFLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  92

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  93    PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  152

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  153   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFAAGVSMVTSLSLAISYPTLAAA  212

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++AV T+YSFP ADKVKEYLKDPSKF   A     A+   A  AA+  
Sbjct  213   PHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF-AVATAPVTASDAGAAPAASKE  271

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP+EES+D+MGFSLFD
Sbjct  272   EEKKEEPQEESDDDMGFSLFD  292



>emb|CBI31491.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   427 bits (1098),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 253/321 (79%), Positives = 265/321 (83%), Gaps = 29/321 (9%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYDQKLCQLLDEYTQILIA ADN                         
Sbjct  1     MAVKPSKADKKIAYDQKLCQLLDEYTQILIAAADN-------------------------  35

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
                RSIR+HAE TGN A LNLIPLLVGNVGLIFT+GDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  36    ---RSIRLHAEKTGNQAFLNLIPLLVGNVGLIFTRGDLKEVSEEVAKYKVGAPARVGLVA  92

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK
Sbjct  93    PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  152

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  153   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLMEKFAAGVSMVTSLSLAISYPTLAAA  212

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM +N YKNVLS+AV TDYSFP ADKVKE+LKDPSKF   A    AAA     AA    
Sbjct  213   PHMFVNAYKNVLSVAVATDYSFPQADKVKEFLKDPSKF-AVAVAPVAAADAGGSAAPPKE  271

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP EES+D+MGFSLFD
Sbjct  272   EEKKEEPAEESDDDMGFSLFD  292



>emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera]
Length=303

 Score =   426 bits (1095),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 251/321 (78%), Positives = 274/321 (85%), Gaps = 18/321 (6%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYDQKLCQLLDEY+QILIA ADNVGSNQLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDQKLCQLLDEYSQILIAAADNVGSNQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KR I           +L+ + L+V +         ++EVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRMI---------FCLLSFVCLVVJS--------PIREVSEEVAKYKVGAPARVGLVA  103

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  104   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  163

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+VLSVYDNGSVFSPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  164   LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFAAGVSMVTSLSLAISYPTLAAA  223

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM IN YKNVL++AV T+YSFP ADKVKEYLKDPSKF   A     A+   A  AA+  
Sbjct  224   PHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF-AVATAPVTASDAGAAPAASKE  282

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKKEEP+EES+D+MGFSLFD
Sbjct  283   EEKKEEPQEESDDDMGFSLFD  303



>ref|XP_004296403.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   419 bits (1078),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 227/275 (83%), Positives = 248/275 (90%), Gaps = 0/275 (0%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             K +KA+KKI YD KLC+ LDEY QILI  ADNVGSNQLQNIR+GLRG SVVLMGKNTM+K
Sbjct  3     KLSKAEKKINYDAKLCKHLDEYGQILIVAADNVGSNQLQNIRQGLRGHSVVLMGKNTMMK  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             RSI++HAE T N AILNL+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVAP+D
Sbjct  63    RSIKIHAEKTRNDAILNLVPLLVGNVGLIFTKGDLKEVKEEVAKYKVGAPARVGLVAPVD  122

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALL+KL I
Sbjct  123   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSKLAI  182

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
             RPFSYGL+V  VYDNGSVFSPEVLDLTE+DL  KFA   S V +L+LAISYPT+ AAPHM
Sbjct  183   RPFSYGLVVQMVYDNGSVFSPEVLDLTEEDLAVKFASSASNVAALALAISYPTVVAAPHM  242

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              +N YKNVL++AV T++SFP ADKVKEYLKDPSKF
Sbjct  243   FLNAYKNVLAVAVATEFSFPQADKVKEYLKDPSKF  277



>ref|XP_003573632.1| PREDICTED: 60S acidic ribosomal protein P0-like [Brachypodium 
distachyon]
Length=323

 Score =   416 bits (1069),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 210/266 (79%), Positives = 243/266 (91%), Gaps = 0/266 (0%)
 Frame = +1

Query  226   AYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHAEN  405
             AYD+KLCQLLDEY ++L+A A++VGS QL  IR+G+RG+SV+LMGKNT+I+R I VHA +
Sbjct  16    AYDKKLCQLLDEYPKVLVASANHVGSTQLAAIRRGIRGESVMLMGKNTLIRRCINVHAVD  75

Query  406   TGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTG  585
             TGN  I  L+PLL GNVGLIFTKGDLKEV EEVAKYKVGAPARVGL+APIDVVVP GNTG
Sbjct  76    TGNENIKALVPLLQGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLIAPIDVVVPAGNTG  135

Query  586   LDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIV  765
             LDP+QTSFFQVLNIPTKINKGTVEII  V+LI+KGDKVGSSEAALLAKLGIRPFSYGL++
Sbjct  136   LDPTQTSFFQVLNIPTKINKGTVEIIANVDLIKKGDKVGSSEAALLAKLGIRPFSYGLVI  195

Query  766   LSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVL  945
               VYD+GSVFSPEVLDLTE+DL+E+FA GVSMV SLSLA+SYPT+AAAPHM +NGYKNVL
Sbjct  196   TQVYDDGSVFSPEVLDLTEEDLMERFASGVSMVASLSLAVSYPTMAAAPHMFLNGYKNVL  255

Query  946   SIAVETDYSFPLADKVKEYLKDPSKF  1023
             ++A+ETDYS+P AD++KEYLKDPSKF
Sbjct  256   AVALETDYSYPHADQIKEYLKDPSKF  281



>ref|XP_006407705.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49158.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=298

 Score =   413 bits (1061),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 215/276 (78%), Positives = 238/276 (86%), Gaps = 24/276 (9%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+  ADNVGS QLQ+IRKGLRGDSVVLMGKNTM+
Sbjct  2     VKATKAEKKIAYDAKLCQLVDEYTQILVVAADNVGSTQLQSIRKGLRGDSVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             KRS+R+HAENTGNT I+NL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  62    KRSVRIHAENTGNTGIMNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  121

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDK             
Sbjct  122   DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDK-------------  168

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
                        SVYDNGSVFSPEVL+LTEDDL+EKFA G+SMVTSL+LA+SYPT+AAAPH
Sbjct  169   -----------SVYDNGSVFSPEVLNLTEDDLVEKFAAGISMVTSLALAVSYPTIAAAPH  217

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  218   MFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  253



>ref|XP_002983859.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
 gb|EFJ14871.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
Length=322

 Score =   412 bits (1058),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 210/278 (76%), Positives = 242/278 (87%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K TK +KK  YD+K+  LL+ YT+ LI  ADNVGS QLQ IR+GLR +SVVLMGKNT
Sbjct  1     MGFKGTKQEKKEIYDRKMVDLLENYTKALICAADNVGSTQLQQIRRGLRPESVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             ++KR+IR +AE +GNTA+L+L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LMKRTIRTYAERSGNTAVLSLMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV +PPG+TGLDPSQTSFFQVLNIPTKINKGTVEI++ VELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKGTVEIVSSVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V  VYD+GSVF P VLDLTEDDL+ +FA GVS V +LSLAI YPTLAAA
Sbjct  181   LGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDDLVGRFAAGVSAVAALSLAIGYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              H  +N YKNVL++A+ TDYS+P A+ VKEYLKDPSKF
Sbjct  241   THCFLNSYKNVLAVALATDYSYPHAETVKEYLKDPSKF  278



>ref|XP_002974292.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
 ref|XP_002985667.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ13245.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ24514.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
Length=318

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 209/278 (75%), Positives = 242/278 (87%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K TK +KK  YD+K+  LL+ Y++ LI  ADNVGSNQLQ IR+GLR +SVVLMGKNT
Sbjct  1     MGFKGTKQEKKEVYDRKMVDLLETYSKALICAADNVGSNQLQQIRRGLRPESVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             ++KR+IR +AE +GNT +L+L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LMKRTIRTYAEKSGNTTVLSLMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV +PPG+TGLDPSQTSFFQVLNIPTKINKGTVEI++ VELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKGTVEIVSSVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V  VYD+GSVF P VLDLTEDDL+ +FA GVS V +LSLAI YPTLAAA
Sbjct  181   LGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDDLVGRFAAGVSAVAALSLAIGYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              H  +N YKNVL++A+ TDYS+P A+ VKEYLKDPSKF
Sbjct  241   SHYFLNSYKNVLAVALATDYSYPQAETVKEYLKDPSKF  278



>ref|XP_002960810.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
 gb|EFJ38349.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
Length=321

 Score =   409 bits (1052),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 233/321 (73%), Positives = 268/321 (83%), Gaps = 0/321 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K TK +KK  YD+K+  LL+ YT+ LI  ADNVGS QLQ IR+GLR +SVVLMGKNT
Sbjct  1     MGFKGTKQEKKEIYDRKMVDLLENYTKALICAADNVGSTQLQQIRRGLRPESVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             ++KR+IR +AE +GN A+L+L+PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61    LMKRTIRTYAERSGNMAVLSLMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV +PPG+TGLDPSQTSFFQVLNIPTKINKGTVEI++ VELI+KG+KVGSSEAALLAK
Sbjct  121   PIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKGTVEIVSSVELIKKGEKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LGIRPFSYGL+V  VYD+GSVF P VLDLTEDDL+ +FA GVS V +LSLAI YPTLAAA
Sbjct  181   LGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDDLVGRFATGVSAVAALSLAIGYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
              H  +N YKNVL++A+ TDYS+P A+  KEYLKDPSKFAVAAAP A+     A       
Sbjct  241   THYFLNSYKNVLAVALATDYSYPHAETAKEYLKDPSKFAVAAAPAASETPADAAGGGKVE  300

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MG SLFD
Sbjct  301   EEKKVEPEEESDDDMGLSLFD  321



>ref|XP_010685586.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=324

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/282 (71%), Positives = 247/282 (88%), Gaps = 0/282 (0%)
 Frame = +1

Query  178   LTVSMAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLM  357
             + ++    ++K +KK  Y  KL +L+D+Y+++L+ +ADNVGSNQLQ IR+GLRGDS+VLM
Sbjct  1     MAITKGGSRSKMEKKEIYSAKLRRLIDDYSKVLVVLADNVGSNQLQQIRQGLRGDSIVLM  60

Query  358   GKNTMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARV  537
             GKNT++KR+++ H + TGN AI  L+ LLVGNVGLIFTKGDLKEVSEE+ KYKVGAPARV
Sbjct  61    GKNTLMKRALKTHMDETGNKAIKPLMNLLVGNVGLIFTKGDLKEVSEELGKYKVGAPARV  120

Query  538   GLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAA  717
             GLVAPIDVV+PPGNTGLDPSQTSFFQ LNIPTKINKGTVEIITPVE+I+KGDKVGSSEA 
Sbjct  121   GLVAPIDVVIPPGNTGLDPSQTSFFQALNIPTKINKGTVEIITPVEIIKKGDKVGSSEAM  180

Query  718   LLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPT  897
             LL+KL I+PFSYGL+V  V+++GSV+ PE+LDLTEDDL  KFA GV+ VT+L+LAISYPT
Sbjct  181   LLSKLAIKPFSYGLVVQKVFEDGSVYDPEILDLTEDDLALKFAAGVANVTALALAISYPT  240

Query  898   LAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             +AAAPHM IN YKNVL+++V TDY+FP A+++KEYLKDPSKF
Sbjct  241   IAAAPHMFINAYKNVLAVSVATDYTFPEAEEIKEYLKDPSKF  282



>emb|CAN65663.1| hypothetical protein VITISV_014917 [Vitis vinifera]
Length=379

 Score =   405 bits (1040),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/278 (75%), Positives = 240/278 (86%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK ++A+KK+ YDQKLC+LLDEY+QILI   DN+GS QLQ+I + LRG SVVLMG NT
Sbjct  1     MAVKLSRAKKKVQYDQKLCRLLDEYSQILIVAVDNMGSKQLQDIHRALRGHSVVLMGNNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+H E TGN A L+LIPLLVGN+GLIFTK DLK VS+EVAKYK GAPAR G+VA
Sbjct  61    MMKRSVRLHVEMTGNKAFLSLIPLLVGNIGLIFTKEDLKGVSDEVAKYKXGAPARXGVVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVV+ PG+TGLDP+ TSFFQVLNIPTKINKG VEI+ PV+L++KGDKVGSSEAALLAK
Sbjct  121   PIDVVIQPGSTGLDPAXTSFFQVLNIPTKINKGAVEIVVPVQLVKKGDKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LG + FSYGL+VLSV DNGSVFSP+VLDLT+DDL EKF+ GVSM  SLSLAISYPTLAAA
Sbjct  181   LGKKXFSYGLVVLSVXDNGSVFSPKVLDLTDDDLAEKFSAGVSMKASLSLAISYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              HM IN   NVL++AV  +YSFP A +VKEYLKDPSKF
Sbjct  241   LHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDPSKF  278



>ref|NP_001078125.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 gb|AEE74737.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=287

 Score =   399 bits (1026),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 231/276 (84%), Gaps = 33/276 (12%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK TKA+KKIAYD KLCQL+DEYTQIL+                                
Sbjct  2     VKATKAEKKIAYDTKLCQLIDEYTQILV--------------------------------  29

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
              RS+R+H+ENTGNTAILNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI
Sbjct  30    -RSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  88

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALLAKLG
Sbjct  89    DVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLG  148

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             IRPFSYGL+V SVYDNGSVFSPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAAPH
Sbjct  149   IRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPH  208

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             M IN YKN L+IAV T+Y+FP A+KVKEYLKDPSKF
Sbjct  209   MFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  244



>ref|XP_002967451.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
 gb|EFJ32050.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
Length=323

 Score =   399 bits (1026),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 204/278 (73%), Positives = 234/278 (84%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K TK +KK AYD KLC+ LD+Y + LI  ADNVGSNQ+Q IR+GLR DSVVLMGKNT
Sbjct  1     MGFKGTKLEKKEAYDLKLCKYLDDYARALICAADNVGSNQMQQIRQGLRPDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             ++KR+IR +AE TGN  +LNLIPLLVGNVGL+FT+GDLKEV E +AKYKVGAPARVGLVA
Sbjct  61    LMKRTIRKYAEKTGNRDVLNLIPLLVGNVGLVFTRGDLKEVREVIAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV + PG+TGLDPS TSFFQ LNIPTKINKGTVEI++ VELI KG KVGSSEAALLAK
Sbjct  121   PIDVTIQPGSTGLDPSHTSFFQALNIPTKINKGTVEIVSSVELISKGTKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L IRPFSYGL+V  VYD+GSVF P VLDLT+DDL+ KFA GVS V ++SLA+ YPTLAAA
Sbjct  181   LRIRPFSYGLVVRRVYDSGSVFDPAVLDLTDDDLVAKFAEGVSAVAAISLALGYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              H  +N YKNVL+IA+ TDYS+P A+  KEYLKDPSKF
Sbjct  241   AHFFLNSYKNVLAIALSTDYSYPQAENAKEYLKDPSKF  278



>ref|XP_002960261.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
 gb|EFJ37800.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
Length=323

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 204/278 (73%), Positives = 234/278 (84%), Gaps = 0/278 (0%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  K TK +KK AYD KLC+ LD+Y + LI  ADNVGSNQ+Q IR+GLR DSVVLMGKNT
Sbjct  1     MGFKGTKLEKKEAYDLKLCKYLDDYGRALICAADNVGSNQMQQIRQGLRPDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             ++KR+IR +AE TGN  +LNLIPLLVGNVGL+FT+GDLKEV E +AKYKVGAPARVGLVA
Sbjct  61    LMKRTIRKYAEKTGNRDVLNLIPLLVGNVGLVFTRGDLKEVREVIAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDV + PG+TGLDPS TSFFQ LNIPTKINKGTVEI++ VELI KG KVGSSEAALLAK
Sbjct  121   PIDVTIQPGSTGLDPSHTSFFQALNIPTKINKGTVEIVSSVELISKGTKVGSSEAALLAK  180

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             L IRPFSYGL+V  VYD+GSVF P VLDLT+DDL+ KFA GVS V ++SLA+ YPTLAAA
Sbjct  181   LRIRPFSYGLVVRRVYDSGSVFDPAVLDLTDDDLVAKFAEGVSAVAAISLALGYPTLAAA  240

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              H  +N YKNVL+IA+ TDYS+P A+  KEYLKDPSKF
Sbjct  241   AHFFLNSYKNVLAIALSTDYSYPQAENAKEYLKDPSKF  278



>sp|P29764.1|RLA0_OXYRB RecName: Full=60S acidic ribosomal protein P0; AltName: Full=Light-induced 
34 kDa protein [Oxybasis rubra]
 emb|CAA33276.1| 34kD light-induced protein [Oxybasis rubra]
Length=321

 Score =   394 bits (1011),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 207/242 (86%), Positives = 223/242 (92%), Gaps = 0/242 (0%)
 Frame = +1

Query  190  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
            MAVK TKA+KKIAYDQKLCQLLDEY+Q+LIA ADNVGSNQLQ IR GLRGDS+VLMGKNT
Sbjct  1    MAVKPTKAEKKIAYDQKLCQLLDEYSQVLIASADNVGSNQLQAIRIGLRGDSIVLMGKNT  60

Query  370  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
            M+KRSIR+HAENTGN  + N+  L + NVGLIFTKGDL +V EE++KYKVGAPAR GLVA
Sbjct  61   MMKRSIRLHAENTGNENLRNVEQLFLPNVGLIFTKGDLNQVREEISKYKVGAPARFGLVA  120

Query  550  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIT VELI+KG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGEKVGSSEAALLAK  180

Query  730  LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
            LGIRPFSYGL V SVYD+GSVFSPEVLDLTEDDLL +FA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLNVESVYDDGSVFSPEVLDLTEDDLLARFATGVSMVTSLSLAISYPTLAAA  240

Query  910  PH  915
            PH
Sbjct  241  PH  242



>gb|AIN39821.1| hypothetical protein, partial [Zoysia matrella]
Length=262

 Score =   377 bits (969),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 229/252 (91%), Gaps = 0/252 (0%)
 Frame = +1

Query  190  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
            MA+K+TKA+KKIAYD+KLCQLLDEYT++L+AVADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCQLLDEYTKVLVAVADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  370  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
            +I+R I+VHAE TGNT    L  LLVGNVGLIFTKGDLKEV EEV KYKVGAPARVGLVA
Sbjct  61   LIRRCIKVHAEKTGNTEFEQLSKLLVGNVGLIFTKGDLKEVREEVGKYKVGAPARVGLVA  120

Query  550  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
            P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAK
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  730  LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
            LGIRPFSYGL++ +VYD GSVFSPEVLDLT+DDL+EKFA GVSMV SLSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVITNVYDAGSVFSPEVLDLTDDDLVEKFASGVSMVASLSLALSYPTLAAA  240

Query  910  PHMLINGYKNVL  945
            P     G K  L
Sbjct  241  PTCSSMGTKTCL  252



>gb|KJB74260.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=273

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 241/321 (75%), Positives = 254/321 (79%), Gaps = 48/321 (15%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK +KA KKIAYD KLCQLLDEYTQILIA ADNVGS QLQNIRKGLRGDSVVLMGKNT
Sbjct  1     MAVKPSKADKKIAYDAKLCQLLDEYTQILIAAADNVGSKQLQNIRKGLRGDSVVLMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
             M+KRS+R+HAE TGN A LNLIPLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA
Sbjct  61    MMKRSVRMHAEKTGNEAFLNLIPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  120

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINK                            
Sbjct  121   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINK----------------------------  152

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
                                 VFSPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  153   --------------------VFSPEVLDLTEDDLIEKFATGVSMVTALSLAISYPTLAAA  192

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  1089
             PHM INGYKN+L++AV T+YSFP ADKVKEYL DPSKFAVAAAPVAAA  G+APAAA A 
Sbjct  193   PHMFINGYKNILAVAVATEYSFPQADKVKEYLADPSKFAVAAAPVAAAGGGAAPAAAPAE  252

Query  1090  eekkeepeeeseDEMGFSLFD  1152
             EEKK EPEEES+D+MGFSLFD
Sbjct  253   EEKKPEPEEESDDDMGFSLFD  273



>gb|KCW65655.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=266

 Score =   371 bits (952),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  199  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
            K +KA KK+AYD KLC+L+DEY+QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNTM+K
Sbjct  3    KLSKADKKLAYDAKLCRLMDEYSQILIVAADNVGSNQLQNIRKGLRGDSLVLMGKNTMMK  62

Query  379  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
            RSIR+HAENTGN A LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63   RSIRIHAENTGNNAYLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  559  VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
            V+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAKLGI
Sbjct  123  VIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGI  182

Query  739  RPFSYGLIVLSVYDNGSVFSP  801
            RPFSYGL+V SVYDNGSVFSP
Sbjct  183  RPFSYGLVVQSVYDNGSVFSP  203



>gb|ABO31368.1| 60S ribosomal protein [Gossypium hirsutum]
Length=228

 Score =   364 bits (935),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 188/225 (84%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  208  KAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSI  387
            K +KK  YDQKLC+LLDEYTQ+L+  ADNVGS Q+QNIRKGLRGDS++LMGKNTM+KRSI
Sbjct  3    KREKKSQYDQKLCRLLDEYTQVLVVAADNVGSTQMQNIRKGLRGDSIILMGKNTMMKRSI  62

Query  388  RVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVV  567
            R+HAE TGN A  NL+PLLVGNVG IFTKGDLKEV EE+AKYKVGAPARVGLVAPIDV+V
Sbjct  63   RLHAERTGNDAFKNLLPLLVGNVGFIFTKGDLKEVREEIAKYKVGAPARVGLVAPIDVIV  122

Query  568  PPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPF  747
            PPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+T VELIRKG+KVGSSEAALL+KLGIRPF
Sbjct  123  PPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTAVELIRKGEKVGSSEAALLSKLGIRPF  182

Query  748  SYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLA  882
            SYGL+V+SVYDNG+VFSPEVLDLTEDDL+EKF   +S VTSLSLA
Sbjct  183  SYGLVVVSVYDNGTVFSPEVLDLTEDDLMEKFRSWLSNVTSLSLA  227



>emb|CDP06275.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 205/223 (92%), Gaps = 0/223 (0%)
 Frame = +1

Query  355   MGKNTMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPAR  534
             MGKNTM+KRSIRVHAE TGN A LNLIPLLVGNVGLIFTKGDLKE+SEEV+KYKVGAPAR
Sbjct  1     MGKNTMMKRSIRVHAEKTGNGAFLNLIPLLVGNVGLIFTKGDLKEISEEVSKYKVGAPAR  60

Query  535   VGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEA  714
              GL+A +DVVVPPGNTG DPSQTSFFQVLNIPT INKGTVEIIT VELI+ GDK GSSE+
Sbjct  61    AGLIAAVDVVVPPGNTGPDPSQTSFFQVLNIPTNINKGTVEIITAVELIKNGDKDGSSES  120

Query  715   ALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYP  894
             ALL+KLGIRPFSYGLIV SV+DNGSVFSP+VL+LTEDD++EKF+LG+SM TSL+L ISYP
Sbjct  121   ALLSKLGIRPFSYGLIVPSVFDNGSVFSPDVLNLTEDDVVEKFSLGLSMATSLALGISYP  180

Query  895   TLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             +L+AAPH+LINGYKN L IAVET+YSF  ADKV EYLKDPS+F
Sbjct  181   SLSAAPHILINGYKNALVIAVETEYSFSQADKVNEYLKDPSEF  223



>gb|ADE76171.1| unknown [Picea sitchensis]
Length=266

 Score =   351 bits (900),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 226/266 (85%), Positives = 246/266 (92%), Gaps = 0/266 (0%)
 Frame = +1

Query  355   MGKNTMIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPAR  534
             MGKNTM+KRSIR++AE +GNTA  NLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPAR
Sbjct  1     MGKNTMMKRSIRLYAEKSGNTAYQNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPAR  60

Query  535   VGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEA  714
             VGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEA
Sbjct  61    VGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEA  120

Query  715   ALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYP  894
             ALLAKLGIRPFSYGL+V SVYDNGSVF PEVLDLTEDDL+EKFA G+S VT+LSLAISYP
Sbjct  121   ALLAKLGIRPFSYGLVVQSVYDNGSVFDPEVLDLTEDDLIEKFAAGISTVTALSLAISYP  180

Query  895   TLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapa  1074
             T+AA PH +INGYKNVL+IA+E DYSFPLA+KVKEYLKDPSKFAVAAAPVA+A   +  A
Sbjct  181   TIAAVPHAIINGYKNVLAIAIELDYSFPLAEKVKEYLKDPSKFAVAAAPVASATEAAPAA  240

Query  1075  aaaaaeekkeepeeeseDEMGFSLFD  1152
             AA   EEKK EPEEESE++MGFSLFD
Sbjct  241   AAPKEEEKKPEPEEESEEDMGFSLFD  266



>dbj|BAC10912.1| putative 60S acidic ribosomal protein P0 [Zinnia elegans]
Length=203

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  199  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
            K +KA KKIAYDQKLCQLLD+Y Q+L+A ADNVGSNQLQNIR+GLRGDSV+LMGKNTM+K
Sbjct  3    KVSKADKKIAYDQKLCQLLDDYNQVLVAAADNVGSNQLQNIRQGLRGDSVILMGKNTMMK  62

Query  379  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
            RSIR+H+E TGN A LNLIPLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVAP+D
Sbjct  63   RSIRMHSEKTGNKAYLNLIPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPVD  122

Query  559  VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
            VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAKLGI
Sbjct  123  VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGI  182

Query  739  RPFSYGLIVLSVYDNGSVFSP  801
            RPFSYGL+V SVY+NGSVF P
Sbjct  183  RPFSYGLVVQSVYENGSVFKP  203



>ref|XP_005850392.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
 gb|EFN58290.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
Length=314

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/273 (64%), Positives = 214/273 (78%), Gaps = 0/273 (0%)
 Frame = +1

Query  205   TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  384
             TK  KK AYD KLC+++D Y +  +  ADNVGS Q  +IR  +R  S +LMGKNTM++RS
Sbjct  5     TKLVKKEAYDAKLCEMMDTYDRAFLVHADNVGSKQFMDIRAAIRDHSRILMGKNTMMRRS  64

Query  385   IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  564
             IR++ E TGN   L L+  +VGNVGLIFTKGDL EV + +  +KVGAPARVGLVAP DV 
Sbjct  65    IRLYCERTGNDQWLQLLGHMVGNVGLIFTKGDLNEVRKLIDDFKVGAPARVGLVAPNDVT  124

Query  565   VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRP  744
             +P GNTG+DPSQTSFFQVLNIPTKINKG+VEI   V LI+ GDKVG+SEA LLAKLGI+P
Sbjct  125   IPGGNTGMDPSQTSFFQVLNIPTKINKGSVEITADVHLIKTGDKVGASEATLLAKLGIKP  184

Query  745   FSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLI  924
             FSYGL++L VYDNGS++ P+VLD+T+DDL      G+  V +  L +SYPT+A+ PH LI
Sbjct  185   FSYGLVILQVYDNGSLYDPKVLDITDDDLGNLITAGLRNVAAACLELSYPTIASVPHSLI  244

Query  925   NGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             NGYKNVL+IAVETDYSFPLA+KVK +L DPS F
Sbjct  245   NGYKNVLAIAVETDYSFPLAEKVKAFLADPSAF  277



>gb|KDD72928.1| hypothetical protein H632_c2720p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=273

 Score =   335 bits (859),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 165/266 (62%), Positives = 216/266 (81%), Gaps = 0/266 (0%)
 Frame = +1

Query  226   AYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVHAEN  405
             A+  KLC LLD Y++ L+  ADNVGS Q+ +IR GLRGDSV+LMGK TMI+R IR + + 
Sbjct  8     AFGAKLCDLLDTYSKALVVHADNVGSKQMMDIRAGLRGDSVLLMGKKTMIRRCIRQYVDR  67

Query  406   TGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTG  585
             TGN   + L+ LL GNVG+IFTK DL ++ + V+KY VGAPARVG+VAP DV +  GNTG
Sbjct  68    TGNDQWVPLLDLLEGNVGIIFTKADLNDLRDRVSKYTVGAPARVGVVAPTDVTIYAGNTG  127

Query  586   LDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIV  765
             +DPSQTSFFQ LN+PTKINKGTVEI++ + LI  GDKVG+S+A LLAKLGI+PF+YGL++
Sbjct  128   MDPSQTSFFQALNVPTKINKGTVEIVSDMHLITAGDKVGASQATLLAKLGIKPFTYGLVL  187

Query  766   LSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVL  945
              +VYDNG++++P+VLD+TEDDL+   + G++ V + SL +++PTLA+APH +++G+KNVL
Sbjct  188   RNVYDNGALYNPKVLDITEDDLVAAMSRGIANVAAASLQLNFPTLASAPHSIVHGFKNVL  247

Query  946   SIAVETDYSFPLADKVKEYLKDPSKF  1023
             S+AV TDYSFPLADKVK YL DPS F
Sbjct  248   SVAVATDYSFPLADKVKAYLADPSAF  273



>gb|EYU43502.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=242

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  430   LIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSF  609
             +I  L GNVGLIFTKGDLKEV+EEVAK+KVGAPARVGLVAPIDV+VPPGNTGLDPSQTSF
Sbjct  1     MIGRLQGNVGLIFTKGDLKEVTEEVAKFKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSF  60

Query  610   FQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGS  789
             FQVLNIPTKINKGTVEI+TPVELI+KGDKVGSSEAALL+KLGIRPFSYGL+V  VYDNGS
Sbjct  61    FQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLSKLGIRPFSYGLVVTKVYDNGS  120

Query  790   VFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDY  969
             VFSPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAAPHM IN YKNVL++AV TDY
Sbjct  121   VFSPEVLDLTEDDLIVKFAMGVSMVTSLALAISYPTLAAAPHMFINAYKNVLAVAVATDY  180

Query  970   SFPLADKVKEYLKDPSKF  1023
             SFPLADKVKEYL DPSKF
Sbjct  181   SFPLADKVKEYLADPSKF  198



>ref|XP_005650079.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25535.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
Length=319

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/274 (61%), Positives = 215/274 (78%), Gaps = 2/274 (1%)
 Frame = +1

Query  208   KAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLR--GDSVVLMGKNTMIKR  381
             +  KK  YD+KLC LLD Y +  +  ADNVGS Q  +IR+GLR  GDS+VLMGKNTM+KR
Sbjct  6     RLSKKEEYDEKLCGLLDGYDKCFVVHADNVGSRQFMDIRRGLRDVGDSIVLMGKNTMMKR  65

Query  382   SIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDV  561
             SIR++ E TG+     L+  LVGNVGLIFTK DL E+ +E+ KYKVGAPARVGLVAP  V
Sbjct  66    SIRLYCEKTGDDKWPALLDHLVGNVGLIFTKADLAELRDEIEKYKVGAPARVGLVAPNSV  125

Query  562   VVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIR  741
             VVP GNTGLDPSQTSFFQ LNIPTKIN+GTVEI++ V LI+  +KVG SEA LL+KLGI+
Sbjct  126   VVPAGNTGLDPSQTSFFQALNIPTKINRGTVEIVSDVHLIKASEKVGGSEATLLSKLGIK  185

Query  742   PFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHML  921
             PFSYGL++L V+++G+++ P+VLD+ ++DL++     ++ + + SL + YPTLA+ PH +
Sbjct  186   PFSYGLVLLKVFEDGAMYDPKVLDIKDEDLMDSVMTAITRIAAASLELGYPTLASIPHSV  245

Query  922   INGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             INGYKNVL+I+V TDY FPLA+KVK +L DPS F
Sbjct  246   INGYKNVLAISVATDYDFPLAEKVKAFLADPSAF  279



>ref|XP_011402179.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
 gb|KFM29126.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
Length=273

 Score =   328 bits (841),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/258 (64%), Positives = 208/258 (81%), Gaps = 0/258 (0%)
 Frame = +1

Query  217  KKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRSIRVH  396
            KK AYD KLC+LLD +T+  +  ADNVGS Q+ NIR GLR +S VLMGKNT+I+R +R++
Sbjct  9    KKEAYDAKLCELLDTHTKAFLVHADNVGSMQMMNIRAGLRENSTVLMGKNTLIRRCLRLY  68

Query  397  AENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPG  576
             E TGN   L L+  LVGNVGLIFT+GDL EV +++ ++KVGAPARVGLVAP DV V  G
Sbjct  69   VERTGNEQWLVLLDHLVGNVGLIFTQGDLNEVRDKIQEFKVGAPARVGLVAPNDVTVYAG  128

Query  577  NTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYG  756
            NTG+DPSQTSFFQ LNI TKINKGTVEI++ V LI+ G+KVG+S+A LLAKLGI+PF+YG
Sbjct  129  NTGMDPSQTSFFQALNISTKINKGTVEIVSDVHLIKPGEKVGASQATLLAKLGIKPFTYG  188

Query  757  LIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLINGYK  936
            L+V  VYDNGS++ P+VLD+T++ L +    G+  V + SLA+ +PT+A+APH LINGYK
Sbjct  189  LVVKQVYDNGSLYDPKVLDITDETLGDLLTAGIRNVAAASLALDFPTMASAPHSLINGYK  248

Query  937  NVLSIAVETDYSFPLADK  990
            N L+IAVETDY+FPLA+K
Sbjct  249  NALAIAVETDYTFPLAEK  266



>gb|KCW65657.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=186

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
            K +KA KK+AYD KLC+L+DEY+QILI  ADNVGSNQLQNIRKGLRGDS+VLMGKNTM+K
Sbjct  3    KLSKADKKLAYDAKLCRLMDEYSQILIVAADNVGSNQLQNIRKGLRGDSLVLMGKNTMMK  62

Query  379  RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
            RSIR+HAENTGN A LNL+PLL GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID
Sbjct  63   RSIRIHAENTGNNAYLNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  122

Query  559  VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  723
            V+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALL
Sbjct  123  VIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  177



>gb|EMS52841.1| 60S acidic ribosomal protein P0 [Triticum urartu]
Length=263

 Score =   322 bits (826),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = +1

Query  448   GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNI  627
             GNVGLIFTKGDLKEV EEVAKYKVGAPARVGL+APIDVVVPPGNTGLDPSQTSFFQVLNI
Sbjct  29    GNVGLIFTKGDLKEVREEVAKYKVGAPARVGLIAPIDVVVPPGNTGLDPSQTSFFQVLNI  88

Query  628   PTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPev  807
             PTKINKG+VEI+  V+LI+KGDKVGSSEAALLAKLGIRPFSYGL++ +VYD+GSVFSPEV
Sbjct  89    PTKINKGSVEIVAHVDLIKKGDKVGSSEAALLAKLGIRPFSYGLVITNVYDDGSVFSPEV  148

Query  808   ldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLAD  987
             LDLTE+DL+EKFA GVSMV SLSLA+SYPTLAAAPHM +NGYKNVL++AVET+YSFP AD
Sbjct  149   LDLTEEDLMEKFACGVSMVASLSLAVSYPTLAAAPHMFLNGYKNVLALAVETEYSFPHAD  208

Query  988   KVKEYLKDPSKF  1023
             ++KEYLKDPSKF
Sbjct  209   QIKEYLKDPSKF  220



>ref|XP_002279500.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Vitis vinifera]
Length=286

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 183/278 (66%), Positives = 210/278 (76%), Gaps = 35/278 (13%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             MAVK ++A+KK+ YDQKLC+LLDEY+QILI                GLRG          
Sbjct  1     MAVKLSRAEKKVQYDQKLCRLLDEYSQILIVA--------------GLRGS---------  37

Query  370   MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
                  IRV +E  G +         +GNVGLIFTKGDLK VS+EVAKYKVGAPAR G+VA
Sbjct  38    ---EKIRV-SEKMGRS--------YLGNVGLIFTKGDLKGVSDEVAKYKVGAPARAGVVA  85

Query  550   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
             PIDVV+ PG+TGLDP+ TSFFQVLNIPTKINKG VEI+ PV+L++KGDKVGSSEAALLAK
Sbjct  86    PIDVVIQPGSTGLDPALTSFFQVLNIPTKINKGAVEIVVPVQLVKKGDKVGSSEAALLAK  145

Query  730   LGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAA  909
             LG + FSYGL+VLSV DNGSVFSP+VLDLT+DDL EKF+ GVSM  SLSLAISYPTLAAA
Sbjct  146   LGKKSFSYGLVVLSVSDNGSVFSPKVLDLTDDDLAEKFSAGVSMKASLSLAISYPTLAAA  205

Query  910   PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              HM IN   NVL++AV  +YSFP A +VKEYLKDPSKF
Sbjct  206   LHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDPSKF  243



>emb|CBV76074.1| 60S acidic ribosomal protein P0 [Polytomella sp. Pringsheim 198.80]
Length=314

 Score =   319 bits (818),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 207/273 (76%), Gaps = 0/273 (0%)
 Frame = +1

Query  205   TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  384
             +K  KK AY +++C LL  + +  I  ADNVGS Q Q+IRK LR  S++LMGKNTMIKRS
Sbjct  5     SKLAKKEAYHERICDLLKTFQKAFIVGADNVGSQQFQDIRKALRPQSIILMGKNTMIKRS  64

Query  385   IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  564
             I+++ E TG+     L+  LVGNVG++FT  DL +V +E+AKYKVGAPARVG  A  +V 
Sbjct  65    IKIYCEETGDNKWAALLDHLVGNVGIVFTNQDLNQVKDEIAKYKVGAPARVGATATEEVT  124

Query  565   VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRP  744
             V  G+TG+DPSQTSFFQ L + TKINKGT+EI++ V ++R GD+VG S+A LLAKLGI+P
Sbjct  125   VKAGSTGMDPSQTSFFQALGVATKINKGTIEIVSDVIVVRVGDRVGPSQATLLAKLGIKP  184

Query  745   FSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLI  924
             F YGL +L +++ GS+F P VLD+T++D+LE     +  V + SL   Y TLAA PH++I
Sbjct  185   FKYGLTLLKIFEEGSLFDPAVLDITDEDMLESVVAAIRNVAAFSLGAHYATLAAVPHVVI  244

Query  925   NGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             NGYKNVL++A+ETDYSFPLA+KVKEYL DPSKF
Sbjct  245   NGYKNVLAVAIETDYSFPLAEKVKEYLADPSKF  277



>gb|AFW74478.1| hypothetical protein ZEAMMB73_076912 [Zea mays]
Length=197

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  190  MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
            MA+K+TKA+KKIAYD+KLC LLDEYT++LIA+ADNVGS QLQ+IR+GLRGDSVVLMGKNT
Sbjct  1    MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT  60

Query  370  MIKRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVA  549
            +I+R I+V+AE TGN     L+ LLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVA
Sbjct  61   LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA  120

Query  550  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  729
            P+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSE+ALLAK
Sbjct  121  PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAK  180

Query  730  LGIRPFSYGLIVLSVYD  780
            LGIRPFSYGL V SVY+
Sbjct  181  LGIRPFSYGLQVTSVYE  197



>gb|AAD56335.1|AC009326_22 putative 60S acidic ribosomal protein, 5' partial [Arabidopsis 
thaliana]
Length=230

 Score =   316 bits (809),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  463   IFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKIN  642
             IFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKIN
Sbjct  1     IFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKIN  60

Query  643   KGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlte  822
             KGTVEIITPVELI++GDKVGSSEAALLAKLGIRPFSYGL+V SVYDNGSVFSPEVLDLTE
Sbjct  61    KGTVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTE  120

Query  823   ddlleKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEY  1002
             D L+EKFA G+SMVTSL+LA+SYPTLAAAPHM IN YKN L+IAV T+Y+FP A+KVKEY
Sbjct  121   DQLVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATEYTFPQAEKVKEY  180

Query  1003  LKDPSKF  1023
             LKDPSKF
Sbjct  181   LKDPSKF  187



>gb|KIZ02211.1| 60S acidic ribosomal protein P0 [Monoraphidium neglectum]
Length=313

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 168/269 (62%), Positives = 205/269 (76%), Gaps = 0/269 (0%)
 Frame = +1

Query  205   TKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIKRS  384
             TK +KK AY  +LC  LD Y +  I  ADNVGS Q  +IR  LR +S++LMGKNTM+KRS
Sbjct  5     TKLEKKEAYHARLCDYLDTYEKAFIVHADNVGSKQFSDIRAALRPESLILMGKNTMMKRS  64

Query  385   IRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVV  564
             IR++ E   +     L+  LVGNVG+IFTK DL  V +E+AKYKVGAPARVGLVAP DV 
Sbjct  65    IRLYCEEKEDDRWAPLLDELVGNVGIIFTKADLASVKDEIAKYKVGAPARVGLVAPNDVT  124

Query  565   VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRP  744
             +P G TG+DPSQTSFFQ LNI TKINKGT++I+  V LI+ GDKVG+SEAALL KLGI+P
Sbjct  125   IPGGGTGMDPSQTSFFQALNIATKINKGTIDIVNDVHLIKAGDKVGASEAALLGKLGIKP  184

Query  745   FSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLI  924
             F YGL +L VY+NGS+F   VL +T++ LL   A  ++ V +LSLA +YPTLA+ PH ++
Sbjct  185   FKYGLEILKVYENGSLFDAAVLSITDEALLGSAAAALANVAALSLAANYPTLASIPHSVV  244

Query  925   NGYKNVLSIAVETDYSFPLADKVKEYLKD  1011
             NGYKNVL+IAVETDYSFPLADKVK YL D
Sbjct  245   NGYKNVLAIAVETDYSFPLADKVKAYLAD  273



>gb|ABR26209.1| 60S acidic ribosomal protein p0 [Oryza sativa Indica Group]
Length=238

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +1

Query  433   IPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFF  612
             +PLLVGNVGLIFTKGDLKEV EEVAKYKVGAPARVGLVAP+DVVVPPGNTGLDPSQTSFF
Sbjct  1     MPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFF  60

Query  613   QVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSV  792
             QVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALLAKLGIRPFSYGL++ +VYD+GSV
Sbjct  61    QVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVITNVYDSGSV  120

Query  793   FSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYS  972
             FSPEVLDLTEDDL+EKFA GVSMV S+SLAISYPT+AAAPHM +NGYKNVL++AVET+YS
Sbjct  121   FSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETEYS  180

Query  973   FPLADKVKEYLKDPSKF  1023
             +P ADK+KEYLKDPSKF
Sbjct  181   YPHADKIKEYLKDPSKF  197



>gb|KHG01938.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=253

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +1

Query  442   LVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVL  621
             + GNVG IFTKGDLKEV EE+AKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVL
Sbjct  17    IAGNVGFIFTKGDLKEVREEIAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVL  76

Query  622   NIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSP  801
             NIPTKINKGTVEI+T VELIRKG+KVGSSEAALL+KLGIRPFSYGL+V+SVYDNG+VFSP
Sbjct  77    NIPTKINKGTVEIVTAVELIRKGEKVGSSEAALLSKLGIRPFSYGLVVVSVYDNGTVFSP  136

Query  802   evldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPL  981
             EVLDLTEDDL+EKF   +S VTSLSLA+S+PTLAAAPHM IN YK  LS+AV T+Y+FP 
Sbjct  137   EVLDLTEDDLMEKFRSWLSNVTSLSLAVSFPTLAAAPHMFINAYKTALSLAVATEYTFPQ  196

Query  982   ADKVKEYLKDPSKF  1023
             A+K+KEYLKDP+KF
Sbjct  197   AEKIKEYLKDPTKF  210



>gb|KHG21849.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=237

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = +1

Query  448   GNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNI  627
             GNVG IFTKGDLKEV EE+AKYKVGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNI
Sbjct  3     GNVGFIFTKGDLKEVREEIAKYKVGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNI  62

Query  628   PTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPev  807
             PTKINKGTVEI+T VELIRKG+KVGSSEAALL+KLGIRPFSYGL+V+SVYDNG+VFSPEV
Sbjct  63    PTKINKGTVEIVTAVELIRKGEKVGSSEAALLSKLGIRPFSYGLVVVSVYDNGTVFSPEV  122

Query  808   ldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLAD  987
             LDLTEDDL+EKF   +S VTSLSLA+S+PTLAAAPHM IN YK  LS+AV T+Y+FP A+
Sbjct  123   LDLTEDDLMEKFRSWLSNVTSLSLAVSFPTLAAAPHMFINAYKTALSLAVATEYTFPQAE  182

Query  988   KVKEYLKDPSKF  1023
             K+KEYLKDP+KF
Sbjct  183   KIKEYLKDPTKF  194



>ref|XP_001697060.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
 gb|EDP00752.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
Length=320

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 209/283 (74%), Gaps = 5/283 (2%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  ++  + KK  Y Q+L Q L  Y +  I  ADNVGS Q  +IRK LR  +V+LMGKNT
Sbjct  1     MVAEERVSDKKKEYRQRLNQYLQTYDKAFIVHADNVGSRQFMDIRKALRPGAVILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIP-----LLVGNVGLIFTKGDLKEVSEEVAKYKVGAPAR  534
             M++  +  + E TG+     L+      LL GNVG++FT GDL +V +E+AKYKVGAPAR
Sbjct  61    MMRFCVEKYLEETGDHRWECLVKPGKKGLLEGNVGIVFTNGDLSQVKDEIAKYKVGAPAR  120

Query  535   VGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEA  714
             VG VAP DVV+  G TG+DPSQTSFFQ L I TKINKGT+EI++ V +++ G++VG S+A
Sbjct  121   VGAVAPEDVVIKAGGTGMDPSQTSFFQALGIATKINKGTIEIVSDVVVVKAGERVGPSQA  180

Query  715   ALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYP  894
              LLAKLG++PF YGL++L V ++G+V+ P+V+D+T++D++     G+  V +LSL   YP
Sbjct  181   TLLAKLGVKPFKYGLLILKVIESGAVYDPKVMDITDEDMMASVIAGIREVAALSLGAQYP  240

Query  895   TLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             TLAAAPH++I+GYKNVL+IAVETDY+FPLA KVK+YL DPSKF
Sbjct  241   TLAAAPHVIIDGYKNVLAIAVETDYTFPLAQKVKDYLADPSKF  283



>ref|XP_002958097.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
 gb|EFJ40828.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
Length=321

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 208/283 (73%), Gaps = 5/283 (2%)
 Frame = +1

Query  190   MAVKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNT  369
             M  ++  +QKK  Y ++L Q L  Y +  I  ADNVGS Q  +IRK LR +SV+LMGKNT
Sbjct  1     MVAEERVSQKKKDYRKRLAQYLQTYDKAFIVNADNVGSKQFMDIRKALRPNSVILMGKNT  60

Query  370   MIKRSIRVHAENTGNTAILNLIP-----LLVGNVGLIFTKGDLKEVSEEVAKYKVGAPAR  534
             M++  +  + E TG+     L+      LL GNVG++FT GDL +V +E+AKYKVGAPAR
Sbjct  61    MMRYCVEKYLEETGDHRWECLVKPGKKGLLEGNVGIVFTNGDLSQVKDEIAKYKVGAPAR  120

Query  535   VGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEA  714
             VG  A  DVV+  G TG+DPSQTSFFQ L I TKINKGT+EI++ V +++ GD+VG+S+A
Sbjct  121   VGATANEDVVIKAGGTGMDPSQTSFFQALGIATKINKGTIEIVSDVVVVKTGDRVGASQA  180

Query  715   ALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYP  894
              LLAKLGI+PF YGL +L V ++G+V+ P+V+++T++D+L      +  V++LSL   YP
Sbjct  181   TLLAKLGIKPFKYGLQILKVIESGAVYDPKVMEITDEDILSSVMTAIREVSALSLGARYP  240

Query  895   TLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             TL AAPH++I+GYKNVL+IA+ETDY+FPLA KVK+YL DPSKF
Sbjct  241   TLVAAPHVIIDGYKNVLAIALETDYTFPLAQKVKDYLADPSKF  283



>sp|Q9DG68.1|RLA0_RANSY RecName: Full=60S acidic ribosomal protein P0; AltName: Full=60S 
ribosomal protein L10E [Rana sylvatica]
 gb|AAG09233.1| brain acidic ribosomal phosphoprotein P0 [Rana sylvatica]
Length=315

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 202/275 (73%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ +A  K  Y  K+ QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     REDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H EN  N+A+  L+P + GNVG +FTK DL EV + +   KV A AR G +AP D
Sbjct  63    KAIRGHLEN--NSALEKLLPHIKGNVGFVFTKEDLAEVRDMLLANKVPASARAGAIAPCD  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LI+ GDKVG+SEA LL  L I
Sbjct  121   VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFS+GLI+  VYDNGS++SPEVLD+TED L  +F  GV  + S+ L I YPT+A+ PH 
Sbjct  181   SPFSFGLIIQQVYDNGSIYSPEVLDITEDALRARFLEGVRNIASVCLQIGYPTVASVPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             ++NGYK VL++AVETDYSFPLADKVK +L DPS F
Sbjct  241   VVNGYKRVLALAVETDYSFPLADKVKAFLADPSAF  275



>ref|XP_006612127.1| PREDICTED: 60S acidic ribosomal protein P0-like [Apis dorsata]
Length=317

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 205/275 (75%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + ++ LAI YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLCEKFMAGVANLAAVCLAIGYPTIASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  TD  FP A  +KEY+KDPSKF
Sbjct  241   IANGFKNLLAIAAVTDIEFPEATTIKEYIKDPSKF  275



>ref|XP_623106.1| PREDICTED: 60S acidic ribosomal protein P0 isoformX1 [Apis mellifera]
 ref|XP_003695681.1| PREDICTED: 60S acidic ribosomal protein P0-like [Apis florea]
 ref|XP_006562125.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X2 [Apis mellifera]
Length=317

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 205/275 (75%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + ++ LAI YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLCEKFMAGVANLAAVCLAIGYPTIASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  TD  FP A  +KEY+KDPSKF
Sbjct  241   IANGFKNLLAIAAVTDIEFPEATTIKEYIKDPSKF  275



>ref|XP_011157010.1| PREDICTED: 60S acidic ribosomal protein P0 [Solenopsis invicta]
 gb|EFZ19789.1| hypothetical protein SINV_09784, partial [Solenopsis invicta]
Length=318

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 232/318 (73%), Gaps = 2/318 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ LAI YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLASVCLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaeek  1098
             ++NG+KN+L++A  TD  F  A  +KEY+KDPSKFA  AA VAA    +A A AA  +E+
Sbjct  241   IVNGFKNLLAVAAVTDVEFAEAATIKEYIKDPSKFAAVAAAVAAPVTAAADAPAAEKKEE  300

Query  1099  keepeeeseDEMGFSLFD  1152
             K+E  E  +D+MGF LFD
Sbjct  301   KKEESESEDDDMGFGLFD  318



>gb|AJQ18907.1| acidic ribosomal protein P0 [Amblyomma cajennense]
Length=318

 Score =   299 bits (765),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 229/319 (72%), Gaps = 2/319 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ K   K  Y  +L QLLDE+ +  I   DNVGS Q+Q IR  LR  +V+LMGKNTMI
Sbjct  2     VREDKTTWKSNYFLRLVQLLDEFPKCFIVGVDNVGSKQMQTIRVSLRKHAVLLMGKNTMI  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H +N  N A+  L+P + GNVG +FTK DL EV E++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLDN--NPALEKLLPHIKGNVGFVFTKEDLTEVREKIIENKVKAPARAGALAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DV++P  NTGL P +TSFFQ L IPTKI+KGT+EI+  + LI+K D+VG+SEA LL  L 
Sbjct  120   DVMIPAQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKDDRVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +L VYD+G+VFSP++LD+T +DL   F  GV  V S+SLAI YPT+A+APH
Sbjct  180   ISPFSYGLKILQVYDSGTVFSPDILDITPEDLRSAFVEGVRNVASVSLAIGYPTVASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaee  1095
              ++NG KN+++IAVETD +F  A+  KEYLKDPSKFA AAAP A   A +A    A  EE
Sbjct  240   SIVNGLKNLIAIAVETDITFKEAEMAKEYLKDPSKFAAAAAPAAGGGAAAAKPEEAKKEE  299

Query  1096  kkeepeeeseDEMGFSLFD  1152
              K+E  EE +D+MGF LFD
Sbjct  300   AKKEESEEEDDDMGFGLFD  318



>ref|XP_011146226.1| PREDICTED: 60S acidic ribosomal protein P0-like [Harpegnathos 
saltator]
 gb|EFN79997.1| 60S acidic ribosomal protein P0 [Harpegnathos saltator]
Length=316

 Score =   298 bits (764),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 230/318 (72%), Gaps = 4/318 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ K   K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG+ VVLMGKNTM++
Sbjct  3     REDKTTWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNGVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHVER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ V S+ LAISYPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFLAGVANVASICLAISYPTIASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaeek  1098
             + NG+KN+L+IA  TD  F  A  +KEY+KDPSKF  AAA VA  +  +    AA  +E+
Sbjct  241   VANGFKNLLAIAAVTDVEFAEAATIKEYIKDPSKF--AAATVAVQSDATVDTPAAEKKEE  298

Query  1099  keepeeeseDEMGFSLFD  1152
             K+E  EES+D+MGF LFD
Sbjct  299   KKEESEESDDDMGFGLFD  316



>ref|XP_003398378.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform 1 [Bombus 
terrestris]
 ref|XP_003398379.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform 2 [Bombus 
terrestris]
Length=317

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 205/275 (75%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + ++ LAI YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLAAVCLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  TD  FP A  +KEY+KDPSKF
Sbjct  241   IANGFKNLLAIAAVTDIEFPEATTIKEYIKDPSKF  275



>ref|XP_011266937.1| PREDICTED: 60S acidic ribosomal protein P0 [Camponotus floridanus]
 gb|EFN61067.1| 60S acidic ribosomal protein P0 [Camponotus floridanus]
Length=318

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 234/318 (74%), Gaps = 2/318 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ L+I YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLASVCLSIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaeek  1098
             + NG+KN+L+IA  T+  FP A  +KEY+KDPSKFA AA  VAA AA +A A AA  +E+
Sbjct  241   IANGFKNLLAIAAVTEVEFPEAATIKEYIKDPSKFAAAATAVAAPAAAAADATAAEKKEE  300

Query  1099  keepeeeseDEMGFSLFD  1152
             K+E  E  +D+MGF LFD
Sbjct  301   KKEESESEDDDMGFGLFD  318



>ref|XP_003488353.1| PREDICTED: 60S acidic ribosomal protein P0-like [Bombus impatiens]
Length=317

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 205/275 (75%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + ++ LAI YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLAAVCLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  TD  FP A  +KEY+KDPSKF
Sbjct  241   IANGFKNLLAIAAVTDIEFPEAATIKEYIKDPSKF  275



>gb|ABM55512.1| putative ribosomal protein P0 [Maconellicoccus hirsutus]
Length=317

 Score =   296 bits (759),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 201/275 (73%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL  LLDEY +  I  ADNVGS Q+Q IR  LRG  +VLMGKNTM++
Sbjct  3     REDKATWKANYFLKLVNLLDEYPKCFIVGADNVGSKQMQQIRISLRGSGIVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+ DL E+ E++ + KV APAR G +AP  
Sbjct  63    KAIRGHIER--NPALERLLPFIKGNVGFVFTRSDLVEIREKLLENKVQAPARAGAIAPCP  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V ++++GDKVG+SEA LL  L I
Sbjct  121   VVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKEGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL V  VYD+G++F P +LD+  +DLL KF+ GV+ V +L LAISYP++A+ PHM
Sbjct  181   SPFSYGLGVQMVYDSGTIFEPRILDIKPEDLLAKFSEGVANVAALCLAISYPSVASVPHM  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             LING KN+L+IA ET+  F  A+ +KEYLKDPSKF
Sbjct  241   LINGLKNLLAIAAETEIEFKEAETMKEYLKDPSKF  275



>ref|NP_001080134.1| ribosomal protein, large, P0 [Xenopus laevis]
 gb|AAH42268.1| Arbp-prov protein [Xenopus laevis]
Length=315

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 199/273 (73%), Gaps = 2/273 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ +A  K  Y  K+ QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     REDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H EN  N A+  L+  + GNVG +FTK DL EV + +   KV A AR G +AP +
Sbjct  63    KAIRGHLEN--NPALEKLLSHIKGNVGFVFTKEDLTEVRDMLLANKVPASARAGAIAPCE  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LI+ GDKVG+SEA LL  L I
Sbjct  121   VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGLI+  VYDNGS++SPEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ PH 
Sbjct  181   SPFSYGLIIQQVYDNGSIYSPEVLDITEEALHVRFLEGVRNVASVCLQIGYPTVASVPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  1017
             +INGYK VL+IAVETDYSFPLADKVK +L DPS
Sbjct  241   VINGYKRVLAIAVETDYSFPLADKVKAFLADPS  273



>gb|AAY66850.1| 60S acidic ribosomal protein P0 [Ixodes scapularis]
Length=319

 Score =   296 bits (758),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 203/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ K   K  Y  +L QLLDEY +  I   DNVGS Q+Q IR  LR  +V+LMGKNTMI
Sbjct  2     VREDKTAWKSNYFLRLVQLLDEYPKCFIVGVDNVGSKQMQTIRVSLRKHAVLLMGKNTMI  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H +N  N A+  L+P + GNVG +FTK DL EV E++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLDN--NPALEKLLPHIKGNVGFVFTKEDLGEVREKIIENKVKAPARAGALAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DV++P  NTGL P +TSFFQ L IPTKI+KGT+EI+  + LI+K D+VG+SEA LL  L 
Sbjct  120   DVMIPAQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKDDRVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +L VYD+G+VFSPE+LD+T +DL   F  GV  V S+SLAI YPT+A+APH
Sbjct  180   ISPFSYGLKILQVYDSGTVFSPEILDITPEDLRSAFVEGVRNVASVSLAIGYPTVASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              ++NG KN++++A+ETD +F  A+  KEYLKDPSKF
Sbjct  240   SIVNGLKNLIAVALETDITFKEAEMAKEYLKDPSKF  275



>ref|XP_002399611.1| 60S acidic ribosomal protein P0, putative [Ixodes scapularis]
 gb|EEC09184.1| 60S acidic ribosomal protein P0, putative [Ixodes scapularis]
Length=319

 Score =   296 bits (757),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 203/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ K   K  Y  +L QLLDEY +  I   DNVGS Q+Q IR  LR  +V+LMGKNTMI
Sbjct  2     VREDKTAWKSNYFLRLVQLLDEYPKCFIVGVDNVGSKQMQTIRVSLRKHAVLLMGKNTMI  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H +N  N A+  L+P + GNVG +FTK DL EV E++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLDN--NPALEKLLPHIKGNVGFVFTKEDLGEVREKIIENKVKAPARAGALAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DV++P  NTGL P +TSFFQ L IPTKI+KGT+EI+  + LI+K D+VG+SEA LL  L 
Sbjct  120   DVMIPAQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKDDRVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +L VYD+G+VFSPE+LD+T +DL   F  GV  V S+SLAI YPT+A+APH
Sbjct  180   ISPFSYGLKILQVYDSGTVFSPEILDITPEDLRSAFVEGVRNVASVSLAIGYPTVASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              ++NG KN++++A+ETD +F  A+  KEYLKDPSKF
Sbjct  240   SIVNGLKNLIAVALETDITFKEAEMAKEYLKDPSKF  275



>ref|XP_001985147.1| GH14667 [Drosophila grimshawi]
 gb|EDV97495.1| GH14667 [Drosophila grimshawi]
Length=318

 Score =   296 bits (757),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 226/319 (71%), Gaps = 2/319 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFVKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
              V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   HVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL+V  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++ L++ YPT+A+APH
Sbjct  180   ISPFSYGLLVSQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaee  1095
              + NG+KN+L+IA  TD  F  A  +KEY+KDPSKFA AAA  A AA G   A      +
Sbjct  240   SVANGFKNLLAIAATTDVDFKEATTIKEYIKDPSKFAAAAASSAPAAGGGGAAEKKEEAK  299

Query  1096  kkeepeeeseDEMGFSLFD  1152
             K E   EE +D+MGF LFD
Sbjct  300   KAESESEEEDDDMGFGLFD  318



>ref|NP_989067.1| ribosomal protein, large, P0 [Xenopus (Silurana) tropicalis]
 gb|AAH61299.1| acidic ribosomal phosphoprotein P0 [Xenopus (Silurana) tropicalis]
Length=314

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 199/273 (73%), Gaps = 2/273 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ +A  K  Y  K+ QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     REDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H EN  N A+  L+  + GNVG +FTK DL EV + +   KV A AR G +AP  
Sbjct  63    KAIRGHLEN--NPALEKLLSHIKGNVGFVFTKEDLTEVRDMLLANKVPACARAGAIAPCG  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VVVP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LI+ GDKVG+SEA LL  L I
Sbjct  121   VVVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGLI+  VYDNGS++SPEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ PH 
Sbjct  181   SPFSYGLIIQQVYDNGSIYSPEVLDITEEALHVRFLEGVRNVASVCLQIGYPTVASVPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  1017
             +INGYK VL+IAVETDYSFPLADKVK +L DPS
Sbjct  241   VINGYKRVLAIAVETDYSFPLADKVKAFLADPS  273



>gb|AGQ49465.1| acidic ribosomal protein P0 [Rhipicephalus microplus]
Length=318

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 227/319 (71%), Gaps = 2/319 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ K   K  Y  +L QLLDEY +  I   DNVGS Q+Q IR  LR  +V+LMGKNTMI
Sbjct  2     VREDKTTWKSNYFLRLVQLLDEYPKCFIVGVDNVGSKQMQTIRVSLRKHAVLLMGKNTMI  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H +N  N A+  L+P + GNVG +FTK DL EV E++   KV APAR G +AP+
Sbjct  62    RKAIRGHLDN--NPALEKLLPHIKGNVGFVFTKEDLTEVREKIIDNKVKAPARAGALAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DV++P  NTGL P +TSFFQ L IPTKI+KGT+EI+  + LI+K D+VG+SEA LL  L 
Sbjct  120   DVMIPAQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKDDRVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +L VYD+G+VFSP++LD+T +DL   F  GV  V ++SL+I YPT+A+ PH
Sbjct  180   ISPFSYGLKILQVYDSGTVFSPDILDITPEDLRSAFVEGVRNVAAVSLSIGYPTVASVPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaee  1095
              ++NG KN+++IAVETD +F  A+  KEYLKDPSKFA AAAP A   A +A    +  EE
Sbjct  240   SIVNGLKNLIAIAVETDITFKEAEMAKEYLKDPSKFAAAAAPAAGGGAAAAKPEESKKEE  299

Query  1096  kkeepeeeseDEMGFSLFD  1152
              K+E  EE +D+MGF LFD
Sbjct  300   AKKEESEEEDDDMGFGLFD  318



>gb|ABV60317.1| 60S acidic ribosomal protein P0-like protein [Lutzomyia longipalpis]
Length=317

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/275 (54%), Positives = 202/275 (73%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  K+ QL DEY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     RENKAAWKANYFVKVVQLFDEYPKCFIVGADNVGSRQMQTIRTSLRGLAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP++
Sbjct  63    KAIRGHLENNAN--LEKLLPHIRGNVGFVFTKGDLNEVRDKLTESKVRAPARAGAIAPLE  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEAALL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEAALLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PF YGL++  VYD+GS+FSPE+LD+  +D+  KF  GV+ + ++ L+I YPTLA+APH 
Sbjct  181   SPFQYGLLIEQVYDSGSIFSPEILDIKPEDIRAKFQQGVANLAAVCLSIGYPTLASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  T+  F  A  +KE++KDPSKF
Sbjct  241   IANGFKNLLAIAATTEVEFAEATTIKEFIKDPSKF  275



>ref|XP_011700188.1| PREDICTED: 60S acidic ribosomal protein P0 [Wasmannia auropunctata]
Length=317

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ LAI YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLASVCLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L++A  TD  F  A  +KEY+KDPSKF
Sbjct  241   IANGFKNLLAVAAVTDVEFAEAATIKEYIKDPSKF  275



>ref|XP_001958489.1| GF10946 [Drosophila ananassae]
 gb|EDV41295.1| GF10946 [Drosophila ananassae]
Length=317

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 204/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             +V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   NVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGLIV  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++ L++ YPT+A+APH
Sbjct  180   ISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  TD  F  A  +KEY+KDPSKF
Sbjct  240   SIANGFKNLLAIAATTDVEFKEATTIKEYIKDPSKF  275



>gb|AEL28833.1| ribosomal protein P0 [Heliconius melpomene cythera]
Length=316

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/275 (55%), Positives = 203/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  K+ QLLDEY +  I   DNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3     REDKATWKTNYFTKIIQLLDEYPKCFIVGGDNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++I+ H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIKDHLET--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVRAPARPGAIAPLA  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +T+FFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAHNTGLGPEKTAFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+P +LD+  +DL  KF  GV+ V +LSLAISYPTLA+APH 
Sbjct  181   SPFSYGLVVKQVYDSGTIFAPAILDIKPEDLRAKFQEGVANVAALSLAISYPTLASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  +D  F  A+ +KE++KDPSKF
Sbjct  241   IANGFKNLLAIAAVSDVEFKEANTIKEFIKDPSKF  275



>dbj|BAN20115.1| ribosomal protein LP0 [Riptortus pedestris]
Length=315

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 202/275 (73%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             K+ KA  K  Y  KL QLL+EY +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     KEDKATWKSHYFSKLIQLLEEYPKCFIVGADNVGSKQMQQIRMSLRGSAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+G+L EV E++ + KV APAR G +AP  
Sbjct  63    KAIRGHIER--NQALEKLLPHIKGNVGFVFTRGELTEVREKLLQNKVRAPARAGAIAPCP  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V ++++GDKVG+SEA LL  L I
Sbjct  121   VVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKEGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F P++LD+  ++L  +F  G + + ++ L ISYPT+A+APH 
Sbjct  181   SPFSYGLVVEMVYDSGTIFEPKILDIKPEELRIRFLEGAARLAAVCLEISYPTIASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L++A  T+  F  A+++KEYLKDPSKF
Sbjct  241   IANGFKNLLAVAAVTEIEFKEAERLKEYLKDPSKF  275



>ref|XP_011146290.1| PREDICTED: 60S acidic ribosomal protein P0-like [Harpegnathos 
saltator]
 gb|EFN80029.1| 60S acidic ribosomal protein P0 [Harpegnathos saltator]
Length=316

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 203/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ K   K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKTTWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHVER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ L+I YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFLAGVANIASICLSIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  TD  F  A  +KEY+KDPSKF
Sbjct  241   IANGFKNLLAIAAVTDVEFAEAATIKEYIKDPSKF  275



>ref|XP_011208099.1| PREDICTED: 60S acidic ribosomal protein P0 [Bactrocera dorsalis]
Length=317

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 202/276 (73%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DEY +  I  ADNVGS Q+QNIR  LRG  VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARAGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
              VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   PVVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++SL+I YPT+A+APH
Sbjct  180   ISPFSYGLAITQVYDSGSIFSPEILDIKPEDLRAKFQAGVANLAAVSLSIGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  T+  F  A  +KE++KDPSKF
Sbjct  240   SVANGFKNLLAIAAATEVDFKEAATIKEFIKDPSKF  275



>ref|XP_011496436.1| PREDICTED: 60S acidic ribosomal protein P0 [Ceratosolen solmsi 
marchali]
Length=318

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 230/318 (72%), Gaps = 2/318 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     REDKATWKAGYFNKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGTAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGLIV  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ L+I YPT+A+ PH 
Sbjct  181   SPFSYGLIVEQVYDSGTIFAPEILDIKPEDLREKFLAGVANLASVCLSIGYPTIASIPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaeek  1098
             + NG+KN+L++A  TD  F  A  +KE++KDPSKFA AA   A AAA +A  AA   EEK
Sbjct  241   IANGFKNLLAVAAATDVEFKEATTIKEFIKDPSKFAAAATSAAPAAAAAAAPAAEKKEEK  300

Query  1099  keepeeeseDEMGFSLFD  1152
             K+E  E  +++MGF+LFD
Sbjct  301   KKEESESEDEDMGFALFD  318



>dbj|BAM18929.1| ribosomal protein LP0 [Papilio polytes]
Length=317

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/275 (55%), Positives = 202/275 (73%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  K+ QLLDEY +  +  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3     REDKATWKTNYFTKIIQLLDEYPKCFLVGADNVGSTQMQQIRISLRGHSIVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVRAPARPGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+P +LD+  +DL  KF  GV+ V ++SLA  YPTLA+APH 
Sbjct  181   SPFSYGLVVKQVYDSGTIFAPAILDIKPEDLRAKFMEGVANVAAVSLAAGYPTLASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             L NG+KN+L+IA  TD  F  A  +KE++KDPSKF
Sbjct  241   LANGFKNLLAIAAVTDVEFKEATTIKEFIKDPSKF  275



>gb|ADV40160.1| 60S acidic ribosomal protein P0 [Latrodectus hesperus]
Length=298

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 154/275 (56%), Positives = 199/275 (72%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ +A  K  Y  KL QLLDEY +  I   DNVGS Q+Q IR  LR  +V+LMGKNTMI+
Sbjct  3     REDRATWKSNYFMKLVQLLDEYPKCFIVGVDNVGSKQMQQIRLSLRQHAVLLMGKNTMIR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H EN  N A+  +I  + GNVG +FTK DL EV +++   KV APAR G +AP D
Sbjct  63    KAIRGHMEN--NPALEKIITHIRGNVGFVFTKEDLVEVRDKIMDNKVKAPARAGAIAPCD  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++ P NTGL P +TSFFQ L IPTKI+KGT+EI+  + LI+K DKVG+SEA LL  L +
Sbjct  121   VILQPQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKEDKVGASEATLLNMLNV  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PF+YGL +  VYD+G+VFSPE+LD+T +DL  KF  GV  V S+SL ISYPTLA+ PH 
Sbjct  181   SPFTYGLKIRQVYDSGTVFSPEILDITSEDLRAKFMEGVLNVASVSLEISYPTLASVPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             ++NG KN+++IAVETD +F  A+  KEYLKDP+KF
Sbjct  241   IVNGLKNLIAIAVETDITFEAAEMAKEYLKDPTKF  275



>ref|XP_001352888.1| GA20389 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL30389.1| GA20389 [Drosophila pseudoobscura pseudoobscura]
Length=317

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 204/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFVKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             +V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   NVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGLIV  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++ L++ YPT+A+APH
Sbjct  180   ISPFSYGLIVSQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  240   SIANGFKNLLAIAATTEVEFKEATTIKEYIKDPSKF  275



>gb|AAL62465.1| 60S acidic ribosomal protein P0 [Spodoptera frugiperda]
Length=315

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/275 (55%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3     REDKATWKTNYFTKIIQLLDEYPKCFIVGADNVGSTQMQQIRISLRGHSIVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++I+ H E   N A+  L+P + GNVG +FT+GDL +V +++ + KV APAR G +AP+ 
Sbjct  63    KAIKDHLET--NPALEKLLPHIKGNVGFVFTRGDLVDVRDKLLENKVRAPARPGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+P +LD+  +DL EKF  GV+ V +LSLAI YPT+A+APH 
Sbjct  181   SPFSYGLVVKQVYDSGTIFAPAILDIKPEDLREKFMAGVANVAALSLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             ++NG+KN+L+IA  T+  F  A  +KE++KDPSKF
Sbjct  241   IVNGFKNLLAIAAVTEVEFKEAQTIKEFIKDPSKF  275



>ref|XP_004522331.1| PREDICTED: 60S acidic ribosomal protein P0-like [Ceratitis capitata]
 sp|Q9U3U0.1|RLA0_CERCA RecName: Full=60S acidic ribosomal protein P0; Short=CcP0 [Ceratitis 
capitata]
 emb|CAB63647.1| P0 protein [Ceratitis capitata]
Length=317

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 201/276 (73%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DEY +  I  ADNVGS Q+QNIR  LRG  VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARAGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
              V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   PVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++SL I YPT+A+APH
Sbjct  180   ISPFSYGLAITQVYDSGSIFSPEILDIKPEDLRAKFQAGVANLAAVSLQIGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  T+  F  A  +KE++KDPSKF
Sbjct  240   SIANGFKNLLAIAASTEVEFKQAATIKEFIKDPSKF  275



>ref|XP_002068394.1| GK20443 [Drosophila willistoni]
 gb|EDW79380.1| GK20443 [Drosophila willistoni]
Length=317

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 204/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NPQLEKLLPYIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             +V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   NVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGLIV  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++ L++ YPT+A+APH
Sbjct  180   ISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  240   SIANGFKNLLAIAATTEVEFKEATTIKEYIKDPSKF  275



>emb|CAD29995.1| ribosomal P0 protein [Bombyx mori]
Length=316

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3     REDKATWKSNYFVKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVQAPARPGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL  KF  GV+ V +LSLAI YPT+A+APH 
Sbjct  181   SPFSYGLVVKQVYDSGTIFAPEILDIKPEDLRAKFQAGVANVAALSLAIGYPTIASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  T+  F  A  +KE++KDPSKF
Sbjct  241   IANGFKNLLAIAAVTEVEFEEATTIKEFIKDPSKF  275



>ref|NP_001037123.1| ribosomal protein P0 [Bombyx mori]
 gb|AAV34809.1| ribosomal protein P0 [Bombyx mori]
Length=316

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3     REDKATWKSNYFVKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++I+ H +N  N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVQAPARPGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL  KF  GV+ V +LSLAI YPT+A+APH 
Sbjct  181   SPFSYGLVVKQVYDSGTIFAPEILDIKPEDLRAKFQAGVANVAALSLAIGYPTIASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  T+  F  A  +KE++KDPSKF
Sbjct  241   IANGFKNLLAIAAVTEVEFEEATTIKEFIKDPSKF  275



>ref|XP_011196704.1| PREDICTED: 60S acidic ribosomal protein P0 [Bactrocera cucurbitae]
Length=316

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 201/276 (73%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DEY +  I  ADNVGS Q+QNIR  LRG  VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARAGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
              V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   HVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++SL I YPT+A+APH
Sbjct  180   ISPFSYGLAITQVYDSGSIFSPEILDIKPEDLRAKFQAGVANLAAVSLQIGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  T+  F  A  +KE++KDPSKF
Sbjct  240   SVANGFKNLLAIAAATEVDFKEAATIKEFIKDPSKF  275



>ref|XP_011629802.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pogonomyrmex 
barbatus]
Length=317

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ LAI YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLASVCLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  241   IANGFKNLLAIAAVTEVEFAEAATIKEYIKDPSKF  275



>gb|ABW16870.1| ribosomal protein P0 [Haemaphysalis longicornis]
Length=320

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 203/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ K   K  Y  +L QLLDE+ +  I   DNVGS Q+Q IR  LR  +V+LMGKNTMI
Sbjct  2     VREDKTTWKSNYFLRLVQLLDEFPKCFIVGVDNVGSKQMQTIRVSLRKHAVLLMGKNTMI  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H +N  N A+  L+P + GNVG +FTK DL EV E++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLDN--NPALERLLPHIKGNVGFVFTKEDLTEVREKIIENKVKAPARAGALAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DV++P  NTGL P +TSFFQ L IPTKI+KGT+EI+  + LI+K D+VG+SEA LL  L 
Sbjct  120   DVMIPAQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKDDRVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +L VYD+G+VF+P++LD+T +DL   F  GV  V S+SLAI YPT+A+APH
Sbjct  180   ISPFSYGLKILQVYDSGTVFAPDILDITPEDLRSAFVEGVRNVASVSLAIGYPTVASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              ++NG KN+++IA+ETD +F  A+  KEY+KDPSKF
Sbjct  240   SIVNGLKNLIAIALETDITFKEAEMAKEYMKDPSKF  275



>gb|ELT92567.1| hypothetical protein CAPTEDRAFT_167366, partial [Capitella teleta]
Length=320

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 202/276 (73%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ K+  K +Y  KL +L+DEY +  +   DNVGS Q+Q IR  LRG  VVLMGKNTM+
Sbjct  2     VREDKSSWKASYFLKLIELIDEYPKCFLVGVDNVGSKQMQQIRIALRGHGVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N ++  L+  + GNVG +FTKGDL EV + + + +VGAPA+ G +AP+
Sbjct  62    RKAIRSHLEN--NPSLEKLLNYIKGNVGFVFTKGDLTEVRKIIQENRVGAPAKAGALAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
              V+V   NTGL P +TSFFQ L IPTKI KGT+EI+  V+LI++G+KVG+SEA LL  L 
Sbjct  120   SVMVTARNTGLGPEKTSFFQALAIPTKITKGTIEILNDVQLIKEGEKVGASEATLLTMLK  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL++  VYD+G+VF P +LD+++DD+  KF  GVS V SL LAI YPTLA+ PH
Sbjct  180   IMPFSYGLVIQQVYDSGTVFHPSILDMSDDDIRGKFMSGVSRVASLCLAIGYPTLASVPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              ++NG+KN+L++A  TD  F  A+ VKE+LKDPSKF
Sbjct  240   SVVNGFKNLLAVAAATDVEFKEAETVKEFLKDPSKF  275



>gb|AIW62441.1| 60S acidic ribosomal protein [Scytodes thoracica]
Length=320

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 199/275 (72%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ +A  K  Y  KL QLLDEY +  I   D+VGS Q+Q IR  LR D+V+LMGKNTMI+
Sbjct  3     REDRATWKSNYFMKLVQLLDEYPKCFIVGVDDVGSRQMQQIRLSLRKDAVLLMGKNTMIR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H EN  N A+  +IP + GNVG +FTK DL EV +++   KV APAR G +AP D
Sbjct  63    KAIRGHMEN--NPALEKIIPHIRGNVGFVFTKEDLVEVRDKIIDNKVKAPARAGAIAPCD  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++ P NTGL P +TSFFQ L IPTKI+KGT+EI   + LI+K DKVG+SEA LL  L +
Sbjct  121   VILQPQNTGLGPEKTSFFQALQIPTKISKGTIEISNEIHLIKKEDKVGASEATLLNMLNV  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PF+YGL +  VYD+G+VFSPE+LD+T +DL  KF  GV  + S+SL I YPTLA+ PH 
Sbjct  181   SPFTYGLKIRQVYDSGTVFSPEILDITSEDLQAKFMEGVVNIASVSLQIGYPTLASVPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             +ING KN+++IA+ETD +F  A+  KEY+KDPSKF
Sbjct  241   IINGLKNLIAIALETDITFKEAEMAKEYMKDPSKF  275



>ref|XP_008544624.1| PREDICTED: 60S acidic ribosomal protein P0 [Microplitis demolitor]
Length=316

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/275 (54%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     REDKASWKSNYFLKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGSAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVRDKLVENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + ++ LA+ YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLKEKFMAGVANLAAVCLAVGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             ++NG+KN+L++A  TD  F  A  +KE++KDPSKF
Sbjct  241   IVNGFKNLLALAAVTDVEFEQAQTIKEFIKDPSKF  275



>gb|EHJ75936.1| ribosomal protein P0 [Danaus plexippus]
Length=316

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/275 (55%), Positives = 203/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3     REDKASWKTNYFTKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++I+ H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIKDHLET--NPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVRAPARPGAIAPLA  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +T+FFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAHNTGLGPEKTAFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+P +LD+  +DL  KF  GV+ V +LSLAI YPT+A+APH 
Sbjct  181   SPFSYGLVVKQVYDSGTIFAPAILDIKPEDLRAKFQEGVANVAALSLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  T+  F  A+ +KE++KDPSKF
Sbjct  241   IANGFKNLLAIAAVTEVEFKEANTIKEFIKDPSKF  275



>ref|XP_001973718.1| GG16244 [Drosophila erecta]
 gb|EDV52744.1| GG16244 [Drosophila erecta]
Length=317

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 203/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
              V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   HVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGLIV  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++ L++ YPT+A+APH
Sbjct  180   ISPFSYGLIVSQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  240   SIANGFKNLLAIAATTEVEFKEATTIKEYIKDPSKF  275



>ref|XP_011297993.1| PREDICTED: 60S acidic ribosomal protein P0 [Fopius arisanus]
Length=317

 Score =   293 bits (750),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/275 (55%), Positives = 203/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     REDKASWKSNYFTKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGSAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + ++ LAI YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFLAGVANLAAVCLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L++A  TD  F  A  +KEY+KDPSKF
Sbjct  241   IANGFKNLLAVAAVTDVEFAEAATIKEYIKDPSKF  275



>ref|XP_011347099.1| PREDICTED: 60S acidic ribosomal protein P0 [Cerapachys biroi]
 gb|EZA49150.1| 60S acidic ribosomal protein P0 [Cerapachys biroi]
Length=317

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 151/275 (55%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD++ +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSQYFTKLVQLLDDFPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ LAI YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLASVCLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  241   IANGFKNLLAIAAVTEVEFTEAATIKEYIKDPSKF  275



>ref|XP_003743791.1| PREDICTED: 60S acidic ribosomal protein P0-like [Metaseiulus 
occidentalis]
Length=316

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 157/276 (57%), Positives = 199/276 (72%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             VK  +   K  Y  KL QL+DEY +  I   DNVGS Q+Q IR  LR  +V+LMGKNTM+
Sbjct  2     VKGDRPTWKSNYFLKLVQLMDEYPKCFIVGVDNVGSKQMQQIRVSLRSSAVLLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++I+ H EN  N A+  L+P + GNVG +FTK DL EV E++   KV APAR G +AP+
Sbjct  62    RKAIKGHLEN--NPALEKLLPSIKGNVGFVFTKEDLCEVREKIMNNKVQAPARAGAIAPV  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DV VP  NTGL P +TSFFQ L+IPTKI+KGT+EII  + LI+ GDKVG+SEA LL  L 
Sbjct  120   DVHVPAQNTGLGPEKTSFFQALHIPTKISKGTIEIINDIHLIKVGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGLI+ +VYDNG++F+PEVLD+T +DL  +F  GV  V ++SL I YPTLA+APH
Sbjct  180   ISPFSYGLIIQAVYDNGTIFAPEVLDITPEDLKARFMNGVRNVAAVSLKIGYPTLASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              ++NG KN++SIA+ TD  F  A   KEYLKDPSKF
Sbjct  240   SIVNGLKNLISIALSTDIEFEAAKLAKEYLKDPSKF  275



>ref|NP_524211.1| ribosomal protein LP0, isoform A [Drosophila melanogaster]
 ref|NP_001262202.1| ribosomal protein LP0, isoform B [Drosophila melanogaster]
 sp|P19889.1|RLA0_DROME RecName: Full=60S acidic ribosomal protein P0; AltName: Full=Apurinic-apyrimidinic 
endonuclease; AltName: Full=DNA-(apurinic 
or apyrimidinic site) lyase [Drosophila melanogaster]
 gb|AAA53372.1| DNA repair protein [Drosophila melanogaster]
 gb|AAF51807.1| ribosomal protein LP0, isoform A [Drosophila melanogaster]
 gb|AAL68335.1| RE74511p [Drosophila melanogaster]
 gb|AAX33595.1| GH01513p [Drosophila melanogaster]
 gb|AGB94895.1| ribosomal protein LP0, isoform B [Drosophila melanogaster]
Length=317

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 203/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
              V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   HVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGLIV  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++ L++ YPT+A+APH
Sbjct  180   ISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  240   SIANGFKNLLAIAATTEVEFKEATTIKEYIKDPSKF  275



>gb|AJQ18906.1| acidic ribosomal protein P0, partial [Rhipicephalus sanguineus]
Length=314

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 201/276 (73%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ K   +  Y  +L QLLDEY +  I   DNVGS Q+Q IR  LR  +V+LMGKNTMI
Sbjct  2     VREDKTTWRSNYFLRLVQLLDEYPKCFIVGVDNVGSKQMQTIRVSLRKHAVLLMGKNTMI  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H +N  N A+  L+P + GNVG +FTK DL EV E++   KV APAR G +AP+
Sbjct  62    RKAIRGHLDN--NPALEKLLPHIKGNVGFVFTKEDLTEVREKIIDNKVKAPARAGALAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DV++P  NTGL P +TSFFQ L IPTKI+KGT+EI+  + LI+K D+VG+SEA LL  L 
Sbjct  120   DVMIPAQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKDDRVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +L VYD+G+VFSP++LD+T +DL   F  GV  V ++SL+I YPT+A+ PH
Sbjct  180   ISPFSYGLKILQVYDSGTVFSPDILDITPEDLRSAFVEGVRNVAAVSLSIGYPTVASVPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              ++NG KN+++IAVETD +F  A+  KEYLKDPSKF
Sbjct  240   SIVNGLKNLIAIAVETDITFKEAEMAKEYLKDPSKF  275



>ref|XP_002040897.1| GM22429 [Drosophila sechellia]
 ref|XP_002085890.1| GD15019 [Drosophila simulans]
 gb|EDW44450.1| GM22429 [Drosophila sechellia]
 gb|EDX11475.1| GD15019 [Drosophila simulans]
Length=317

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 203/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
              V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   HVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGLIV  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++ L++ YPT+A+APH
Sbjct  180   ISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  240   SIANGFKNLLAIAATTEVEFKEATTIKEYIKDPSKF  275



>ref|XP_002095795.1| RpLP0 [Drosophila yakuba]
 gb|EDW95507.1| RpLP0 [Drosophila yakuba]
Length=317

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/276 (55%), Positives = 203/276 (74%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ KA  K  Y  K+ +L DE+ +  I  ADNVGS Q+QNIR  LRG +VVLMGKNTM+
Sbjct  2     VRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMM  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H EN  N  +  L+P + GNVG +FTKGDL EV +++ + KV APAR G +AP+
Sbjct  62    RKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
              V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L 
Sbjct  120   HVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGLIV  VYD+GS+FSPE+LD+  +DL  KF  GV+ + ++ L++ YPT+A+APH
Sbjct  180   ISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRVKFQQGVANLAAVCLSVGYPTIASAPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              + NG+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  240   SIANGFKNLLAIAATTEVEFKEATTIKEYIKDPSKF  275



>gb|AJQ18908.1| acidic ribosomal protein P0, partial [Dermacentor nitens]
Length=314

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 200/276 (72%), Gaps = 2/276 (1%)
 Frame = +1

Query  196   VKQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMI  375
             V++ K   K  Y  +L QL DEY +  I   DNVGS Q+Q IR  LR  +V+LMGKNTMI
Sbjct  2     VREDKTTWKSNYFLRLVQLFDEYPKCFIVGVDNVGSKQMQTIRVSLRKHAVLLMGKNTMI  61

Query  376   KRSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPI  555
             +++IR H +N  N A+  L+P + GNVG +FTK DL EV E++   KV APAR G +AP+
Sbjct  62    RKAIRGHLDN--NPALEKLLPHIKGNVGFVFTKEDLTEVREKIIDNKVKAPARAGALAPL  119

Query  556   DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLG  735
             DV++P  NTGL P +TSFFQ L IPTKI+KGT+EI+  + LI+K D+VG+SEA LL  L 
Sbjct  120   DVMIPAQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKDDRVGASEATLLNMLN  179

Query  736   IRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPH  915
             I PFSYGL +L VYD+G+VFSP++LD+T +DL   F  GV  V ++SL+I YPT+A+ PH
Sbjct  180   ISPFSYGLKILQVYDSGTVFSPDILDITPEDLRSAFVEGVRNVAAVSLSIGYPTVASVPH  239

Query  916   MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
              ++NG KN+++IAVETD +F  A+  KEYLKDPSKF
Sbjct  240   SIVNGLKNLIAIAVETDITFKEAEMAKEYLKDPSKF  275



>gb|KDR14762.1| 60S acidic ribosomal protein P0 [Zootermopsis nevadensis]
Length=316

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/275 (55%), Positives = 202/275 (73%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ K   K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     REDKTAWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGVAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP  
Sbjct  63    KAIRGHLER--NPALEKLLPHVRGNVGFVFTRGDLVEVRDKLLENKVRAPARNGAIAPCP  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V ++++GDKVG+S+A LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKEGDKVGASDATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F P +LD+  +DL  KFA GV+ + ++ L+ISYPTLA+APH 
Sbjct  181   SPFSYGLLVQMVYDSGTIFEPAILDIKPEDLRVKFAEGVARLAAVCLSISYPTLASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             ++NG+KN+L+IA  TD  F  A  +KE+LKDPSKF
Sbjct  241   VVNGFKNLLAIAAATDVEFKEAQTIKEFLKDPSKF  275



>gb|EYU19990.1| hypothetical protein MIMGU_mgv1a0100892mg, partial [Erythranthe 
guttata]
Length=213

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +1

Query  517   VGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDK  696
             VGAPARVGLVAPIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI+KGDK
Sbjct  1     VGAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDK  60

Query  697   VGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLS  876
             VGSSEAALL+KLGIRPFSYGL+V  VYDNGSVFSPEVLDLTEDDL+ KFA+GVSMVTSL+
Sbjct  61    VGSSEAALLSKLGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIGKFAMGVSMVTSLA  120

Query  877   LAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             LAISYPTLAAAPHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  121   LAISYPTLAAAPHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  169



>gb|ACY95307.1| ribosomal protein P0 [Manduca sexta]
Length=317

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/275 (55%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  K+ QLLDEY +  I  ADNVGS Q+Q IR  LRG S+VLMGKNTM++
Sbjct  3     REDKATWKTNYFTKIIQLLDEYPKCFIVGADNVGSQQMQQIRISLRGHSIVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++I+ H +N  N A+  L+P + GNVG +FT+GDL +V +++ + KV APAR G +AP+ 
Sbjct  63    KAIKDHLDN--NPALEKLLPHIKGNVGFVFTRGDLVDVRDKLLENKVQAPARPGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VVIPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+P +LD+  +DL EKF  GV+ V +LSL+I YPT+A+APH 
Sbjct  181   SPFSYGLVVKQVYDSGTIFAPAILDIKPEDLREKFLAGVANVAALSLSIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             + NG+KN+L+IA  T+  F  A  +KE++KDPSKF
Sbjct  241   IANGFKNLLAIAAVTEVEFKEATTIKEFIKDPSKF  275



>ref|XP_011871965.1| PREDICTED: 60S acidic ribosomal protein P0 [Vollenhovia emeryi]
Length=318

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 232/318 (73%), Gaps = 2/318 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD++ +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKASWKSNYFTKLVQLLDDFPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ L I YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLASVCLTIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaaeek  1098
             + NG+KN+L++A  T+  F  A  +KEY+KDP+KFA AAA VAA  A +A A AA  +E+
Sbjct  241   IANGFKNLLAVAAVTEVEFAEATTIKEYVKDPTKFAAAAAAVAAPVAAAADAPAAEKKEE  300

Query  1099  keepeeeseDEMGFSLFD  1152
             K+E  E  +D+MGF LFD
Sbjct  301   KKEESESEDDDMGFGLFD  318



>ref|XP_001607606.1| PREDICTED: 60S acidic ribosomal protein P0 [Nasonia vitripennis]
Length=316

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/275 (55%), Positives = 202/275 (73%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG +VVLMGKNTM++
Sbjct  3     REDKASWKAGYFSKLIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGTAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++I+ H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIKGHIER--NAALEKLLPHIRGNVGFVFTRGDLVEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGLIV  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ LAI YPT+A+APH 
Sbjct  181   SPFSYGLIVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLASVCLAIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             +  G+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  241   IAYGFKNLLAIAAVTEVEFAEAATIKEYIKDPSKF  275



>ref|XP_003706895.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X4 [Megachile 
rotundata]
Length=316

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/275 (54%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD+Y +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +T+FFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTAFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGLIV  VYD+G++F+PE+LD+  +DL EKF  GV+ + ++ L+I YPT+A+ PH 
Sbjct  181   SPFSYGLIVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLAAVCLSIGYPTIASVPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             ++NG+KN+L+IA  T+  F  A  +KEY+KDPSKF
Sbjct  241   IVNGFKNLLAIAAVTEIEFAEAATIKEYIKDPSKF  275



>ref|XP_012058112.1| PREDICTED: 60S acidic ribosomal protein P0 [Atta cephalotes]
Length=318

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/275 (54%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +1

Query  199   KQTKAQKKIAYDQKLCQLLDEYTQILIAVADNVGSNQLQNIRKGLRGDSVVLMGKNTMIK  378
             ++ KA  K  Y  KL QLLD++ +  I  ADNVGS Q+Q IR  LRG++VVLMGKNTM++
Sbjct  3     REDKATWKSNYFTKLVQLLDDFPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTMMR  62

Query  379   RSIRVHAENTGNTAILNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPID  558
             ++IR H E   N A+  L+P + GNVG +FT+GDL EV +++ + KV APAR G +AP+ 
Sbjct  63    KAIRGHIER--NAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS  120

Query  559   VVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGI  738
             V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL  L I
Sbjct  121   VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI  180

Query  739   RPFSYGLIVLSVYDNGSVFSPevldlteddlleKFALGVSMVTSLSLAISYPTLAAAPHM  918
              PFSYGL+V  VYD+G++F+PE+LD+  +DL EKF  GV+ + S+ L I YPT+A+APH 
Sbjct  181   SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLREKFMAGVANLASVCLMIGYPTVASAPHS  240

Query  919   LINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  1023
             ++NG+KN+L++A  T+  F  A  +KEY+KDPSKF
Sbjct  241   IVNGFKNLLAVAAVTEVEFAEATTIKEYVKDPSKF  275



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4142156179002