BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1479

Length=840
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg             334   2e-106   
emb|CDP04037.1|  unnamed protein product                                321   3e-106   Coffea canephora [robusta coffee]
ref|XP_008244615.1|  PREDICTED: probable inactive receptor kinase...    331   5e-106   Prunus mume [ume]
gb|KHN40997.1|  Putative inactive receptor kinase                       320   6e-106   Glycine soja [wild soybean]
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...    333   1e-105   Nelumbo nucifera [Indian lotus]
gb|KHN30614.1|  Putative inactive receptor kinase                       319   2e-105   Glycine soja [wild soybean]
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...    330   6e-105   
ref|XP_012077868.1|  PREDICTED: probable inactive receptor kinase...    328   3e-104   Jatropha curcas
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...    328   4e-104   Pyrus x bretschneideri [bai li]
emb|CBI15804.3|  unnamed protein product                                328   6e-104   Vitis vinifera
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative     327   7e-104   
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...    328   9e-104   Vitis vinifera
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...    327   2e-103   Nicotiana tomentosiformis
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...    326   4e-103   Nicotiana sylvestris
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...    325   4e-103   Solanum lycopersicum
ref|XP_010098027.1|  putative inactive receptor kinase                  328   4e-103   
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...    324   1e-102   
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...    324   1e-102   Nelumbo nucifera [Indian lotus]
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...    323   2e-102   Pyrus x bretschneideri [bai li]
gb|KHN24722.1|  Putative inactive receptor kinase                       313   3e-102   Glycine soja [wild soybean]
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...    323   7e-102   Solanum tuberosum [potatoes]
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...    323   8e-102   Glycine max [soybeans]
ref|XP_010094441.1|  putative inactive receptor kinase                  322   8e-102   Morus notabilis
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg             322   1e-101   
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                   322   1e-101   Citrus sinensis [apfelsine]
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...    322   1e-101   
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg             322   1e-101   Citrus clementina [clementine]
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...    322   1e-101   Prunus mume [ume]
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                   322   2e-101   Citrus sinensis [apfelsine]
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg             322   2e-101   Citrus clementina [clementine]
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...    322   3e-101   
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                   322   3e-101   Citrus sinensis [apfelsine]
ref|XP_011041763.1|  PREDICTED: probable inactive receptor kinase...    317   4e-101   Populus euphratica
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...    321   5e-101   Nicotiana sylvestris
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...    319   1e-100   Fragaria vesca subsp. vesca
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g             320   1e-100   Phaseolus vulgaris [French bean]
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...    319   2e-100   Nicotiana tomentosiformis
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...    318   4e-100   Cucumis sativus [cucumbers]
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...    317   6e-100   
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...    318   6e-100   
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...    317   1e-99    Populus euphratica
ref|XP_002325632.1|  putative plant disease resistance family pro...    317   1e-99    Populus trichocarpa [western balsam poplar]
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...    315   3e-99    
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...    315   4e-99    Fragaria vesca subsp. vesca
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...    316   4e-99    Sesamum indicum [beniseed]
gb|KEH34523.1|  LRR receptor-like kinase                                315   4e-99    Medicago truncatula
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...    316   4e-99    
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...    314   1e-98    Cucumis melo [Oriental melon]
gb|KHN18649.1|  Putative inactive receptor kinase                       313   1e-98    Glycine soja [wild soybean]
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...    314   1e-98    
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...    315   2e-98    
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...    315   2e-98    Glycine max [soybeans]
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...    313   2e-98    
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...    313   2e-98    Cucumis sativus [cucumbers]
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...    313   3e-98    Glycine max [soybeans]
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...    313   3e-98    Glycine max [soybeans]
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...    313   3e-98    Glycine max [soybeans]
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...    313   3e-98    Glycine max [soybeans]
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg             313   4e-98    Citrus clementina [clementine]
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                   313   4e-98    Citrus sinensis [apfelsine]
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...    313   5e-98    
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...    313   6e-98    Medicago truncatula
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...    312   8e-98    Solanum tuberosum [potatoes]
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...    311   2e-97    Cicer arietinum [garbanzo]
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...    311   2e-97    Sesamum indicum [beniseed]
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g             311   4e-97    Phaseolus vulgaris [French bean]
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...    309   1e-96    Populus euphratica
ref|XP_002319979.1|  putative plant disease resistance family pro...    309   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative     308   1e-96    Ricinus communis
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...    308   2e-96    
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...    308   2e-96    Solanum lycopersicum
emb|CAN80590.1|  hypothetical protein VITISV_040789                     308   3e-96    Vitis vinifera
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...    308   3e-96    
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...    308   4e-96    
gb|KJB20517.1|  hypothetical protein B456_003G153000                    308   4e-96    Gossypium raimondii
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...    307   5e-96    Sesamum indicum [beniseed]
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...    307   5e-96    
gb|ABK93951.1|  unknown                                                 298   6e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011001674.1|  PREDICTED: probable inactive receptor kinase...    306   7e-96    Populus euphratica
gb|KHG05843.1|  hypothetical protein F383_32232                         307   1e-95    Gossypium arboreum [tree cotton]
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...    305   2e-95    Sesamum indicum [beniseed]
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...    305   3e-95    Phoenix dactylifera
ref|XP_012091018.1|  PREDICTED: probable inactive receptor kinase...    305   4e-95    Jatropha curcas
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...    305   4e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...    305   6e-95    Nicotiana sylvestris
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...    304   8e-95    
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...    304   1e-94    
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...    305   1e-94    Nicotiana tomentosiformis
gb|KJB29842.1|  hypothetical protein B456_005G120900                    304   2e-94    Gossypium raimondii
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...    302   2e-94    Populus euphratica
gb|KHG17391.1|  hypothetical protein F383_22576                         303   3e-94    Gossypium arboreum [tree cotton]
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...    305   3e-94    Nicotiana sylvestris
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...    302   4e-94    Populus euphratica
gb|ABR17070.1|  unknown                                                 293   6e-94    Picea sitchensis
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...    300   2e-93    Elaeis guineensis
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...    300   3e-93    Populus euphratica
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg             300   3e-93    Eutrema salsugineum [saltwater cress]
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...    300   3e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006371315.1|  putative plant disease resistance family pro...    299   6e-93    
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg                298   6e-93    Erythranthe guttata [common monkey flower]
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...    299   8e-93    Populus euphratica
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...    299   8e-93    Populus euphratica
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g             299   1e-92    
emb|CDP13882.1|  unnamed protein product                                298   2e-92    Coffea canephora [robusta coffee]
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...    295   2e-91    Nicotiana sylvestris
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg             294   4e-91    Citrus clementina [clementine]
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg             294   4e-91    Citrus clementina [clementine]
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                   294   6e-91    Citrus sinensis [apfelsine]
gb|KJB71491.1|  hypothetical protein B456_011G125200                    293   9e-91    Gossypium raimondii
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...    293   1e-90    
emb|CDY58565.1|  BnaC03g12450D                                          293   2e-90    Brassica napus [oilseed rape]
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...    292   3e-90    Phoenix dactylifera
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg             293   3e-90    
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...    291   6e-90    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH57151.1|  AT3G08680                                              280   6e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...    291   7e-90    Brassica rapa
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...    291   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...    290   2e-89    
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...    289   4e-89    Tarenaya hassleriana [spider flower]
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...    289   4e-89    
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...    289   5e-89    
ref|XP_012091108.1|  PREDICTED: probable inactive receptor kinase...    288   7e-89    
gb|EYU36892.1|  hypothetical protein MIMGU_mgv1a0177021mg               275   7e-89    Erythranthe guttata [common monkey flower]
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...    289   8e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...    288   9e-89    Eucalyptus grandis [rose gum]
emb|CDP06375.1|  unnamed protein product                                289   1e-88    Coffea canephora [robusta coffee]
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...    287   2e-88    
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    287   3e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg             286   6e-88    Capsella rubella
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...    286   6e-88    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB67957.1|  hypothetical protein B456_010G219700                    285   6e-88    Gossypium raimondii
gb|KHF99691.1|  hypothetical protein F383_18108                         285   6e-88    Gossypium arboreum [tree cotton]
ref|XP_002864562.1|  predicted protein                                  286   8e-88    Arabidopsis lyrata subsp. lyrata
ref|XP_010670041.1|  PREDICTED: probable inactive receptor kinase...    286   9e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein     286   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...    285   1e-87    Theobroma cacao [chocolate]
gb|KCW50324.1|  hypothetical protein EUGRSUZ_J00100                     285   2e-87    Eucalyptus grandis [rose gum]
ref|XP_011622690.1|  PREDICTED: probable inactive receptor kinase...    284   6e-87    Amborella trichopoda
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...    283   7e-87    Camelina sativa [gold-of-pleasure]
ref|XP_009146990.1|  PREDICTED: probable inactive receptor kinase...    282   2e-86    Brassica rapa
emb|CDY35996.1|  BnaA05g29540D                                          282   2e-86    Brassica napus [oilseed rape]
gb|ACA61611.1|  hypothetical protein AP2_E06.2                          283   2e-86    Arabidopsis lyrata subsp. petraea
ref|XP_006357316.1|  PREDICTED: probable inactive receptor kinase...    280   4e-86    Solanum tuberosum [potatoes]
ref|XP_006587908.1|  PREDICTED: probable inactive receptor kinase...    281   4e-86    Glycine max [soybeans]
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg             281   5e-86    Eutrema salsugineum [saltwater cress]
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...    280   6e-86    Glycine max [soybeans]
emb|CDY02808.1|  BnaC02g10810D                                          275   7e-86    
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein     280   1e-85    Arabidopsis thaliana [mouse-ear cress]
emb|CDY27986.1|  BnaC05g43880D                                          280   1e-85    Brassica napus [oilseed rape]
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...    280   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN40609.1|  Putative inactive receptor kinase                       279   1e-85    Glycine soja [wild soybean]
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170             280   2e-85    
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...    280   2e-85    
ref|XP_009123870.1|  PREDICTED: probable inactive receptor kinase...    278   3e-85    Brassica rapa
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...    278   7e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007140053.1|  hypothetical protein PHAVU_008G080500g             277   9e-85    Phaseolus vulgaris [French bean]
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...    276   3e-84    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN48152.1|  Putative inactive receptor kinase                       263   8e-84    Glycine soja [wild soybean]
gb|EEE55588.1|  hypothetical protein OsJ_03884                          263   1e-83    Oryza sativa Japonica Group [Japonica rice]
gb|KEH23299.1|  LRR receptor-like kinase                                273   3e-83    Medicago truncatula
gb|KEH35517.1|  receptor-like kinase                                    274   3e-83    Medicago truncatula
ref|XP_004511532.1|  PREDICTED: probable inactive receptor kinase...    266   4e-83    Cicer arietinum [garbanzo]
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg             273   4e-83    Prunus persica
ref|XP_004308997.1|  PREDICTED: probable inactive receptor kinase...    273   5e-83    Fragaria vesca subsp. vesca
ref|XP_002281635.1|  PREDICTED: probable inactive receptor kinase...    273   6e-83    Vitis vinifera
emb|CDY32713.1|  BnaA02g07750D                                          273   8e-83    Brassica napus [oilseed rape]
ref|XP_007013302.1|  Leucine-rich repeat protein kinase family pr...    273   9e-83    
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...    273   9e-83    
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...    272   1e-82    Cicer arietinum [garbanzo]
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...    273   1e-82    Cicer arietinum [garbanzo]
ref|XP_002529343.1|  Nodulation receptor kinase precursor, putative     273   1e-82    Ricinus communis
ref|XP_010921194.1|  PREDICTED: probable inactive receptor kinase...    264   1e-82    Elaeis guineensis
emb|CDX88667.1|  BnaA03g09820D                                          271   2e-82    
ref|XP_008234182.1|  PREDICTED: probable inactive receptor kinase...    271   2e-82    Prunus mume [ume]
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...    272   2e-82    Brassica rapa
ref|XP_006451034.1|  hypothetical protein CICLE_v10007694mg             271   4e-82    
ref|XP_012078693.1|  PREDICTED: probable inactive receptor kinase...    271   4e-82    Jatropha curcas
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g             271   5e-82    Phaseolus vulgaris [French bean]
ref|XP_006475765.1|  PREDICTED: probable inactive receptor kinase...    271   7e-82    Citrus sinensis [apfelsine]
gb|EEE64112.1|  hypothetical protein OsJ_18944                          270   8e-82    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055854.1|  Os05g0480400                                       270   8e-82    
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...    270   2e-81    Fragaria vesca subsp. vesca
ref|XP_004241083.1|  PREDICTED: probable inactive receptor kinase...    268   2e-81    
gb|KHG24076.1|  hypothetical protein F383_10304                         269   4e-81    Gossypium arboreum [tree cotton]
ref|XP_007204237.1|  hypothetical protein PRUPE_ppa002548mg             269   5e-81    Prunus persica
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...    268   6e-81    Oryza brachyantha
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...    267   7e-81    
ref|XP_009363779.1|  PREDICTED: probable inactive receptor kinase...    268   7e-81    Pyrus x bretschneideri [bai li]
gb|EMT17815.1|  Putative inactive receptor kinase                       267   1e-80    
gb|KJB54134.1|  hypothetical protein B456_009G022300                    268   1e-80    Gossypium raimondii
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...    268   1e-80    Prunus mume [ume]
gb|ACZ98536.1|  protein kinase                                          268   1e-80    Malus domestica [apple tree]
emb|CDY22164.1|  BnaC01g39370D                                          265   1e-80    Brassica napus [oilseed rape]
ref|XP_008343962.1|  PREDICTED: probable inactive receptor kinase...    267   1e-80    
ref|XP_008386031.1|  PREDICTED: probable inactive receptor kinase...    267   2e-80    
ref|XP_010925785.1|  PREDICTED: probable inactive receptor kinase...    267   2e-80    
gb|KHG18372.1|  hypothetical protein F383_03411                         267   2e-80    Gossypium arboreum [tree cotton]
ref|XP_009374078.1|  PREDICTED: probable inactive receptor kinase...    265   2e-80    
ref|XP_010098956.1|  putative inactive receptor kinase                  267   2e-80    Morus notabilis
gb|EEC75189.1|  hypothetical protein OsI_11426                          263   2e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_003611028.1|  Probably inactive receptor-like protein kinase     266   2e-80    Medicago truncatula
ref|XP_004300851.1|  PREDICTED: probable inactive receptor kinase...    266   2e-80    Fragaria vesca subsp. vesca
ref|XP_010047774.1|  PREDICTED: probable inactive receptor kinase...    266   3e-80    Eucalyptus grandis [rose gum]
ref|XP_011009200.1|  PREDICTED: probable inactive receptor kinase...    266   3e-80    Populus euphratica
ref|XP_010249925.1|  PREDICTED: probable inactive receptor kinase...    266   3e-80    Nelumbo nucifera [Indian lotus]
ref|XP_004511531.1|  PREDICTED: probable inactive receptor kinase...    265   4e-80    Cicer arietinum [garbanzo]
ref|XP_002454913.1|  hypothetical protein SORBIDRAFT_03g001310          264   4e-80    
ref|XP_010322111.1|  PREDICTED: probable inactive receptor kinase...    265   5e-80    Solanum lycopersicum
ref|XP_009371417.1|  PREDICTED: probable inactive receptor kinase...    266   5e-80    Pyrus x bretschneideri [bai li]
gb|KHN37771.1|  Putative inactive receptor kinase                       255   5e-80    Glycine soja [wild soybean]
gb|KJB64834.1|  hypothetical protein B456_010G067400                    266   5e-80    Gossypium raimondii
gb|AFK45382.1|  unknown                                                 265   6e-80    Medicago truncatula
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...    265   7e-80    Phoenix dactylifera
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...    265   1e-79    Glycine max [soybeans]
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...    264   1e-79    Elaeis guineensis
ref|XP_008376328.1|  PREDICTED: probable inactive receptor kinase...    264   2e-79    Malus domestica [apple tree]
dbj|BAB62593.1|  putative receptor-like protein kinase                  264   2e-79    Oryza sativa Japonica Group [Japonica rice]
gb|KHN25658.1|  Putative inactive receptor kinase                       258   2e-79    Glycine soja [wild soybean]
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...    263   2e-79    Oryza brachyantha
ref|XP_004139332.1|  PREDICTED: probable inactive receptor kinase...    264   3e-79    Cucumis sativus [cucumbers]
ref|XP_008458016.1|  PREDICTED: probable inactive receptor kinase...    264   3e-79    Cucumis melo [Oriental melon]
ref|XP_011084098.1|  PREDICTED: probable inactive receptor kinase...    264   3e-79    Sesamum indicum [beniseed]
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...    263   4e-79    Vitis vinifera
ref|NP_001050019.1|  Os03g0332900                                       263   4e-79    
gb|EPS74415.1|  hypothetical protein M569_00340                         263   4e-79    Genlisea aurea
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...    263   4e-79    Brachypodium distachyon [annual false brome]
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...    263   5e-79    Setaria italica
ref|XP_009336254.1|  PREDICTED: probable inactive receptor kinase...    263   5e-79    Pyrus x bretschneideri [bai li]
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110          263   6e-79    Sorghum bicolor [broomcorn]
ref|XP_010254253.1|  PREDICTED: probable inactive receptor kinase...    263   7e-79    Nelumbo nucifera [Indian lotus]
gb|KHN25793.1|  Putative inactive receptor kinase                       262   9e-79    Glycine soja [wild soybean]
ref|XP_007141331.1|  hypothetical protein PHAVU_008G186900g             262   1e-78    Phaseolus vulgaris [French bean]
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...    262   1e-78    Phoenix dactylifera
ref|XP_008649769.1|  PREDICTED: probable inactive receptor kinase...    262   1e-78    
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...    261   2e-78    Brachypodium distachyon [annual false brome]
ref|XP_010109178.1|  putative inactive receptor kinase                  261   2e-78    
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...    261   2e-78    Elaeis guineensis
emb|CBI22555.3|  unnamed protein product                                261   2e-78    Vitis vinifera
ref|XP_002441272.1|  hypothetical protein SORBIDRAFT_09g023570          261   3e-78    Sorghum bicolor [broomcorn]
ref|XP_008794990.1|  PREDICTED: probable inactive receptor kinase...    261   3e-78    Phoenix dactylifera
gb|EYU35188.1|  hypothetical protein MIMGU_mgv1a002709mg                261   3e-78    Erythranthe guttata [common monkey flower]
ref|XP_010533192.1|  PREDICTED: probable inactive receptor kinase...    261   3e-78    Tarenaya hassleriana [spider flower]
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor             261   3e-78    Zea mays [maize]
ref|XP_002960794.1|  hypothetical protein SELMODRAFT_74002              261   4e-78    
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...    261   4e-78    Phoenix dactylifera
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...    260   4e-78    Setaria italica
gb|KEH35437.1|  receptor-like kinase                                    252   4e-78    Medicago truncatula
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...    261   4e-78    Elaeis guineensis
ref|XP_007038934.1|  Leucine-rich repeat protein kinase family pr...    260   4e-78    
emb|CDY03526.1|  BnaC01g15560D                                          249   4e-78    
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...    260   5e-78    
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...    260   6e-78    
gb|EMT10528.1|  Putative inactive receptor kinase                       259   9e-78    
ref|XP_003516715.2|  PREDICTED: probable inactive receptor kinase...    259   9e-78    Glycine max [soybeans]
gb|EMT09037.1|  Putative inactive receptor kinase                       259   1e-77    
ref|XP_008793541.1|  PREDICTED: probable inactive receptor kinase...    259   1e-77    Phoenix dactylifera
ref|XP_010557581.1|  PREDICTED: probable inactive receptor kinase...    259   1e-77    Tarenaya hassleriana [spider flower]
dbj|BAK07296.1|  predicted protein                                      259   1e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...    259   1e-77    Brachypodium distachyon [annual false brome]
ref|XP_008793397.1|  PREDICTED: probable inactive receptor kinase...    259   1e-77    Phoenix dactylifera
dbj|BAJ93317.1|  predicted protein                                      259   1e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009362770.1|  PREDICTED: probable inactive receptor kinase...    259   2e-77    
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...    258   2e-77    Sesamum indicum [beniseed]
ref|XP_002509916.1|  ATP binding protein, putative                      256   2e-77    
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...    258   2e-77    
ref|XP_006590496.1|  PREDICTED: probable inactive receptor kinase...    257   2e-77    Glycine max [soybeans]
ref|XP_008239079.1|  PREDICTED: probable inactive receptor kinase...    258   3e-77    Prunus mume [ume]
ref|XP_010543666.1|  PREDICTED: probable leucine-rich repeat rece...    258   4e-77    Tarenaya hassleriana [spider flower]
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...    258   4e-77    
gb|EMT08914.1|  Putative inactive receptor kinase                       253   5e-77    
ref|XP_003544853.1|  PREDICTED: probable inactive receptor kinase...    258   5e-77    Glycine max [soybeans]
gb|KHN16761.1|  Putative inactive receptor kinase                       250   5e-77    Glycine soja [wild soybean]
gb|AES98409.2|  LRR receptor-like kinase                                256   6e-77    Medicago truncatula
ref|XP_007210296.1|  hypothetical protein PRUPE_ppa002579mg             258   6e-77    Prunus persica
ref|NP_001042446.1|  Os01g0223600                                       253   7e-77    
gb|ERN04237.1|  hypothetical protein AMTR_s00077p00144570               244   7e-77    Amborella trichopoda
ref|XP_010543665.1|  PREDICTED: probable leucine-rich repeat rece...    259   8e-77    
ref|XP_009352353.1|  PREDICTED: probable inactive receptor kinase...    256   1e-76    Pyrus x bretschneideri [bai li]
gb|KJB07168.1|  hypothetical protein B456_001G003200                    256   1e-76    Gossypium raimondii
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor             256   1e-76    
ref|XP_004236305.1|  PREDICTED: probable inactive receptor kinase...    257   1e-76    
ref|XP_007154939.1|  hypothetical protein PHAVU_003G159700g             256   1e-76    
ref|XP_003527143.1|  PREDICTED: probable inactive receptor kinase...    257   1e-76    
ref|XP_004967473.1|  PREDICTED: probable inactive receptor kinase...    256   2e-76    
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090          256   2e-76    
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...    256   2e-76    
ref|XP_001774015.1|  predicted protein                                  255   2e-76    
ref|XP_001778286.1|  predicted protein                                  256   2e-76    
ref|XP_011007941.1|  PREDICTED: probable inactive receptor kinase...    255   3e-76    
ref|XP_006374322.1|  hypothetical protein POPTR_0015s06040g             255   3e-76    
ref|XP_008392458.1|  PREDICTED: probable inactive receptor kinase...    255   3e-76    
ref|XP_010558411.1|  PREDICTED: probable inactive receptor kinase...    254   3e-76    
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...    255   3e-76    
ref|XP_003609204.1|  hypothetical protein MTR_4g113100                  256   4e-76    
ref|XP_010473057.1|  PREDICTED: probable inactive receptor kinase...    256   4e-76    
gb|EMT12910.1|  Putative inactive receptor kinase                       255   4e-76    
ref|XP_010417819.1|  PREDICTED: probable inactive receptor kinase...    255   5e-76    
ref|XP_006351444.1|  PREDICTED: probable inactive receptor kinase...    255   6e-76    
ref|XP_007158557.1|  hypothetical protein PHAVU_002G162400g             253   7e-76    
ref|NP_001168214.1|  uncharacterized protein LOC100381972               243   7e-76    
gb|EEC74787.1|  hypothetical protein OsI_10572                          247   8e-76    
ref|XP_003562443.1|  PREDICTED: probable inactive receptor kinase...    254   1e-75    
ref|XP_012086772.1|  PREDICTED: probable inactive receptor kinase...    254   1e-75    
ref|XP_002513601.1|  ATP binding protein, putative                      254   1e-75    
ref|XP_007137558.1|  hypothetical protein PHAVU_009G136800g             254   1e-75    
ref|XP_003565740.1|  PREDICTED: probable inactive receptor kinase...    254   1e-75    
ref|XP_004143879.1|  PREDICTED: probable inactive receptor kinase...    253   1e-75    
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                   253   1e-75    
ref|XP_002317741.1|  hypothetical protein POPTR_0012s01230g             254   1e-75    
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg             253   1e-75    
ref|XP_008437363.1|  PREDICTED: probable inactive receptor kinase...    253   1e-75    
ref|NP_001060650.1|  Os07g0681100                                       253   2e-75    
ref|XP_009103556.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    253   3e-75    
ref|XP_006829650.1|  PREDICTED: probable inactive receptor kinase...    253   3e-75    
emb|CDY04464.1|  BnaA07g12900D                                          253   3e-75    
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...    253   3e-75    
ref|XP_002879005.1|  hypothetical protein ARALYDRAFT_481544             253   3e-75    
ref|XP_006600766.1|  PREDICTED: probable inactive receptor kinase...    253   3e-75    
ref|XP_010097875.1|  putative inactive receptor kinase                  253   4e-75    
gb|KEH21182.1|  LRR receptor-like kinase                                253   4e-75    
dbj|BAJ94608.1|  predicted protein                                      252   5e-75    
gb|ACR38562.1|  unknown                                                 243   5e-75    
gb|EAZ05160.1|  hypothetical protein OsI_27356                          252   7e-75    
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...    251   7e-75    
gb|EYU23030.1|  hypothetical protein MIMGU_mgv1a002522mg                252   8e-75    
ref|XP_006397367.1|  hypothetical protein EUTSA_v10022498mg             252   8e-75    
dbj|BAA94519.1|  putative receptor-like kinase                          252   8e-75    
ref|XP_009140749.1|  PREDICTED: probable inactive receptor kinase...    252   9e-75    
gb|AAK92807.1|  putative receptor protein kinase                        252   9e-75    
ref|NP_180241.1|  leucine-rich repeat protein kinase family protein     252   1e-74    
gb|KHN23405.1|  Putative inactive receptor kinase                       251   1e-74    
gb|EPS63924.1|  hypothetical protein M569_10855                         251   1e-74    
emb|CDY48185.1|  BnaA04g15490D                                          251   1e-74    
ref|XP_004502606.1|  PREDICTED: probable inactive receptor kinase...    250   2e-74    
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...    251   2e-74    
ref|XP_004508557.1|  PREDICTED: probable inactive receptor kinase...    251   2e-74    
ref|XP_009614171.1|  PREDICTED: probable inactive receptor kinase...    251   2e-74    
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...    251   2e-74    
emb|CDP12117.1|  unnamed protein product                                251   2e-74    
ref|XP_004502605.1|  PREDICTED: probable inactive receptor kinase...    250   2e-74    
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...    250   2e-74    
ref|XP_004503646.1|  PREDICTED: probable inactive receptor kinase...    251   2e-74    
ref|XP_011001931.1|  PREDICTED: probable inactive receptor kinase...    250   2e-74    
ref|XP_012090129.1|  PREDICTED: probable inactive receptor kinase...    250   3e-74    
emb|CDX98821.1|  BnaC09g50140D                                          250   3e-74    
ref|XP_011001936.1|  PREDICTED: probable inactive receptor kinase...    250   3e-74    
ref|XP_009122125.1|  PREDICTED: probable leucine-rich repeat rece...    250   4e-74    
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                   249   5e-74    
ref|XP_006645650.1|  PREDICTED: probable inactive receptor kinase...    250   5e-74    
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...    250   5e-74    
ref|XP_009597502.1|  PREDICTED: probable inactive receptor kinase...    250   5e-74    
ref|XP_004308019.1|  PREDICTED: probable inactive receptor kinase...    251   5e-74    
ref|XP_008380496.1|  PREDICTED: probable inactive receptor kinase...    249   5e-74    
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein     249   7e-74    
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...    249   8e-74    
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...    249   9e-74    
ref|XP_009352112.1|  PREDICTED: probable inactive receptor kinase...    249   9e-74    
ref|XP_008234792.1|  PREDICTED: probable inactive receptor kinase...    249   1e-73    
ref|XP_003526687.1|  PREDICTED: probable inactive receptor kinase...    248   1e-73    
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...    249   1e-73    
ref|XP_006398978.1|  hypothetical protein EUTSA_v10012946mg             248   1e-73    
gb|ACN30771.1|  unknown                                                 248   1e-73    
ref|XP_010925124.1|  PREDICTED: probable inactive receptor kinase...    248   2e-73    
ref|XP_008376682.1|  PREDICTED: probable inactive receptor kinase...    248   2e-73    
emb|CDP03386.1|  unnamed protein product                                249   2e-73    
ref|XP_009395807.1|  PREDICTED: probable inactive receptor kinase...    248   2e-73    
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...    247   3e-73    
ref|XP_009375580.1|  PREDICTED: probable inactive receptor kinase...    248   3e-73    
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg             248   3e-73    
ref|NP_001168844.1|  uncharacterized LOC100382649 precursor             248   3e-73    
gb|KJB52632.1|  hypothetical protein B456_008G271600                    248   3e-73    
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...    247   3e-73    
ref|XP_007220432.1|  hypothetical protein PRUPE_ppa002831mg             247   3e-73    
gb|KHG27491.1|  hypothetical protein F383_14041                         247   6e-73    
ref|XP_010671535.1|  PREDICTED: probable inactive receptor kinase...    246   6e-73    
ref|XP_011084477.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    246   6e-73    
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223             247   7e-73    
emb|CDY47625.1|  BnaA01g13400D                                          247   7e-73    
gb|KFK24939.1|  hypothetical protein AALP_AA8G045400                    246   7e-73    
ref|XP_004490516.1|  PREDICTED: probable inactive receptor kinase...    246   7e-73    
ref|XP_009767272.1|  PREDICTED: probable inactive receptor kinase...    247   8e-73    
ref|NP_196135.1|  putative leucine-rich repeat receptor-like prot...    246   8e-73    
ref|XP_010268752.1|  PREDICTED: probable inactive receptor kinase...    247   9e-73    
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...    246   9e-73    
ref|XP_010104998.1|  putative inactive receptor kinase                  246   1e-72    
ref|XP_009362808.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    244   1e-72    
ref|XP_006293818.1|  hypothetical protein CARUB_v10022800mg             246   1e-72    
gb|KJB27114.1|  hypothetical protein B456_004G278900                    246   1e-72    
ref|XP_003522551.1|  PREDICTED: probable inactive receptor kinase...    246   1e-72    
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...    246   1e-72    
gb|ACR34746.1|  unknown                                                 241   2e-72    
ref|XP_002871141.1|  hypothetical protein ARALYDRAFT_325150             246   2e-72    
gb|KHN44239.1|  Putative inactive receptor kinase                       245   2e-72    
gb|AAN05336.1|  Putative leucine-rich repeat transmembrane protei...    246   2e-72    
ref|XP_003602176.1|  Leucine-rich repeat receptor-like protein ki...    251   2e-72    
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...    245   2e-72    
gb|KFK32479.1|  hypothetical protein AALP_AA6G247800                    246   2e-72    
ref|XP_009796898.1|  PREDICTED: probable inactive receptor kinase...    245   2e-72    
emb|CDX94213.1|  BnaC07g38470D                                          245   2e-72    
gb|EEE59802.1|  hypothetical protein OsJ_12326                          238   2e-72    
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...    245   2e-72    
ref|NP_001049422.1|  Os03g0223000                                       247   2e-72    
ref|XP_004958707.1|  PREDICTED: probable inactive receptor kinase...    245   3e-72    
ref|XP_007141021.1|  hypothetical protein PHAVU_008G160700g             244   3e-72    
ref|XP_010491047.1|  PREDICTED: probable leucine-rich repeat rece...    245   4e-72    
gb|ACC91242.1|  leucine-rich repeat transmembrane protein kinase        244   4e-72    
gb|ACU19868.1|  unknown                                                 234   4e-72    
ref|XP_011080874.1|  PREDICTED: probable inactive receptor kinase...    244   4e-72    
tpg|DAA57078.1|  TPA: putative leucine-rich repeat receptor-like ...    244   5e-72    
gb|AES72427.2|  LRR receptor-like kinase                                244   6e-72    
ref|XP_010423497.1|  PREDICTED: probable leucine-rich repeat rece...    244   8e-72    
ref|XP_006289209.1|  hypothetical protein CARUB_v10002657mg             244   8e-72    
ref|XP_010271320.1|  PREDICTED: probable inactive receptor kinase...    244   1e-71    
ref|XP_007040424.1|  Leucine-rich repeat protein kinase family pr...    243   1e-71    
ref|XP_008388374.1|  PREDICTED: probable inactive receptor kinase...    243   1e-71    
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...    243   1e-71    
ref|XP_010452417.1|  PREDICTED: probable leucine-rich repeat rece...    243   1e-71    
ref|XP_008463343.1|  PREDICTED: probable inactive receptor kinase...    244   1e-71    
ref|XP_004245544.1|  PREDICTED: probable inactive receptor kinase...    243   2e-71    
ref|XP_010916177.1|  PREDICTED: probable inactive receptor kinase...    243   2e-71    
ref|XP_004149854.1|  PREDICTED: probable inactive receptor kinase...    243   2e-71    
gb|KHN00038.1|  Putative inactive receptor kinase                       231   2e-71    
ref|XP_010433865.1|  PREDICTED: probable inactive receptor kinase...    243   2e-71    
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...    243   2e-71    
ref|XP_009413825.1|  PREDICTED: probable inactive receptor kinase...    243   2e-71    
gb|KJB19053.1|  hypothetical protein B456_003G082600                    242   2e-71    
ref|XP_006283316.1|  hypothetical protein CARUB_v10004355mg             241   3e-71    
ref|XP_009628885.1|  PREDICTED: probable inactive receptor kinase...    242   3e-71    
ref|XP_010448663.1|  PREDICTED: probable inactive receptor kinase...    242   3e-71    
ref|XP_006343895.1|  PREDICTED: probable inactive receptor kinase...    242   4e-71    
ref|XP_009629119.1|  PREDICTED: probable inactive receptor kinase...    242   4e-71    
emb|CDP05105.1|  unnamed protein product                                242   4e-71    
gb|KEH40435.1|  LRR receptor-like kinase                                241   4e-71    
ref|XP_009782917.1|  PREDICTED: probable inactive receptor kinase...    242   4e-71    
ref|XP_011073578.1|  PREDICTED: probable inactive receptor kinase...    241   5e-71    
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg             241   6e-71    
gb|KHG17719.1|  hypothetical protein F383_03334                         241   6e-71    
ref|NP_001152341.1|  LOC100285980 precursor                             242   6e-71    
gb|AFW89165.1|  putative leucine-rich repeat receptor-like protei...    242   7e-71    
ref|XP_008813619.1|  PREDICTED: probable inactive receptor kinase...    236   7e-71    
gb|AET05610.2|  LRR receptor-like kinase                                242   7e-71    
ref|XP_008775508.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    242   7e-71    
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g             241   7e-71    
ref|XP_009393622.1|  PREDICTED: probable inactive receptor kinase...    241   8e-71    
gb|KHN09234.1|  Putative inactive receptor kinase                       234   9e-71    
ref|XP_008660393.1|  PREDICTED: probable inactive receptor kinase...    241   1e-70    
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...    240   1e-70    
ref|XP_006651742.1|  PREDICTED: probable inactive receptor kinase...    240   1e-70    
ref|XP_010688116.1|  PREDICTED: probable inactive receptor kinase...    241   1e-70    
ref|XP_006350601.1|  PREDICTED: probable inactive receptor kinase...    240   1e-70    
ref|XP_004985160.1|  PREDICTED: probable inactive receptor kinase...    241   2e-70    
gb|KJB10488.1|  hypothetical protein B456_001G203900                    239   2e-70    
ref|XP_003631134.1|  Atypical receptor-like kinase MARK                 242   2e-70    
ref|XP_001752184.1|  predicted protein                                  241   2e-70    
ref|NP_001168611.1|  uncharacterized LOC100382395 precursor             240   2e-70    
gb|KHN10529.1|  Putative inactive receptor kinase                       237   2e-70    
ref|XP_002972265.1|  hypothetical protein SELMODRAFT_267563             239   2e-70    
gb|KHN00136.1|  Putative inactive receptor kinase                       239   2e-70    
ref|XP_009799943.1|  PREDICTED: probable inactive receptor kinase...    240   2e-70    
gb|EMT33198.1|  hypothetical protein F775_43654                         233   2e-70    
gb|KHG20593.1|  putative inactive receptor kinase -like protein         239   2e-70    
ref|XP_002531014.1|  ATP binding protein, putative                      240   3e-70    
ref|XP_006422104.1|  hypothetical protein CICLE_v10004549mg             239   3e-70    
ref|XP_010916205.1|  PREDICTED: probable inactive receptor kinase...    240   3e-70    
ref|XP_002984179.1|  hypothetical protein SELMODRAFT_156455             239   3e-70    
ref|XP_008381374.1|  PREDICTED: probable inactive receptor kinase...    228   4e-70    
ref|XP_003530966.1|  PREDICTED: probable inactive receptor kinase...    239   4e-70    
ref|XP_003558467.1|  PREDICTED: probable inactive receptor kinase...    240   4e-70    
ref|XP_004250172.1|  PREDICTED: probable inactive receptor kinase...    239   5e-70    
ref|XP_010055829.1|  PREDICTED: probable inactive receptor kinase...    239   5e-70    
ref|XP_006364614.1|  PREDICTED: probable inactive receptor kinase...    239   5e-70    
gb|AGL74765.1|  ovary receptor kinase 11                                239   5e-70    
ref|XP_009357339.1|  PREDICTED: probable inactive receptor kinase...    239   5e-70    
emb|CBI33513.3|  unnamed protein product                                239   5e-70    
ref|XP_009368693.1|  PREDICTED: probable inactive receptor kinase...    239   5e-70    
gb|AGO98727.1|  ovary receptor kinase 11                                239   6e-70    
gb|KHN43642.1|  Putative inactive receptor kinase                       234   7e-70    
ref|XP_002276147.1|  PREDICTED: probable inactive receptor kinase...    238   9e-70    
ref|XP_010035197.1|  PREDICTED: probable inactive receptor kinase...    238   9e-70    
ref|XP_002991819.1|  hypothetical protein SELMODRAFT_42017              238   1e-69    
ref|XP_002468249.1|  hypothetical protein SORBIDRAFT_01g042480          239   1e-69    
gb|KHN45250.1|  Putative inactive receptor kinase                       234   1e-69    
ref|XP_004137511.1|  PREDICTED: probable inactive receptor kinase...    238   2e-69    
ref|XP_009592532.1|  PREDICTED: probable inactive receptor kinase...    238   2e-69    
ref|XP_008466324.1|  PREDICTED: probable inactive receptor kinase...    238   2e-69    
ref|XP_002992978.1|  hypothetical protein SELMODRAFT_270002             237   2e-69    
ref|XP_009797253.1|  PREDICTED: probable inactive receptor kinase...    237   3e-69    
ref|XP_007160555.1|  hypothetical protein PHAVU_002G331400g             237   3e-69    
emb|CAN82203.1|  hypothetical protein VITISV_018964                     237   4e-69    
gb|AAK18840.1|AC082645_10  putative receptor kinase                     238   4e-69    
ref|XP_007036910.1|  Receptor-like kinase 1                             236   6e-69    
ref|XP_011083189.1|  PREDICTED: probable inactive receptor kinase...    236   6e-69    
ref|XP_001778285.1|  predicted protein                                  236   7e-69    
ref|XP_003525182.1|  PREDICTED: probable inactive receptor kinase...    236   9e-69    
ref|XP_004503256.1|  PREDICTED: probable inactive receptor kinase...    238   1e-68    
ref|XP_010059849.1|  PREDICTED: probable inactive receptor kinase...    236   1e-68    
ref|XP_010676354.1|  PREDICTED: probable inactive receptor kinase...    234   2e-68    
ref|XP_009759771.1|  PREDICTED: probable inactive receptor kinase...    236   2e-68    
ref|XP_006372561.1|  hypothetical protein POPTR_0017s02820g             233   2e-68    
ref|XP_010049947.1|  PREDICTED: probable inactive receptor kinase...    235   2e-68    



>ref|XP_007207849.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
 gb|EMJ09048.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
Length=623

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 194/224 (87%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+++ GS SAL+HGNRE+ +   DW TRLKI+ G A+G+AHIHS  G + 
Sbjct  392  YSKDEKLLVYDYISAGSFSALLHGNRETGQNPPDWETRLKISLGCAKGLAHIHSASGGKF  451

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLTQDLNG ISDFGL PLM F TIP RS GYRAPEVIET+KS QKSDVYS
Sbjct  452  THGNIKSSNVLLTQDLNGSISDFGLAPLMNFATIPSRSVGYRAPEVIETKKSFQKSDVYS  511

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+E+VQ
Sbjct  512  FGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEELVQ  570

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV +VP+MRP M+EVVRMIEEIR PD DNRPSSEDN+
Sbjct  571  MLQIAMACVARVPDMRPTMEEVVRMIEEIRPPDSDNRPSSEDNR  614



>emb|CDP04037.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+ +  SLSAL+HGNR S R  LDW TR+KI+ GAARG+AHIHSV G + 
Sbjct  21   YSKDEKLLVYDYFSNSSLSALLHGNRSSGRAPLDWETRVKISLGAARGIAHIHSVGGPKF  80

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGN+KSSNVLL QDL+GC+SD GL PLM F     R AGYRAPEV+ETRK T KSDVYS
Sbjct  81   THGNVKSSNVLLNQDLDGCVSDLGLAPLMNFPATRSRQAGYRAPEVMETRKHTHKSDVYS  140

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK P+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  141  FGVLLLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  199

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP MDEVVRMIEE+RQ D +NRPSSE+NK
Sbjct  200  MLQIAMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENK  243



>ref|XP_008244615.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Prunus mume]
Length=554

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 192/224 (86%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+++ GS SAL+HGNRE+ +   DW TRLKI+ G A+G+AHIHS  G + 
Sbjct  323  YSKDEKLLVYDYISAGSFSALLHGNRETGQNPPDWETRLKISLGCAKGLAHIHSASGGKF  382

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN LLTQDLNG ISDFGL PLM F TIP RS GYRAPEVIET+KS QKSDVYS
Sbjct  383  IHGNIKSSNALLTQDLNGSISDFGLAPLMNFATIPSRSVGYRAPEVIETKKSFQKSDVYS  442

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+E+VQ
Sbjct  443  FGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEELVQ  501

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV +VP+MRP M+EVVRMIEEIR PD DNRPSSEDN+
Sbjct  502  MLQIAMACVARVPDMRPTMEEVVRMIEEIRPPDSDNRPSSEDNR  545



>gb|KHN40997.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   320 bits (820),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  G+LS L+HGNR S R  LDWN+R+KI+ G ARG+AHIHSV G + 
Sbjct  21   YSKDEKLLVYDYIPSGNLSTLLHGNRASGRTPLDWNSRIKISVGIARGIAHIHSVGGPKF  80

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGN+KSSNVLL  D +GCISDFGLTPLM     P R+AGYRAPEVIETRK T KSDVYS
Sbjct  81   THGNVKSSNVLLNHDNDGCISDFGLTPLMNVPATPSRAAGYRAPEVIETRKHTHKSDVYS  140

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             G+LLLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  141  FGILLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  199

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP MDEVVRMIEEIR  D +NRPSSE+N+
Sbjct  200  MLQIAMACVAKVPDMRPSMDEVVRMIEEIRLSDSENRPSSEENR  243



>ref|XP_010252005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252007.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252008.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252009.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252010.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=676

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 192/224 (86%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++T GSLS L+HGNR + R  LDWN+R+KI+ G ARG+AHIH+  G + 
Sbjct  445  YSKDEKLLVYDYITAGSLSTLLHGNRGTGRTPLDWNSRIKISLGTARGIAHIHAEGGGKF  504

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL PLM F   P RS GYRAPEVIETRK TQKSDVYS
Sbjct  505  THGNIKSSNVLLNQDQDGCISDFGLVPLMNFPVTPSRSVGYRAPEVIETRKPTQKSDVYS  564

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP+QS   ++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  565  FGVLLLELLTGKAPLQSPGHDDVVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  623

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRPKM+EVVRMIEEIRQ D +NRPSSE+NK
Sbjct  624  MLQIAMACVAKVPDMRPKMEEVVRMIEEIRQSDSENRPSSEENK  667



>gb|KHN30614.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   319 bits (818),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  G+LS L+HGNR S R  LDWN+R+KI+ G ARG+AHIHSV G + 
Sbjct  21   YSKDEKLLVYDYIPSGNLSTLLHGNRASGRTPLDWNSRIKISVGIARGIAHIHSVGGPKF  80

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGN+KSSNVLL QD +GCISDFGLTPLM   + P R+AGYRAPEVIETRK T KSDVYS
Sbjct  81   AHGNVKSSNVLLNQDNDGCISDFGLTPLMNVPSTPSRAAGYRAPEVIETRKHTHKSDVYS  140

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  141  FGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  199

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M+EVVRMIEEIR  D +NRPSSE+N+
Sbjct  200  MLQIAMACVAKVPDMRPSMEEVVRMIEEIRLSDSENRPSSEENR  243



>ref|XP_008244579.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244587.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244595.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244604.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244609.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
Length=633

 Score =   330 bits (847),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 192/224 (86%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+++ GS SAL+HGNRE+ +   DW TRLKI+ G A+G+AHIHS  G + 
Sbjct  402  YSKDEKLLVYDYISAGSFSALLHGNRETGQNPPDWETRLKISLGCAKGLAHIHSASGGKF  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN LLTQDLNG ISDFGL PLM F TIP RS GYRAPEVIET+KS QKSDVYS
Sbjct  462  IHGNIKSSNALLTQDLNGSISDFGLAPLMNFATIPSRSVGYRAPEVIETKKSFQKSDVYS  521

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+E+VQ
Sbjct  522  FGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEELVQ  580

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV +VP+MRP M+EVVRMIEEIR PD DNRPSSEDN+
Sbjct  581  MLQIAMACVARVPDMRPTMEEVVRMIEEIRPPDSDNRPSSEDNR  624



>ref|XP_012077868.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012077874.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012077878.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012077884.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012077889.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 gb|KDP45679.1| hypothetical protein JCGZ_17286 [Jatropha curcas]
Length=634

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 193/224 (86%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLSAL+HGNR++ R  LDW+TR+KIA G A+G+AH+HS  G + 
Sbjct  403  YSKDEKLLVYDYIQGGSLSALLHGNRQAGRTPLDWDTRVKIALGTAKGIAHLHSAGGPKF  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL Q+ +GCISDFGLTPLM     P RSAGYRAPEVIETRK T KSDVYS
Sbjct  463  THGNIKSSNVLLNQEHDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHTHKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS A++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  523  FGVLLLEMLTGKAPLQSPARDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ MACV KVP+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  582  MLQIGMACVAKVPDMRPNMDEVVRMIEEIRQSDSENRPSSEENK  625



>ref|XP_009370892.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009370912.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=639

 Score =   328 bits (841),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMAL-DWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GS SAL+HGNRES   L DW TRLKI+ G A+G+AHIHS  G + 
Sbjct  399  YSKDEKLLVYDYIPAGSFSALLHGNRESGQHLPDWETRLKISLGCAKGLAHIHSASGGKF  458

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLLTQDLNG +SDFGL PLM  TTIP RS GYRAPEVIET+KS QKSDVYS
Sbjct  459  IHGNIKSSNVLLTQDLNGSMSDFGLAPLMNLTTIPSRSVGYRAPEVIETKKSFQKSDVYS  518

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAPVQ+   ++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+E+VQ
Sbjct  519  FGVMLLEMLTGKAPVQTPGHDDVVDLPRWVQSVVREEWTAEVFDVELMKY-QNIEEELVQ  577

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AM CV +VP+MRP M+EVVRMIEEIR PD +NRPSS+DNK
Sbjct  578  MLQIAMTCVARVPDMRPTMEEVVRMIEEIRPPDSENRPSSDDNK  621



>emb|CBI15804.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   328 bits (841),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 191/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V+ GSLSAL+HGNR + R  LDWN R+KI+ G ARG+ HIHSV G + 
Sbjct  425  YSKDEKLLVYDYVSGGSLSALLHGNRPTGRSPLDWNARVKISLGIARGITHIHSVGGGKF  484

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD  GCISDFGLTPLM F     R+AGYRAPEVIE+RK T KSDVYS
Sbjct  485  THGNIKSSNVLLNQDFEGCISDFGLTPLMNFPATSSRNAGYRAPEVIESRKHTHKSDVYS  544

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  545  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDIELMRY-QNIEEEMVQ  603

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  604  MLQLAMACVAKVPDMRPSMDEVVRMIEEIRQSDSENRPSSEENK  647



>ref|XP_002533837.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF28551.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=635

 Score =   327 bits (839),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 191/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLS L+HGNR++ R  LDW+ R+KIA G ARG+AH+HS  G + 
Sbjct  404  YSKDEKLLVYDYIQGGSLSTLLHGNRQAGRTPLDWDNRVKIALGTARGIAHLHSAGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGLTPLM     P RSAGYRAPEVIETRK T KSDVYS
Sbjct  464  THGNIKSSNVLLNQDHDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHTHKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS +++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  524  FGVLLLEMLTGKAPLQSPSRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ MACV KVP+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  583  MLQIGMACVAKVPDMRPNMDEVVRMIEEIRQSDSENRPSSEENK  626



>ref|XP_002276162.3| PREDICTED: probable inactive receptor kinase At5g58300 [Vitis 
vinifera]
Length=666

 Score =   328 bits (841),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 191/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V+ GSLSAL+HGNR + R  LDWN R+KI+ G ARG+ HIHSV G + 
Sbjct  435  YSKDEKLLVYDYVSGGSLSALLHGNRPTGRSPLDWNARVKISLGIARGITHIHSVGGGKF  494

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD  GCISDFGLTPLM F     R+AGYRAPEVIE+RK T KSDVYS
Sbjct  495  THGNIKSSNVLLNQDFEGCISDFGLTPLMNFPATSSRNAGYRAPEVIESRKHTHKSDVYS  554

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  555  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDIELMRY-QNIEEEMVQ  613

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  614  MLQLAMACVAKVPDMRPSMDEVVRMIEEIRQSDSENRPSSEENK  657



>ref|XP_009590190.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009590191.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=645

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 188/223 (84%), Gaps = 1/223 (0%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            +SKDEKLL+YD V  GSLS  MHGNRE    LDW +RL+IA GAA G+AHIHSV G +L 
Sbjct  415  FSKDEKLLIYDHVPGGSLSTRMHGNRELGRTLDWESRLRIAHGAASGIAHIHSVAGGKLI  474

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYSl  479
            HGNI+SSNVLLT D +GCISD GLTPLMG  TIP RSAGYRAPEVIETRK TQKSDVYS 
Sbjct  475  HGNIRSSNVLLTHDNSGCISDVGLTPLMGSPTIPSRSAGYRAPEVIETRKCTQKSDVYSF  534

Query  478  gvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQL  299
            GVLLLELLTGKAPVQ    +EVVDLP+WVQSVVREEWTAEVFDAELI + Q+++DEMVQ+
Sbjct  535  GVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDAELIKF-QNIQDEMVQM  593

Query  298  LQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            LQ+AMACV KVPE RP M++VV+MIE+I+Q D  NRPSSEDNK
Sbjct  594  LQIAMACVAKVPETRPDMNQVVQMIEDIQQSDSGNRPSSEDNK  636



>ref|XP_009772876.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=648

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 187/223 (84%), Gaps = 1/223 (0%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            +SKDEKLL+YD V  GSLS  MHGNRE    LDW +RL+IA GAA G+AHIHSV G +L 
Sbjct  418  FSKDEKLLIYDHVPAGSLSTRMHGNRELGRTLDWESRLRIAHGAASGIAHIHSVTGGKLI  477

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYSl  479
            HGNI+SSNVLLT D +GCISD GLTPLMG  TIP RSAGYRAPEVIETRK TQKSDVYS 
Sbjct  478  HGNIRSSNVLLTHDNSGCISDVGLTPLMGSPTIPSRSAGYRAPEVIETRKCTQKSDVYSF  537

Query  478  gvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQL  299
            GVLLLELLTGKAPVQ    +EVVDLP+WVQSVVREEWTAEVFDAELI + Q++EDEMVQ+
Sbjct  538  GVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDAELIKF-QNIEDEMVQM  596

Query  298  LQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            LQ+AM CV KVPE RP M++VV+MIE+I+Q D  NRPSSEDNK
Sbjct  597  LQIAMTCVAKVPETRPDMNQVVQMIEDIQQSDSGNRPSSEDNK  639



>ref|XP_004246956.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=633

 Score =   325 bits (834),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 186/223 (83%), Gaps = 1/223 (0%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            +SKDEKLLVYD V  GSLS  MHGNR+    LDW +RL+IA GAA G+AHIH+V G +L 
Sbjct  403  FSKDEKLLVYDHVPEGSLSTRMHGNRDLGRTLDWESRLRIAHGAASGIAHIHAVSGGKLI  462

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYSl  479
            HGNIKSSNVLLTQD +GCISD GLTPLMGF TIP RSAGYRAPEVIET+K TQKSDVYS 
Sbjct  463  HGNIKSSNVLLTQDNSGCISDVGLTPLMGFPTIPSRSAGYRAPEVIETKKCTQKSDVYSF  522

Query  478  gvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQL  299
            GVLLLELLTGKAPVQ    +EVVDLP+WVQSVVREEWTAEVFD ELI + Q+ EDEMVQ+
Sbjct  523  GVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDTELIKF-QNNEDEMVQM  581

Query  298  LQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            LQ+AMACV  VPE RP M ++V+MIE+I+Q D  NRPSSEDNK
Sbjct  582  LQIAMACVANVPETRPGMSQIVQMIEDIQQIDSGNRPSSEDNK  624



>ref|XP_010098027.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB74410.1| putative inactive receptor kinase [Morus notabilis]
Length=711

 Score =   328 bits (840),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++T GS SAL+HGNRES R   DW +RLKI+ G ARG+AHIHS  G + 
Sbjct  480  YSKDEKLLVYDYITAGSFSALLHGNRESGRSPPDWESRLKISLGCARGIAHIHSAAGGKF  539

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLL+QDL+GCISDFGL PLM F  IP RS GYRAPEVIETRK +QKSDVYS
Sbjct  540  VHGNIKSSNVLLSQDLSGCISDFGLAPLMNFPAIPSRSIGYRAPEVIETRKFSQKSDVYS  599

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAPVQS  +++V DLP+WVQSVVREEWTAEVFD EL+ Y Q++E+E+VQ
Sbjct  600  FGVILLEMLTGKAPVQSPGRDDVADLPRWVQSVVREEWTAEVFDVELMKY-QNIEEELVQ  658

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M+EVVRMIEEIR  D ++RPS EDNK
Sbjct  659  MLQIAMACVAKVPDMRPTMEEVVRMIEEIRPSDSESRPSPEDNK  702



>ref|XP_008355739.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=639

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMAL-DWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GS SAL+HGNRES   L DW TRLKI+ G A+G+AHIHS  G + 
Sbjct  399  YSKDEKLLVYDYIPSGSFSALLHGNRESGQHLPDWETRLKISLGCAKGLAHIHSASGGKF  458

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLLTQDL G ISDFGL  LM  TTIP RS GYRAPEVIET+KS QKSDVYS
Sbjct  459  IHGNIKSSNVLLTQDLYGSISDFGLALLMNLTTIPSRSVGYRAPEVIETKKSFQKSDVYS  518

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAPVQS+ +++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+E+VQ
Sbjct  519  FGVMLLEMLTGKAPVQSSGRDDVVDLPRWVQSVVREEWTAEVFDVELMKY-QNIEEELVQ  577

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AM CV +VP+MRP M+EVVRMIEEIR PD +NRPSS+DNK
Sbjct  578  MLQIAMTCVARVPDMRPTMEEVVRMIEEIRPPDSENRPSSDDNK  621



>ref|XP_010244554.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244555.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244556.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244557.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244558.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=642

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 190/225 (84%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES--RMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKLLVYD++  G+L  LMHGNR S  R  LDW +R+KI+ GAARG+AHIHS  G +
Sbjct  410  YSKDEKLLVYDYIPAGNLLTLMHGNRGSGGRSPLDWGSRVKISLGAARGIAHIHSEGGGK  469

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
              HGNIKSSNVLLTQD +GCISDFGL  LM F  IP RS GYRAPEVIETRK TQKSDVY
Sbjct  470  FIHGNIKSSNVLLTQDQDGCISDFGLASLMNFPVIPSRSVGYRAPEVIETRKPTQKSDVY  529

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLELLTGKAP+QS   ++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMV
Sbjct  530  SFGVLLLELLTGKAPLQSPGHDDVVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMV  588

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQ+AMACV KVP++RPKM+EVVRMIEEIRQ D +NRPSSE+NK
Sbjct  589  QMLQIAMACVAKVPDVRPKMEEVVRMIEEIRQSDSENRPSSEENK  633



>ref|XP_009374410.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=634

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 195/224 (87%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+++ GSLSAL+HGNR   R ALDW++R+KI+ G ARG+AHIHSV G + 
Sbjct  404  YSKDEKLLVYDYISNGSLSALLHGNRGGGRTALDWDSRVKISLGTARGIAHIHSVGGLKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVLL+QDLNGCISD GLTPLM  +    RSAGYRAPEVIETR+ + KSDVYS
Sbjct  464  THGNIKSTNVLLSQDLNGCISDVGLTPLMNVSATA-RSAGYRAPEVIETRRHSHKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  523  FGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D +NRPSSE+NK
Sbjct  582  MLQIAMACVAKVPDMRPSMEEVVRMIEEIRQSDSENRPSSEENK  625



>gb|KHN24722.1| Putative inactive receptor kinase, partial [Glycine soja]
Length=327

 Score =   313 bits (803),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+L  L+HG R   R  LDW++R+KI+ G A+G+AHIHSV G + 
Sbjct  96   YSKDEKLLVYDYVPGGNLHTLLHGGRTGGRTPLDWDSRIKISLGTAKGLAHIHSVGGPKF  155

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEVIETRK + KSDVYS
Sbjct  156  THGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRAAGYRAPEVIETRKHSHKSDVYS  215

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  216  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  274

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDE VRMIEEIRQ D +NRPSSE+NK
Sbjct  275  MLQIAMACVAKMPDMRPSMDEAVRMIEEIRQSDSENRPSSEENK  318



>ref|XP_006356869.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356870.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=653

 Score =   323 bits (828),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 185/223 (83%), Gaps = 1/223 (0%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            +SKDEKLLVYD V  GSLS  MHGN++    LDW +RL+IA GAA G+AHIH+V G +L 
Sbjct  423  FSKDEKLLVYDHVPAGSLSTRMHGNKDLGRTLDWESRLRIAHGAASGIAHIHAVSGGKLI  482

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYSl  479
            HGNIKSSNVLLT D NGCISD GLTPLMGF TIP +SAGYRAPEVIET+K TQKSDVYS 
Sbjct  483  HGNIKSSNVLLTHDNNGCISDVGLTPLMGFPTIPSKSAGYRAPEVIETKKCTQKSDVYSF  542

Query  478  gvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQL  299
            GVLLLELLTGKAPVQ    +EVVDLP+WVQSVVREEWTAEVFD ELI + Q++EDEMVQ+
Sbjct  543  GVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDVELIKF-QNIEDEMVQM  601

Query  298  LQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            LQ+AM CV  VPE RP M +VV+MIE+I+Q D  NRPSSEDNK
Sbjct  602  LQIAMTCVANVPETRPDMSQVVQMIEDIQQIDSGNRPSSEDNK  644



>ref|XP_003519295.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006575457.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006575458.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=654

 Score =   323 bits (827),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  G+LS L+HGNR S R  LDWN+R+KI+ G ARG+AHIHSV G + 
Sbjct  422  YSKDEKLLVYDYIPSGNLSTLLHGNRASGRTPLDWNSRIKISVGIARGIAHIHSVGGPKF  481

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGN+KSSNVLL  D +GCISDFGLTPLM     P R+AGYRAPEVIETRK T KSDVYS
Sbjct  482  THGNVKSSNVLLNHDNDGCISDFGLTPLMNVPATPSRAAGYRAPEVIETRKHTHKSDVYS  541

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             G+LLLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  542  FGILLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  600

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP MDEVVRMIEEIR  D +NRPSSE+N+
Sbjct  601  MLQIAMACVAKVPDMRPSMDEVVRMIEEIRLSDSENRPSSEENR  644



>ref|XP_010094441.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB56022.1| putative inactive receptor kinase [Morus notabilis]
Length=634

 Score =   322 bits (826),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+  RGSLSAL+HGNR   R  LDW TR+KIA G A+G+AHIHS+ G + 
Sbjct  403  YSKDEKLLVYDYFPRGSLSALLHGNRGGGRTPLDWETRVKIALGTAKGIAHIHSMGGPKF  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGN+K+SNVLL QDL+GCISDFGLTPLM     P RS GYRAPEVIETRK T KSDVYS
Sbjct  463  THGNVKASNVLLNQDLDGCISDFGLTPLMNAHATPSRSVGYRAPEVIETRKYTHKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WV SVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  523  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVHSVVREEWTAEVFDIELMRY-QNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M++VVRMIEEIRQ D +NRPSSE+NK
Sbjct  582  MLQIAMACVTKVPDMRPSMEQVVRMIEEIRQSDSENRPSSEENK  625



>ref|XP_007208318.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
 gb|EMJ09517.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
Length=634

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 194/224 (87%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+++ GSLSAL+HGNR   R ALDW++R+KIA G ARG+AHIHS+ G + 
Sbjct  404  YSKDEKLLVYDYISNGSLSALLHGNRGGGRTALDWDSRIKIALGTARGIAHIHSMGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVLL+QDL+GCISD GLTPLM       RSAGYRAPEVIETRK + KSDVYS
Sbjct  464  THGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATT-RSAGYRAPEVIETRKHSHKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  523  FGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D +NRPSSE+NK
Sbjct  582  MLQIAMACVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENK  625



>gb|KDO54914.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
 gb|KDO54915.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=635

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GSLS L+HGNR + R  LDW TR+KI  G ARGVAHIHS+ G + 
Sbjct  404  YSKDEKLLVYDYFASGSLSTLLHGNRGAGRTPLDWETRVKILLGTARGVAHIHSMGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEVIETRK + KSDVYS
Sbjct  464  THGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHSHKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  524  FGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D +NRPSSE+NK
Sbjct  583  MLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENK  626



>ref|XP_008384658.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=634

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 194/224 (87%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD ++ GSLSAL+HGNR S R ALDW++R+KI+ G ARG+AHIHSV G + 
Sbjct  404  YSKDEKLLVYDCISNGSLSALLHGNRGSGRTALDWDSRVKISLGTARGIAHIHSVGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVLL+QDLNGCISD GLTPLM       RSAGYRAPEVIETR+ + KSDVYS
Sbjct  464  THGNIKSTNVLLSQDLNGCISDVGLTPLMNVPATA-RSAGYRAPEVIETRRHSHKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  523  FGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D +NRPSSE+NK
Sbjct  582  MLQIAMACVAKVPDMRPSMEEVVRMIEEIRQSDSENRPSSEENK  625



>ref|XP_006432052.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464957.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006464958.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR45292.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=635

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GSLS L+HGNR + R  LDW TR+KI  G ARGVAHIHS+ G + 
Sbjct  404  YSKDEKLLVYDYFASGSLSTLLHGNRGAGRTPLDWETRVKILLGTARGVAHIHSMGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEVIETRK + KSDVYS
Sbjct  464  THGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHSHKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  524  FGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D +NRPSSE+NK
Sbjct  583  MLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENK  626



>ref|XP_008239856.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=634

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 194/224 (87%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+++ GSLSAL+HGNR   R ALDW++R+KIA G ARG+AHIHS+ G + 
Sbjct  404  YSKDEKLLVYDYISNGSLSALLHGNRGGGRTALDWDSRIKIALGTARGIAHIHSMGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVLL+QDL+GCISD GLTPLM       RSAGYRAPEVIETRK + KSDVYS
Sbjct  464  THGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATT-RSAGYRAPEVIETRKHSHKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  523  FGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D +NRPSSE+NK
Sbjct  582  MLQIAMACVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENK  625



>gb|KDO54912.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=672

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GSLS L+HGNR + R  LDW TR+KI  G ARGVAHIHS+ G + 
Sbjct  441  YSKDEKLLVYDYFASGSLSTLLHGNRGAGRTPLDWETRVKILLGTARGVAHIHSMGGPKF  500

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEVIETRK + KSDVYS
Sbjct  501  THGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHSHKSDVYS  560

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  561  FGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  619

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D +NRPSSE+NK
Sbjct  620  MLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENK  663



>ref|XP_006432053.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464956.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR45293.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=672

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GSLS L+HGNR + R  LDW TR+KI  G ARGVAHIHS+ G + 
Sbjct  441  YSKDEKLLVYDYFASGSLSTLLHGNRGAGRTPLDWETRVKILLGTARGVAHIHSMGGPKF  500

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEVIETRK + KSDVYS
Sbjct  501  THGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHSHKSDVYS  560

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  561  FGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  619

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D +NRPSSE+NK
Sbjct  620  MLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENK  663



>ref|XP_003544939.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=656

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  G+LS L+HGNR S R  LDWN+R+KI+ G ARG+AHIHSV G + 
Sbjct  424  YSKDEKLLVYDYIPSGNLSTLLHGNRASGRTPLDWNSRIKISVGIARGIAHIHSVGGPKF  483

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGN+KSSNVLL QD +GCISDFGLTPLM   + P R+AGYRAPEVIETRK T KSDVYS
Sbjct  484  AHGNVKSSNVLLNQDNDGCISDFGLTPLMNVPSTPSRAAGYRAPEVIETRKHTHKSDVYS  543

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  544  FGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  602

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M+EVVRMIEEIR  D +NRPSSE+N+
Sbjct  603  MLQIAMACVAKVPDMRPSMEEVVRMIEEIRLSDSENRPSSEENR  646



>gb|KDO54913.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=682

 Score =   322 bits (825),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GSLS L+HGNR + R  LDW TR+KI  G ARGVAHIHS+ G + 
Sbjct  451  YSKDEKLLVYDYFASGSLSTLLHGNRGAGRTPLDWETRVKILLGTARGVAHIHSMGGPKF  510

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEVIETRK + KSDVYS
Sbjct  511  THGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEVIETRKHSHKSDVYS  570

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  571  FGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  629

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D +NRPSSE+NK
Sbjct  630  MLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENK  673



>ref|XP_011041763.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=510

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLS L+H NR + R  LDW++R+KIA G ARG++H+HSV G + 
Sbjct  279  YSKDEKLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSVGGPKF  338

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVLL+QD +GCISDFGLTPLM       RSAGYRAPEVIETRK T KSDVYS
Sbjct  339  THGNIKSTNVLLSQDHDGCISDFGLTPLMNVPATSSRSAGYRAPEVIETRKHTHKSDVYS  398

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  399  FGVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  457

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D +NRPSSE+NK
Sbjct  458  MLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENK  501



>ref|XP_009758202.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=652

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 191/225 (85%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES--RMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKLLVYD+ +RGSLS L+HG+R +  R  LDW +R+KI+ GAARG+AHIHS+ G +
Sbjct  420  YSKDEKLLVYDYFSRGSLSLLLHGSRAASGRTPLDWESRVKISLGAARGIAHIHSMGGPK  479

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
            +THGNIKSSNVLL QD+  C+SDFGL P+M F   P R  GYRAPEVIETRK T KSDVY
Sbjct  480  VTHGNIKSSNVLLNQDMEACVSDFGLAPVMNFPAAPSRHPGYRAPEVIETRKHTHKSDVY  539

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVL+LE+LTGK P+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMV
Sbjct  540  SFGVLMLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMV  598

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQ+AMACVG+VP+MRP MDEVVRMIEE+RQ D DNRPSSE+NK
Sbjct  599  QMLQIAMACVGRVPDMRPTMDEVVRMIEEVRQSDSDNRPSSEENK  643



>ref|XP_004294716.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=630

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 192/224 (86%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+++ GSLSA +HGNR   R  LDW++R+KI+ G ARG+AHIHSV G + 
Sbjct  401  YSKDEKLLVYDYISNGSLSAFLHGNRGGGRTPLDWDSRIKISLGTARGIAHIHSVGGPKF  460

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVLL+QDL+GCISD GLTPLM       RSAGYRAPEVIETRK + KSDVYS
Sbjct  461  THGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATS-RSAGYRAPEVIETRKHSHKSDVYS  519

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  520  FGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  578

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M+EVVRMIE+IRQ D +NRPSSEDNK
Sbjct  579  MLQIAMACVAKVPDMRPNMEEVVRMIEDIRQSDSENRPSSEDNK  622



>ref|XP_007142022.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 ref|XP_007142023.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14016.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14017.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
Length=655

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  G+LS L+HGNR S R  LDWN+R+KI+ G ARG+AHIHSV G + 
Sbjct  423  YSKDEKLLVYDYIPNGNLSTLLHGNRASGRTPLDWNSRIKISVGIARGIAHIHSVGGPKF  482

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGN+KSSNVLL QD +GCISDFGLTPLM     P R+AGYRAPEVIETRK + KSDVYS
Sbjct  483  THGNVKSSNVLLNQDNDGCISDFGLTPLMNVPATPSRAAGYRAPEVIETRKHSHKSDVYS  542

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  543  FGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  601

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP M+EV RMIEEIR  D +NRPSSE+N+
Sbjct  602  MLQIAMACVAKVPDMRPTMEEVARMIEEIRLSDSENRPSSEENR  645



>ref|XP_009592168.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=652

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 190/225 (84%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES--RMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKLLVYD+ +RGSLS L+HG+R +  R  LDW +R+KI+ GAARG+ HIHS+ G +
Sbjct  420  YSKDEKLLVYDYFSRGSLSLLLHGSRAASGRTPLDWESRVKISLGAARGITHIHSMGGPK  479

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
            +THGNIKSSNVLL QD+  C+SDFGL P+M F   P R  GYRAPEVIETRK T KSDVY
Sbjct  480  VTHGNIKSSNVLLNQDMEACVSDFGLAPVMNFPAAPSRHPGYRAPEVIETRKHTHKSDVY  539

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVL+LE+LTGK P+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMV
Sbjct  540  SFGVLMLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMV  598

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQ+AMACVG+VP+MRP MDEVVRMIEE+RQ D DNRPSSE+NK
Sbjct  599  QMLQIAMACVGRVPDMRPTMDEVVRMIEEVRQSDSDNRPSSEENK  643



>ref|XP_004142674.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
sativus]
 ref|XP_011653728.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
sativus]
 gb|KGN54462.1| hypothetical protein Csa_4G334730 [Cucumis sativus]
Length=638

 Score =   318 bits (815),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 186/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GS SAL+ G+RE  R   DW TRLK++ G A+G+AHIHS  G + 
Sbjct  399  YSKDEKLLVYDYAIAGSFSALLRGSREGGRAPPDWETRLKVSLGCAKGLAHIHSASGGKF  458

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LLTQDLNGCISDFGLTPLM    IP RS GYRAPEVIETRKSTQKSDVYS
Sbjct  459  IHGNIKSSNILLTQDLNGCISDFGLTPLMNSPAIPSRSVGYRAPEVIETRKSTQKSDVYS  518

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP QS  +++V+DLP+WVQSVVREEWT+EVFD EL+ Y Q++E+E+VQ
Sbjct  519  FGVILLEMLTGKAPSQSPGRDDVMDLPRWVQSVVREEWTSEVFDVELMKY-QNIEEELVQ  577

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV +VP+MRP MD+VVRMIEEIR  D   RPSSEDNK
Sbjct  578  MLQIAMACVSRVPDMRPTMDDVVRMIEEIRSLDSGTRPSSEDNK  621



>ref|XP_007033487.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007033488.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04413.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04414.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   317 bits (813),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 191/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMAL-DWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GS S+L+HG+RES  AL DW++RLKI+ GAA+G+A+IHS  G + 
Sbjct  408  YSKDEKLLVYDYKAAGSFSSLLHGSRESGRALPDWDSRLKISLGAAKGIAYIHSCAGGKF  467

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNVLL QDL+GCISDFGLT LM F  +P RSAGYRAPEVIETRK TQKSDVYS
Sbjct  468  SHGNIKSSNVLLNQDLHGCISDFGLTSLMSFPAVPSRSAGYRAPEVIETRKFTQKSDVYS  527

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK+PVQ +  E+VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+E+VQ
Sbjct  528  FGVLLLEMLTGKSPVQLSGHEDVVDLPRWVQSVVREEWTAEVFDVELMKY-QNVEEELVQ  586

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AM CV ++P+MRP M+EV RM+EEIR  D +NRPSSEDN+
Sbjct  587  MLQIAMTCVARLPDMRPTMEEVTRMMEEIRPSDSENRPSSEDNR  630



>ref|XP_007017100.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY34719.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=671

 Score =   318 bits (816),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLS L+HGNR   R  LDW +R+KI+ GAARG+AH+H + G + 
Sbjct  440  YSKDEKLLVYDYIPGGSLSTLLHGNRGGGRTPLDWESRVKISLGAARGIAHVHFMGGPKF  499

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGN+KSSNVLL QD +GCISD GLTPLM     P R+AGYRAPEVIETRK T KSDVYS
Sbjct  500  THGNVKSSNVLLNQDHDGCISDLGLTPLMNVPVTPSRTAGYRAPEVIETRKHTHKSDVYS  559

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  560  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  618

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP MDEVVRMIEE+RQ D +NRPSSE+NK
Sbjct  619  MLQIAMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENK  662



>ref|XP_011041759.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041760.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041761.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041762.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=636

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLS L+H NR + R  LDW++R+KIA G ARG++H+HSV G + 
Sbjct  405  YSKDEKLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSVGGPKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVLL+QD +GCISDFGLTPLM       RSAGYRAPEVIETRK T KSDVYS
Sbjct  465  THGNIKSTNVLLSQDHDGCISDFGLTPLMNVPATSSRSAGYRAPEVIETRKHTHKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  525  FGVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  583

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D +NRPSSE+NK
Sbjct  584  MLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENK  627



>ref|XP_002325632.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEF00014.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=636

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLS L+H NR + R  LDW++R+KIA G ARG++H+HSV G + 
Sbjct  405  YSKDEKLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSVGGPKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVLL+QD +GCISDFGLTPLM       RSAGYRAPEVIETRK T KSDVYS
Sbjct  465  THGNIKSTNVLLSQDHDGCISDFGLTPLMNVPATSSRSAGYRAPEVIETRKHTHKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  525  FGVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  583

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D +NRPSSE+NK
Sbjct  584  MLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENK  627



>ref|XP_011089538.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
 ref|XP_011089539.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
Length=636

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 192/224 (86%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GSL++L+HGN+ + R  LDW +R+K++ GAARG+AH+HS+ GA+ 
Sbjct  405  YSKDEKLLVYDYYPNGSLASLLHGNKTTGRAPLDWESRVKMSLGAARGIAHLHSIGGAKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QDL+GC+SDFGL PLM   +   R AGYRAPEV+ETRK T KSDVYS
Sbjct  465  THGNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTSSRHAGYRAPEVMETRKHTHKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGK P+QS ++E++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  525  FGVILLEMLTGKQPIQSPSREDIVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  583

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP +DEVVRMIEE+RQ D +NRPSS++NK
Sbjct  584  MLQIAMACVAKVPDMRPSIDEVVRMIEEVRQSDSENRPSSDENK  627



>ref|XP_004302522.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466405.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=633

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 186/218 (85%), Gaps = 2/218 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GS +AL+HG+RES     DW TRLKIA G+A+G+AHIHS  G + 
Sbjct  402  YSKDEKLLVYDYIAAGSFAALLHGHRESGHNGPDWETRLKIALGSAKGLAHIHSSGGGKF  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+L+TQDLNGCISDFGLTPLM F TIP RS GYRAPEVIE RKS QKSDVYS
Sbjct  462  IHGNIKSSNILITQDLNGCISDFGLTPLMNFATIPSRSVGYRAPEVIEARKSFQKSDVYS  521

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD EL+ + Q++E+E+VQ
Sbjct  522  FGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEELVQ  580

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRP  188
            +LQ+AMACV  VP++RP M+EVV+MIE+IR PD +NRP
Sbjct  581  MLQIAMACVQNVPDLRPTMEEVVKMIEDIRPPDSENRP  618



>ref|XP_011089537.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Sesamum indicum]
Length=655

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 192/224 (86%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GSL++L+HGN+ + R  LDW +R+K++ GAARG+AH+HS+ GA+ 
Sbjct  424  YSKDEKLLVYDYYPNGSLASLLHGNKTTGRAPLDWESRVKMSLGAARGIAHLHSIGGAKF  483

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QDL+GC+SDFGL PLM   +   R AGYRAPEV+ETRK T KSDVYS
Sbjct  484  THGNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTSSRHAGYRAPEVMETRKHTHKSDVYS  543

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGK P+QS ++E++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  544  FGVILLEMLTGKQPIQSPSREDIVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  602

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+MRP +DEVVRMIEE+RQ D +NRPSS++NK
Sbjct  603  MLQIAMACVAKVPDMRPSIDEVVRMIEEVRQSDSENRPSSDENK  646



>gb|KEH34523.1| LRR receptor-like kinase [Medicago truncatula]
Length=650

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+LS L+HGNR   R  LDW++R+KI+ G ARG+AHIHSV G + 
Sbjct  419  YSKDEKLLVYDYVPAGNLSTLLHGNRTGGRTPLDWDSRVKISLGTARGMAHIHSVGGPKF  478

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL  LM     P R+AGYRAPEVIETRK + KSDVYS
Sbjct  479  THGNIKSSNVLLNQDNDGCISDFGLASLMNVPANPSRAAGYRAPEVIETRKHSHKSDVYS  538

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  539  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  597

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDEVV+MIEEIRQ D +NRPSSE+NK
Sbjct  598  MLQIAMACVAKMPDMRPNMDEVVKMIEEIRQSDSENRPSSEENK  641



>ref|XP_003600547.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES70798.1| LRR receptor-like kinase [Medicago truncatula]
Length=660

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+LS L+HGNR   R  LDW++R+KI+ G ARG+AHIHSV G + 
Sbjct  429  YSKDEKLLVYDYVPAGNLSTLLHGNRTGGRTPLDWDSRVKISLGTARGMAHIHSVGGPKF  488

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL  LM     P R+AGYRAPEVIETRK + KSDVYS
Sbjct  489  THGNIKSSNVLLNQDNDGCISDFGLASLMNVPANPSRAAGYRAPEVIETRKHSHKSDVYS  548

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  549  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  607

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDEVV+MIEEIRQ D +NRPSSE+NK
Sbjct  608  MLQIAMACVAKMPDMRPNMDEVVKMIEEIRQSDSENRPSSEENK  651



>ref|XP_008463277.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463278.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463279.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463281.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463282.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463283.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=640

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 184/224 (82%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GS SAL+ G+RE  R   DW TRLK++ G A+G+AHIHS  G + 
Sbjct  399  YSKDEKLLVYDYAVAGSFSALLRGSREGGRAPPDWETRLKVSLGCAKGLAHIHSASGGKF  458

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LLTQD NGCISDFGLTPLM    IP RS GYRAPEVIETRKSTQKSDVYS
Sbjct  459  IHGNIKSSNILLTQDPNGCISDFGLTPLMNSPAIPSRSVGYRAPEVIETRKSTQKSDVYS  518

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP QS  +++V+DLP+WVQSVVREEWT+EVFD EL+ Y Q++E+E+VQ
Sbjct  519  FGVVLLEMLTGKAPSQSPGRDDVIDLPRWVQSVVREEWTSEVFDVELMKY-QNIEEELVQ  577

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV +VP+MRP MDEVVRMIEEIR      RPSSEDNK
Sbjct  578  MLQIAMACVSRVPDMRPTMDEVVRMIEEIRSLHSGTRPSSEDNK  621



>gb|KHN18649.1| Putative inactive receptor kinase [Glycine soja]
Length=585

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+L  L+HG R   R  LDW++R+KI+ G A+G+AH+HSV G + 
Sbjct  357  YSKDEKLLVYDYVPGGNLHTLLHGGRTGGRTPLDWDSRIKISLGTAKGLAHVHSVGGPKF  416

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEVIE RK + KSDVYS
Sbjct  417  THGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEVIEARKHSHKSDVYS  476

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  477  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  535

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  536  MLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENK  579



>ref|XP_006374053.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP51850.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GS   ++HGNRE  R ALDW +R+KI  G A+G+A+IHS  G + 
Sbjct  400  YSKDEKLLVYDYAPSGSFFTVLHGNREVGRTALDWESRVKICLGTAKGIAYIHSACGGKF  459

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLL QDL+GCISDFGLTPL+ + ++P RSAGYRAPEVI+TRKSTQKSDVYS
Sbjct  460  IHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPSRSAGYRAPEVIDTRKSTQKSDVYS  519

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAPVQS   ++V+DLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMV+
Sbjct  520  FGVVLLEMLTGKAPVQSPGHDDVIDLPRWVQSVVREEWTAEVFDEELMRY-QNIEEEMVE  578

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV  VP+MRP M+EVVRMIEE+   + +NRPSSE+NK
Sbjct  579  MLQIAMACVAVVPDMRPTMEEVVRMIEEVGPSESENRPSSEENK  622



>ref|XP_003537367.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006591268.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=671

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+L  L+HG R   R  LDW++R+KI+ G A+G+AHIHSV G + 
Sbjct  440  YSKDEKLLVYDYVPGGNLHTLLHGGRTGGRTPLDWDSRIKISLGTAKGLAHIHSVGGPKF  499

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEVIETRK + KSDVYS
Sbjct  500  THGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRAAGYRAPEVIETRKHSHKSDVYS  559

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  560  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  618

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDE VRMIEEIRQ D +NRPSSE+NK
Sbjct  619  MLQIAMACVAKMPDMRPSMDEAVRMIEEIRQSDSENRPSSEENK  662



>ref|XP_006591269.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=670

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+L  L+HG R   R  LDW++R+KI+ G A+G+AHIHSV G + 
Sbjct  439  YSKDEKLLVYDYVPGGNLHTLLHGGRTGGRTPLDWDSRIKISLGTAKGLAHIHSVGGPKF  498

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEVIETRK + KSDVYS
Sbjct  499  THGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRAAGYRAPEVIETRKHSHKSDVYS  558

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  559  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  617

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDE VRMIEEIRQ D +NRPSSE+NK
Sbjct  618  MLQIAMACVAKMPDMRPSMDEAVRMIEEIRQSDSENRPSSEENK  661



>ref|XP_008456255.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008456256.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=630

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 189/224 (84%), Gaps = 4/224 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GSLS+L+HGNR   R  LDW++R+KIA   A+G+AHIH+V G + 
Sbjct  401  YSKDEKLLVYDYVPGGSLSSLLHGNRGGERTPLDWDSRVKIALATAKGIAHIHAVGGPKF  460

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIK+SNVLL Q++N C+SDFGLTPLM   T   R+AGYRAPEVIE RK T KSDVYS
Sbjct  461  THGNIKASNVLLIQEINACVSDFGLTPLMNVPT--SRTAGYRAPEVIEARKHTHKSDVYS  518

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++E+VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  519  FGVLLLEMLTGKAPLQSPGRDEMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  577

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AM CV K+P+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  578  MLQIAMTCVAKLPDMRPNMDEVVRMIEEIRQSDSENRPSSEENK  621



>ref|XP_004139930.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
sativus]
 ref|XP_011656965.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
sativus]
 gb|KGN46766.1| hypothetical protein Csa_6G133750 [Cucumis sativus]
Length=630

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 189/224 (84%), Gaps = 4/224 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GSLS+L+HGNR   R  LDW++R+KIA   A+G+AHIH++ G + 
Sbjct  401  YSKDEKLLVYDYVPGGSLSSLLHGNRGGERTPLDWDSRVKIALATAKGIAHIHAMGGPKF  460

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIK+SNVLL QD+N C+SDFGLTPLM   T   R+AGYRAPEVIE RK T KSDVYS
Sbjct  461  THGNIKASNVLLIQDVNACVSDFGLTPLMNVPT--SRTAGYRAPEVIEARKHTHKSDVYS  518

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++E+VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  519  FGVLLLEMLTGKAPLQSPGRDEMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  577

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AM CV K+P+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  578  MLQIAMTCVAKLPDMRPNMDEVVRMIEEIRQSDSENRPSSEENK  621



>ref|XP_006602052.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+L  L+HG R   R  LDW++R+KI+ G A+G+AH+HSV G + 
Sbjct  412  YSKDEKLLVYDYVPGGNLHTLLHGGRTGGRTPLDWDSRIKISLGTAKGLAHVHSVGGPKF  471

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEVIE RK + KSDVYS
Sbjct  472  THGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEVIEARKHSHKSDVYS  531

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  532  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  590

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  591  MLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENK  634



>ref|XP_006602050.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=667

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+L  L+HG R   R  LDW++R+KI+ G A+G+AH+HSV G + 
Sbjct  439  YSKDEKLLVYDYVPGGNLHTLLHGGRTGGRTPLDWDSRIKISLGTAKGLAHVHSVGGPKF  498

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEVIE RK + KSDVYS
Sbjct  499  THGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEVIEARKHSHKSDVYS  558

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  559  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  617

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  618  MLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENK  661



>ref|XP_003553192.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006602051.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
Length=654

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+L  L+HG R   R  LDW++R+KI+ G A+G+AH+HSV G + 
Sbjct  426  YSKDEKLLVYDYVPGGNLHTLLHGGRTGGRTPLDWDSRIKISLGTAKGLAHVHSVGGPKF  485

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEVIE RK + KSDVYS
Sbjct  486  THGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEVIEARKHSHKSDVYS  545

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  546  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  604

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  605  MLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENK  648



>ref|XP_006602049.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=668

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+L  L+HG R   R  LDW++R+KI+ G A+G+AH+HSV G + 
Sbjct  440  YSKDEKLLVYDYVPGGNLHTLLHGGRTGGRTPLDWDSRIKISLGTAKGLAHVHSVGGPKF  499

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEVIE RK + KSDVYS
Sbjct  500  THGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEVIEARKHSHKSDVYS  559

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  560  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  618

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D +NRPSSE+NK
Sbjct  619  MLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENK  662



>ref|XP_006429632.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
 ref|XP_006481232.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481233.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006481234.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR42872.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
Length=632

 Score =   313 bits (801),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYDF+  GS SAL+HGNR   R  LDW +R+KI+ G+A+G+AHIH+  G + 
Sbjct  402  FSKDEKLLVYDFIEAGSFSALLHGNRGIGRTPLDWESRVKISLGSAKGIAHIHAAVGGKF  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
              GNIKSSNVLL+QDL GCISDFGLTPLM   T+P RSAGYRAPEVIET+K TQKSDVYS
Sbjct  462  ILGNIKSSNVLLSQDLQGCISDFGLTPLMNTPTVPSRSAGYRAPEVIETKKPTQKSDVYS  521

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q+   E+VVDLP+WVQSVVREEWT+EVFD EL+ Y +++E+EMVQ
Sbjct  522  FGVLLLEMLTGKAPIQAPGHEDVVDLPRWVQSVVREEWTSEVFDVELMRY-ENIEEEMVQ  580

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            +LQ+AM+CV KVP+MRP M+EVVRMIE+IR  D +N+PSSED
Sbjct  581  MLQIAMSCVAKVPDMRPTMEEVVRMIEDIRPSDSENQPSSED  622



>gb|KDO64166.1| hypothetical protein CISIN_1g006747mg [Citrus sinensis]
Length=632

 Score =   313 bits (801),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYDF+  GS SAL+HGNR   R  LDW +R+KI+ G+A+G+AHIH+  G + 
Sbjct  402  FSKDEKLLVYDFIEAGSFSALLHGNRGIGRTPLDWESRVKISLGSAKGIAHIHAAVGGKF  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
              GNIKSSNVLL+QDL GCISDFGLTPLM   T+P RSAGYRAPEVIET+K TQKSDVYS
Sbjct  462  ILGNIKSSNVLLSQDLQGCISDFGLTPLMNTPTVPSRSAGYRAPEVIETKKPTQKSDVYS  521

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q+   E+VVDLP+WVQSVVREEWT+EVFD EL+ Y +++E+EMVQ
Sbjct  522  FGVLLLEMLTGKAPIQAPGHEDVVDLPRWVQSVVREEWTSEVFDVELMRY-ENIEEEMVQ  580

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            +LQ+AM+CV KVP+MRP M+EVVRMIE+IR  D +N+PSSED
Sbjct  581  MLQIAMSCVAKVPDMRPTMEEVVRMIEDIRPSDSENQPSSED  622



>ref|XP_004500388.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=647

 Score =   313 bits (801),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+LS ++HG+R   R  LDW++R+KI+ G ARG+AHIHSV G + 
Sbjct  416  YSKDEKLLVYDYVPAGNLSTILHGSRAGGRTPLDWDSRVKISLGTARGIAHIHSVGGPKF  475

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL  LM     P R+AGYRAPEVIETRK + KSDVYS
Sbjct  476  THGNIKSSNVLLNQDNDGCISDFGLAALMNVPATPSRAAGYRAPEVIETRKHSHKSDVYS  535

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  536  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  594

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDEVVRMIEEIR  D +NRPSSE+NK
Sbjct  595  MLQIAMACVAKMPDMRPSMDEVVRMIEEIRLSDSENRPSSEENK  638



>ref|XP_003616055.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES99013.1| receptor-like kinase [Medicago truncatula]
Length=651

 Score =   313 bits (801),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 183/224 (82%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV D+   G+LS L+HG R   R  LDWNTR+KI+ G ARG+AH+H V G R 
Sbjct  420  YSKDEKLLVCDYFPNGNLSILLHGTRTGGRTTLDWNTRVKISLGIARGIAHLHLVGGPRF  479

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGN+KSSNVLL QD +GCISDFGLTPLM     P R+ GYRAPEVIETRK T KSDVYS
Sbjct  480  THGNVKSSNVLLNQDNDGCISDFGLTPLMNIPATPSRTMGYRAPEVIETRKHTHKSDVYS  539

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP QS  ++++VDLP+WV+SVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  540  FGVLLLEMLTGKAPQQSPVRDDMVDLPRWVRSVVREEWTAEVFDVELMRY-QNIEEEMVQ  598

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D DNRPSS+DNK
Sbjct  599  MLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSDNRPSSDDNK  642



>ref|XP_006358156.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358157.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=635

 Score =   312 bits (799),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV +++  GSLSA +HGNR   R  LDW++RLKI+ GAA+G+AHIH+  G + 
Sbjct  403  YSKDEKLLVNEYMPAGSLSAALHGNRGIGRTPLDWDSRLKISQGAAKGIAHIHTEGGVKF  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLT+DL+GCISDFGLTPLM + +   R AGYRAPEVIETRK TQKSDVYS
Sbjct  463  THGNIKSSNVLLTRDLDGCISDFGLTPLMNYISYKYRCAGYRAPEVIETRKGTQKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK+P+  + Q+EVVDLP+WV+SVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  523  FGVLLLEMLTGKSPLPLSGQDEVVDLPRWVRSVVREEWTAEVFDVELLKY-QNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ +ACV KVP+MRP M EVVRMIEEIRQP+ + RPSSED++
Sbjct  582  MLQIGLACVAKVPDMRPAMGEVVRMIEEIRQPEGETRPSSEDSR  625



>ref|XP_004490727.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490728.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
Length=653

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 182/224 (81%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV D+   G+LS L+HG R   R  LDWNTR+KI  G ARG+AH+HSV G + 
Sbjct  422  YSKDEKLLVCDYFPNGNLSTLLHGTRTGGRTTLDWNTRVKITLGIARGIAHLHSVGGPKF  481

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGN+KSSNVLL QD + CISDFGLTP M     P R+ GYRAPEVIETRK T KSDVYS
Sbjct  482  THGNVKSSNVLLNQDNDSCISDFGLTPFMNVPATPSRAIGYRAPEVIETRKHTHKSDVYS  541

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  542  FGVLLLEMLTGKAPQQSPVRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  600

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ MACV KVP+MRP M+EVVRMIEEIRQ D DNRPSS++NK
Sbjct  601  MLQIGMACVAKVPDMRPNMEEVVRMIEEIRQSDSDNRPSSDENK  644



>ref|XP_011095165.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011095166.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=643

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 184/217 (85%), Gaps = 2/217 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            YSKDEKLL+YD V  GSLSA +HGNR+S   LDW++R+KI+ GAA+GVAHIHS  G + T
Sbjct  415  YSKDEKLLIYDHVPGGSLSAQLHGNRDSGRILDWDSRVKISLGAAKGVAHIHSTAGGKQT  474

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFT-TIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            HGNIKSSNVLLTQD NGCI+DFGLTPLMG   TIP RSAGYRAPEV ETRKSTQKSDVYS
Sbjct  475  HGNIKSSNVLLTQDFNGCITDFGLTPLMGIIPTIPSRSAGYRAPEVTETRKSTQKSDVYS  534

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP +   Q+EVVDLP+WVQSVVREEWTAEVFDA+L+ Y Q++E+EMVQ
Sbjct  535  FGVLLLELLTGKAPTKLVGQDEVVDLPRWVQSVVREEWTAEVFDADLVKY-QNIEEEMVQ  593

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNR  191
            +LQ+AM CV +VP+ RP MDEVV+MI +IR  D +N+
Sbjct  594  MLQIAMNCVAQVPDARPAMDEVVKMIGKIRPSDSENQ  630



>ref|XP_007146903.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
 gb|ESW18897.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
Length=657

 Score =   311 bits (796),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  G+L  L+HG R   R  LDW +R+KI+ G+A+G+AHIHSV G++ 
Sbjct  426  YSKDEKLLVYDYIPAGNLHTLLHGGRTGGRTPLDWESRIKISLGSAKGLAHIHSVGGSKF  485

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD +GCISDFGL  LM     P R+AGYRAPEV+ETRK + KSDVYS
Sbjct  486  THGNIKSSNVLLNQDNDGCISDFGLASLMNVPATPSRAAGYRAPEVVETRKHSHKSDVYS  545

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  546  FGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  604

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV K+P+MRP MDEVVR+IEEIRQ D +NRPSSE+NK
Sbjct  605  MLQIAMACVAKMPDMRPSMDEVVRLIEEIRQSDSENRPSSEENK  648



>ref|XP_011011771.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011772.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011773.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011774.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011775.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
Length=635

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 186/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDE+LLVYD++  GSLS L+H NR + R  LDW++R+KIA G ARG++H+HS  G + 
Sbjct  404  YSKDERLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSAGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL+QD +GCISDFGLTPLM       RSAGYRAPEVIET K + KSDVYS
Sbjct  464  THGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEVIETSKHSHKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  524  FGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D +NRPSSE NK
Sbjct  583  MLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEGNK  626



>ref|XP_002319979.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEE95902.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=635

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 186/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDE+LLVYD++  GSLS L+H NR + R  LDW++R+KIA G ARG++H+HS  G + 
Sbjct  404  YSKDERLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSAGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL+QD +GCISDFGLTPLM       RSAGYRAPEVIET K + KSDVYS
Sbjct  464  THGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEVIETSKHSHKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  524  FGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D +NRPSSE NK
Sbjct  583  MLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEGNK  626



>ref|XP_002528709.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33698.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=633

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 183/224 (82%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V+ GS   L+HG+    +  LDW +R+KI    ARG+AHIHS  G R 
Sbjct  404  YSKDEKLLVYDYVSAGSFFTLLHGSGAFGQNPLDWESRVKICLETARGIAHIHSAAGGRF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             H NIKSSNVL+TQDL G +SDFGLTP+M +  +P R+AGYRAPEVIETRK TQKSDVYS
Sbjct  464  IHANIKSSNVLITQDLCGSVSDFGLTPIMSYPAVPSRTAGYRAPEVIETRKPTQKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAPVQS  Q++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  524  FGVLLLEMLTGKAPVQSTGQDDVVDLPRWVQSVVREEWTAEVFDLELLKY-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV +VP+MRP MDEVVRMIEEIR PD  N PSSE+ K
Sbjct  583  MLQIAMACVARVPDMRPTMDEVVRMIEEIRVPDSLNHPSSEEYK  626



>ref|XP_009355011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009355020.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=623

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 189/221 (86%), Gaps = 3/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+++ GSLSA +HGNR   R +LDW++R+KI+ G ARG+AHIHSV G + 
Sbjct  403  YSKDEKLLVYDYISNGSLSARLHGNRGIERPSLDWDSRIKISLGTARGIAHIHSVGGPKF  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVLL+QDL+GCISD GLTPLM       RSAGYRAPEVIETRK + KSDVYS
Sbjct  463  THGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATA-RSAGYRAPEVIETRKHSHKSDVYS  521

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  522  FGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  580

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D +NR SSE
Sbjct  581  MLQIAMACVAKVPDMRPTMEEVVRMIEEIRQSDSENRQSSE  621



>ref|XP_004235218.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318222.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318223.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318224.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=635

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV +++  GSLSA +H NR + R  LDW++RLKI+ GAA+G+AHIH+  G + 
Sbjct  403  YSKDEKLLVNEYMPAGSLSAALHDNRSTGRTPLDWDSRLKISQGAAKGIAHIHTEGGVKF  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLT+DL+GCISDFGLTP+M + +   R AGYRAPEVIETRK TQKSDVYS
Sbjct  463  THGNIKSSNVLLTRDLDGCISDFGLTPMMNYISFKYRCAGYRAPEVIETRKGTQKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK+P+    Q+EVVDLP+WV+SVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  523  FGVLLLEMLTGKSPLPLPGQDEVVDLPRWVRSVVREEWTAEVFDVELLKY-QNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ +ACV KVP+MRP M EVVRMIEEIRQP  + RPSSED++
Sbjct  582  MLQIGLACVAKVPDMRPAMGEVVRMIEEIRQPQGETRPSSEDSR  625



>emb|CAN80590.1| hypothetical protein VITISV_040789 [Vitis vinifera]
Length=625

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++T GSL AL+HGNR+  +  L+W +R+KIA G A+G+ HIHS  G + 
Sbjct  395  YSKDEKLLVYDYITGGSLFALLHGNRDPEKTLLNWESRVKIALGTAKGIVHIHSANGGKF  454

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLTQD++G ISDFGLT LM +  +  RS GYRAPEVIETRKSTQKSDVYS
Sbjct  455  THGNIKSSNVLLTQDVDGQISDFGLTSLMNYPLVTSRSLGYRAPEVIETRKSTQKSDVYS  514

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD EL+   QS E+EMVQ
Sbjct  515  YGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMK-DQSYEEEMVQ  573

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            +LQ+AMACV K+P+MRPKM+EVVR++EEIR  D +NRPSS++
Sbjct  574  MLQIAMACVAKMPDMRPKMEEVVRLMEEIRPSDSENRPSSDN  615



>ref|XP_010653700.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Vitis vinifera]
 emb|CBI32886.3| unnamed protein product [Vitis vinifera]
Length=634

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++T GSL AL+HGNR+  +  L+W +R+KIA G A+G+ HIHS  G + 
Sbjct  404  YSKDEKLLVYDYITGGSLFALLHGNRDPEKTLLNWESRVKIALGTAKGIVHIHSANGGKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLTQD++G ISDFGLT LM +  +  RS GYRAPEVIETRKSTQKSDVYS
Sbjct  464  THGNIKSSNVLLTQDVDGQISDFGLTSLMNYPLVTSRSLGYRAPEVIETRKSTQKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD EL+   QS E+EMVQ
Sbjct  524  YGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMK-DQSYEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            +LQ+AMACV K+P+MRPKM+EVVR++EEIR  D +NRPSS++
Sbjct  583  MLQIAMACVAKMPDMRPKMEEVVRLMEEIRPSDSENRPSSDN  624



>ref|XP_010653698.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
 ref|XP_010653699.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
Length=667

 Score =   308 bits (790),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++T GSL AL+HGNR+  +  L+W +R+KIA G A+G+ HIHS  G + 
Sbjct  437  YSKDEKLLVYDYITGGSLFALLHGNRDPEKTLLNWESRVKIALGTAKGIVHIHSANGGKF  496

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLTQD++G ISDFGLT LM +  +  RS GYRAPEVIETRKSTQKSDVYS
Sbjct  497  THGNIKSSNVLLTQDVDGQISDFGLTSLMNYPLVTSRSLGYRAPEVIETRKSTQKSDVYS  556

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD EL+   QS E+EMVQ
Sbjct  557  YGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMK-DQSYEEEMVQ  615

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            +LQ+AMACV K+P+MRPKM+EVVR++EEIR  D +NRPSS++
Sbjct  616  MLQIAMACVAKMPDMRPKMEEVVRLMEEIRPSDSENRPSSDN  657



>gb|KJB20517.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20518.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20520.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20521.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
Length=657

 Score =   308 bits (789),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLS L+HG+R   R  LDW +R+KI+ G ARG++H+HS+ G + 
Sbjct  426  YSKDEKLLVYDYIPGGSLSTLLHGDRGGGRSPLDWESRVKISLGIARGISHVHSMGGPKF  485

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVL+ Q+ +GCISD GLTPLM     P RS GYRAPEVIETRK T KSDVYS
Sbjct  486  THGNIKSSNVLINQEHDGCISDLGLTPLMNVPATPSRSVGYRAPEVIETRKHTHKSDVYS  545

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  546  FGVLLLEMLTGKAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  604

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KV +MRP MDEVVRMIEE+RQ D +NRPSSE+NK
Sbjct  605  MLQIAMACVAKVADMRPNMDEVVRMIEEVRQSDSENRPSSEENK  648



>ref|XP_011080640.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=640

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 185/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GSL+AL+HGNR + R  LDW++R++I+ GAARG+AH+H+  GAR 
Sbjct  415  YSKDEKLLVYDYYPSGSLAALLHGNRTAGRTPLDWDSRVRISLGAARGIAHLHAAGGARF  474

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD+  C+SDFGL PLM       R  GYRAPEVIETRK T KSDVYS
Sbjct  475  THGNIKSSNVLLNQDVEACVSDFGLAPLMNSPASSSRHTGYRAPEVIETRKHTHKSDVYS  534

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGK P+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  535  FGVMLLEMLTGKQPIQSPGRDDIVDLPRWVQSVVREEWTAEVFDIELMRF-QNIEEEMVQ  593

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KVP+ RP MDEVVRMIEE+R  D +NRPSSE+NK
Sbjct  594  MLQIAMACVAKVPDARPNMDEVVRMIEEVRPSDSENRPSSEENK  637



>ref|XP_009337799.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=636

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 183/222 (82%), Gaps = 2/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GS SAL+HGNRES +   DW TRL I+ G A+G+AHIHS  G + 
Sbjct  396  YSKDEKLLVYDYIPAGSFSALLHGNRESGQHPPDWETRLNISLGCAKGLAHIHSASGGKF  455

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGN+KSSNVLL QDL G ISDFGL PLM FT IP RS GYRAPEVIET+KS QKSDVYS
Sbjct  456  IHGNVKSSNVLLMQDLTGSISDFGLAPLMNFTAIPSRSVGYRAPEVIETKKSFQKSDVYS  515

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD EL+   +++E+E+VQ
Sbjct  516  FGVMLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRC-ENIEEELVQ  574

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            +LQ+AM CV  VP+MRP M+EVVRMIE+IR PD +NR SSED
Sbjct  575  MLQIAMTCVATVPDMRPTMEEVVRMIEDIRPPDSENRSSSED  616



>gb|ABK93951.1| unknown [Populus trichocarpa]
Length=351

 Score =   298 bits (763),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV+++++ GSLSA +HGNR   R +LDWN R+KI  G ARG+A IHS  GA+ 
Sbjct  124  YSKDEKLLVHNYMSAGSLSAFLHGNRAGGRTSLDWNARVKICLGTARGIARIHSEGGAKF  183

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SNVLLT DL+GCISD GL PLM F T   R+ GYRAPEVIETRK++QKSDVYS
Sbjct  184  FHGNIKASNVLLTPDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEVIETRKASQKSDVYS  243

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD EL+  HQ++E+EMVQ
Sbjct  244  FGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVR-HQNIEEEMVQ  302

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR SS+
Sbjct  303  MLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  343



>ref|XP_011001674.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=631

 Score =   306 bits (785),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 185/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   GS   ++HGNRE  R ALDW +R+KI    A+G+A+IHS  G   
Sbjct  405  YSKDEKLLVYDYAPSGSFFTVLHGNREVGRTALDWESRVKICLETAKGIAYIHSACGGNF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLL QDL+GCISDFGLTPL+ + ++P RS GYRAPEVI+TRKSTQKSDVYS
Sbjct  465  IHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPSRSVGYRAPEVIDTRKSTQKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAPVQS   ++++DLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMV+
Sbjct  525  FGVVLLEMLTGKAPVQSPGHDDLIDLPRWVQSVVREEWTAEVFDEELMRY-QNIEEEMVE  583

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV  VP+MRP M+EVVRMIEE+   + +NRPSSE+NK
Sbjct  584  MLQIAMACVAVVPDMRPTMEEVVRMIEEVGPSESENRPSSEENK  627



>gb|KHG05843.1| hypothetical protein F383_32232 [Gossypium arboreum]
Length=659

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLS L+HG+R   R  LDW +R+KI+ G ARG++H+HS+ G + 
Sbjct  428  YSKDEKLLVYDYIPGGSLSTLLHGDRGGGRSPLDWESRVKISLGIARGISHVHSMGGPKF  487

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVL+ Q+ +GCISD GLTPLM     P R+ GYRAPEVIETRK T KSDVYS
Sbjct  488  THGNIKSSNVLINQEHDGCISDLGLTPLMNVPATPSRTVGYRAPEVIETRKHTHKSDVYS  547

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD EL+ + Q++E+EMVQ
Sbjct  548  FGVLLLEMLTGKAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEEMVQ  606

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AMACV KV +MRP MDEVVRMIEE+RQ D +NRPSSE+NK
Sbjct  607  MLQIAMACVAKVADMRPNMDEVVRMIEEVRQSDSENRPSSEENK  650



>ref|XP_011084790.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084791.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084792.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084793.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084794.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084795.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084796.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084797.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084800.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=635

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVY+++   SLSA +HGN+   R  LDW+TRL IA GAARG+AHIHS  GA+ 
Sbjct  404  FSKDEKLLVYEYMPASSLSAALHGNKGIGRTPLDWDTRLNIALGAARGLAHIHSEGGAKH  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSN+LL   L+GC+SDFGL+P+M +  I  R AGYRAPEVIETRK +QK+DVYS
Sbjct  464  THGNIKSSNILLNASLDGCVSDFGLSPMMNYIPIKYRVAGYRAPEVIETRKVSQKADVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGK+P+Q    ++VVDLP+WV+SVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  524  FGVVLLEMLTGKSPIQYTGYDDVVDLPRWVRSVVREEWTAEVFDVELMKY-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+A+ACV KVP+MRP MDEVVRMIE+IRQ + +NRPSSEDN+
Sbjct  583  MLQIALACVAKVPDMRPSMDEVVRMIEDIRQSELENRPSSEDNR  626



>ref|XP_008803002.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803003.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803004.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=635

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 186/225 (83%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GS S L+HGN+ + R  LDW++R+KI+ GAARG+AHIH+  G + 
Sbjct  405  YSKDEKLLVYDYVPSGSFSTLLHGNKGAGRTPLDWDSRVKISVGAARGIAHIHTEGGGKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPR-SAGYRAPEVIETRKSTQKSDVY  485
            THGNIK+SNVLLTQDL  C+SDFGL PLM     P R   GYRAPEVIETRKSTQKSDVY
Sbjct  465  THGNIKASNVLLTQDLEACVSDFGLAPLMNTHATPSRIVVGYRAPEVIETRKSTQKSDVY  524

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMV
Sbjct  525  SFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQ+AMACV + P+ RP+M+EV+RMIEE+R  D  NRPSSE +K
Sbjct  584  QMLQIAMACVARAPDQRPRMEEVIRMIEEVRHSDSGNRPSSEKSK  628



>ref|XP_012091018.1| PREDICTED: probable inactive receptor kinase At3g08680 [Jatropha 
curcas]
 ref|XP_012091019.1| PREDICTED: probable inactive receptor kinase At3g08680 [Jatropha 
curcas]
 gb|KDP21848.1| hypothetical protein JCGZ_00635 [Jatropha curcas]
Length=657

 Score =   305 bits (782),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 182/224 (81%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GS   L+HG     R  LDW +R+KI  GAARG+AHIHS  G + 
Sbjct  429  YSKDEKLLVYDYVAGGSFFTLLHGGGIFGRTPLDWESRVKICLGAARGIAHIHSAGGGKF  488

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LLTQDL G ISDFGLTP+M + ++P RSAGYRAPEVIETRKSTQKSDVYS
Sbjct  489  IHGNIKSSNLLLTQDLRGRISDFGLTPIMSYPSVPARSAGYRAPEVIETRKSTQKSDVYS  548

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAPVQS  Q+EVVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  549  FGVLLLEMLTGKAPVQSTGQDEVVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  607

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AM+CV +VP+ RP M+EVVRMIEEIR  D  N  S E+ +
Sbjct  608  MLQIAMSCVARVPDTRPTMNEVVRMIEEIRPTDSVNHTSEENTE  651



>ref|XP_010683449.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=641

 Score =   305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 183/221 (83%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD V  GSL A +HG+++  +  LDW +R+KI  GAA+G+AHIHS  G R 
Sbjct  408  YSKDEKLLVYDHVLAGSLLARLHGSKDGEKPPLDWESRIKILLGAAKGIAHIHSAAGGRF  467

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNV L++D+NGCISDFGL PLM F  +PPR+AGYRAPE +ETRK TQKSDVYS
Sbjct  468  THGNIKSSNVFLSEDVNGCISDFGLAPLMSFPAVPPRTAGYRAPETVETRKITQKSDVYS  527

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGK PVQS  +++VVDLP+WVQSVVREEWTAEVFD EL+  +Q++E+E+VQ
Sbjct  528  FGVLLLELLTGKTPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDTELMR-NQNIEEELVQ  586

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+AMACV KVP++RP M EVVRMIEE RQ D  +RPS E
Sbjct  587  MLQIAMACVSKVPDLRPDMGEVVRMIEETRQSDSSSRPSPE  627



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score =   305 bits (780),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 185/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV +++  GSLSA +HGNR   R  LDW+TRLKI+ GAA+G+AHIH+  G + 
Sbjct  416  YSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKF  475

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLT+D +GCISDFGLTPLM +     R AGYRAPEVIETRK TQKSDVYS
Sbjct  476  THGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYS  535

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LT K+P+  +  +EVVDLP+WV+SVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  536  FGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKY-QNIEEEMVQ  594

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ +ACV KVP+MRP M +VVRMIEEIRQP  + RPSSED++
Sbjct  595  MLQIGLACVAKVPDMRPSMGQVVRMIEEIRQPQGETRPSSEDSR  638



>ref|XP_008366817.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
 ref|XP_008366818.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=636

 Score =   304 bits (778),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 180/218 (83%), Gaps = 2/218 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GS SAL+HGNRES +   DW TRL+I+ G A+G+AHIHS    + 
Sbjct  396  YSKDEKLLVYDYIPAGSFSALLHGNRESGQHPPDWETRLRISLGCAKGLAHIHSASEGKF  455

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGN+KSSNVLL QDL G ISDFGL PLM F  IP RS GYRAPEVIET+KS QKSDVYS
Sbjct  456  IHGNVKSSNVLLMQDLTGSISDFGLAPLMNFXAIPSRSVGYRAPEVIETKKSFQKSDVYS  515

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAPVQS  ++++VDLP+WVQSVVREEWTAEVFD EL+ Y +++E+E+VQ
Sbjct  516  FGVMLLEMLTGKAPVQSPGRDDIVDLPRWVQSVVREEWTAEVFDVELMRY-ENIEEELVQ  574

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRP  188
            +LQ+AM CV  VP+MRP M+EVVRMIEEIR PD +NRP
Sbjct  575  MLQIAMTCVATVPDMRPTMEEVVRMIEEIRPPDSENRP  612



>ref|XP_010922781.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922782.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922783.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922784.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922785.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922786.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=635

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 186/225 (83%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GS S L+HGN+ + R  LDW++R+KI+ GAARG+AHIH+  G + 
Sbjct  405  YSKDEKLLVYDYVPSGSFSTLLHGNKGAGRTPLDWDSRVKISLGAARGIAHIHTEGGGKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPEVIETRKSTQKSDVY  485
            THGNIK+SNVLLTQDL  C+SDFGL PLM     P R   GYRAPEVIETRKSTQKSDVY
Sbjct  465  THGNIKASNVLLTQDLEACVSDFGLAPLMNIHATPSRVVVGYRAPEVIETRKSTQKSDVY  524

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMV
Sbjct  525  SFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQ+AMACV + P+ RP M++V+RMIEE+R  D +NRPSSE +K
Sbjct  584  QMLQIAMACVARAPDQRPIMEDVIRMIEEVRHSDSENRPSSEKSK  628



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 185/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV +++  GSLSA +HGN    R  LDW+TRLKI+ GAA+G+AHIH+  G + 
Sbjct  453  YSKDEKLLVTEYMPAGSLSAALHGNSGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKF  512

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSN+LLT+D +GCISDFGLTPLM +     R AGYRAPEVIETRK TQKSDVYS
Sbjct  513  THGNIKSSNILLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYS  572

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LT K+P+  +  +EVVDLP+WV+SVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  573  FGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKY-QNIEEEMVQ  631

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ +ACV KVP+MRP M EVVRMIE+IRQP+ + RPSSEDN+
Sbjct  632  MLQIGLACVAKVPDMRPSMGEVVRMIEDIRQPEGETRPSSEDNR  675



>gb|KJB29842.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
 gb|KJB29843.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
Length=660

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMAL-DWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYDF+  GS S+L+HG+RE    L  W++R+KI+ GAA+G+A+IHS  G + 
Sbjct  429  YSKDEKLMVYDFIAAGSFSSLLHGSRERGRPLPGWDSRVKISLGAAKGIAYIHSSGGGKF  488

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLLT+DL+GCISDFGLTPLM    +P RSAGYRAPEVIE+RK TQKSDVYS
Sbjct  489  IHGNIKSSNVLLTKDLHGCISDFGLTPLMTSPKVPSRSAGYRAPEVIESRKFTQKSDVYS  548

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKA  QS+  ++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+E+VQ
Sbjct  549  FGVLLLEMLTGKAATQSSGHKDVVDLPRWVQSVVREEWTAEVFDVELMKY-QNIEEELVQ  607

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AM CV ++P+MRP M+EV RMIEEIR    +NRPSSEDN+
Sbjct  608  MLQIAMTCVARLPDMRPTMEEVTRMIEEIRPSVSENRPSSEDNR  651



>ref|XP_011001675.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=586

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 185/225 (82%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMH-GNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKLLVYD+   GS   ++H GNRE  R ALDW +R+KI    A+G+A+IHS  G  
Sbjct  359  YSKDEKLLVYDYAPSGSFFTVLHAGNREVGRTALDWESRVKICLETAKGIAYIHSACGGN  418

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
              HGNIKSSNVLL QDL+GCISDFGLTPL+ + ++P RS GYRAPEVI+TRKSTQKSDVY
Sbjct  419  FIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPSRSVGYRAPEVIDTRKSTQKSDVY  478

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLE+LTGKAPVQS   ++++DLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMV
Sbjct  479  SFGVVLLEMLTGKAPVQSPGHDDLIDLPRWVQSVVREEWTAEVFDEELMRY-QNIEEEMV  537

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            ++LQ+AMACV  VP+MRP M+EVVRMIEE+   + +NRPSSE+NK
Sbjct  538  EMLQIAMACVAVVPDMRPTMEEVVRMIEEVGPSESENRPSSEENK  582



>gb|KHG17391.1| hypothetical protein F383_22576 [Gossypium arboreum]
Length=661

 Score =   303 bits (777),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 186/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMAL-DWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYDF+  GS S+L+HG+RE    L  W++R+KI+ GAA+G+A+IHS  G + 
Sbjct  430  YSKDEKLMVYDFIAAGSFSSLLHGSRERGRPLPGWDSRVKISLGAAKGIAYIHSSGGGKF  489

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLLT+DL+GCISDFGLTPLM    +P RSAGYRAPEVIE+RK TQKSDVYS
Sbjct  490  IHGNIKSSNVLLTEDLHGCISDFGLTPLMTSPKVPSRSAGYRAPEVIESRKFTQKSDVYS  549

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKA  QS+   +VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+E+VQ
Sbjct  550  FGVLLLEMLTGKAATQSSGHADVVDLPRWVQSVVREEWTAEVFDVELMKY-QNIEEELVQ  608

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+AM CV ++P+MRP M+EV RMIEEIR    +NRPSSEDN+
Sbjct  609  MLQIAMTCVARLPDMRPSMEEVTRMIEEIRPSVSENRPSSEDNR  652



>ref|XP_009760490.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Nicotiana sylvestris]
Length=717

 Score =   305 bits (780),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 185/224 (83%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV +++  GSLSA +HGNR   R  LDW+TRLKI+ GAA+G+AHIH+  G + 
Sbjct  487  YSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKF  546

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLT+D +GCISDFGLTPLM +     R AGYRAPEVIETRK TQKSDVYS
Sbjct  547  THGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYS  606

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LT K+P+  +  +EVVDLP+WV+SVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  607  FGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKY-QNIEEEMVQ  665

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+ +ACV KVP+MRP M +VVRMIEEIRQP  + RPSSED++
Sbjct  666  MLQIGLACVAKVPDMRPSMGQVVRMIEEIRQPQGETRPSSEDSR  709



>ref|XP_011001671.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011001672.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=632

 Score =   302 bits (773),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 185/225 (82%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMH-GNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKLLVYD+   GS   ++H GNRE  R ALDW +R+KI    A+G+A+IHS  G  
Sbjct  405  YSKDEKLLVYDYAPSGSFFTVLHAGNREVGRTALDWESRVKICLETAKGIAYIHSACGGN  464

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
              HGNIKSSNVLL QDL+GCISDFGLTPL+ + ++P RS GYRAPEVI+TRKSTQKSDVY
Sbjct  465  FIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPSRSVGYRAPEVIDTRKSTQKSDVY  524

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLE+LTGKAPVQS   ++++DLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMV
Sbjct  525  SFGVVLLEMLTGKAPVQSPGHDDLIDLPRWVQSVVREEWTAEVFDEELMRY-QNIEEEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            ++LQ+AMACV  VP+MRP M+EVVRMIEE+   + +NRPSSE+NK
Sbjct  584  EMLQIAMACVAVVPDMRPTMEEVVRMIEEVGPSESENRPSSEENK  628



>gb|ABR17070.1| unknown [Picea sitchensis]
Length=340

 Score =   293 bits (749),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 183/224 (82%), Gaps = 4/224 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLSAL+HG+R S R  LDW+TR++IA GAARG++HIH   G + 
Sbjct  92   YSKDEKLLVYDYMPTGSLSALLHGSRGSGRTPLDWDTRMRIALGAARGISHIHEEGGGKF  151

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLT DL+GC+SDFGL PL        R AGYRAPEVIETRK TQKSDVYS
Sbjct  152  THGNIKSSNVLLTTDLDGCVSDFGLVPLFSAAAAANRIAGYRAPEVIETRKVTQKSDVYS  211

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  +E +DLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  212  FGVLLLELLTGKAPNQASLNDEGIDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  270

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFD--NRPSSED  176
            LLQ+AMACV  VP+ RP+M +VV+MIE++RQ + D  NR SS+D
Sbjct  271  LLQIAMACVAAVPDQRPRMQDVVKMIEDMRQFETDDGNRQSSDD  314



>ref|XP_010931391.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931392.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931393.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=636

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 185/223 (83%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GS S L+HGN+ S R  LDW++R+KI+ GAARG+AHIH+  G + 
Sbjct  405  YSKDEKLLVYDYVPSGSFSTLLHGNKGSGRTPLDWDSRVKISLGAARGIAHIHTDGGGKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPEVIETRKSTQKSDVY  485
            THGNIK+SNVLLTQDL  C+SDFGL PLM     P R   GYRAPEVIETRKSTQ+SDVY
Sbjct  465  THGNIKASNVLLTQDLEACVSDFGLAPLMNTHATPSRVVVGYRAPEVIETRKSTQRSDVY  524

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMV
Sbjct  525  SFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            Q+LQ+AMACV + P+ RP+M+EV+RMIEE+R  D +NR SSE+
Sbjct  584  QMLQIAMACVARAPDQRPRMEEVIRMIEEVRHSDSENRQSSEE  626



>ref|XP_010999642.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=630

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV+++++ GSLSA +HGNR   R +LDWN R+KI  G ARG+A IHS  GA+ 
Sbjct  403  YSKDEKLLVHNYMSAGSLSAFLHGNRAGGRTSLDWNARVKICLGTARGIARIHSEGGAKF  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNV+LT DL+GCISD GL PLM F T   R+ GYRAPEVIETRK++QKSDVYS
Sbjct  463  FHGNIKSSNVILTSDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEVIETRKASQKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD EL+  HQ++E+EMVQ
Sbjct  523  FGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVR-HQNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR SS+
Sbjct  582  MLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  622



>ref|XP_006401105.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
 gb|ESQ42558.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
Length=650

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 188/224 (84%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   G+LS+L+HGNRES RM LDW++R+KI   AA+G+AH+H+V G + 
Sbjct  416  YSKDEKLLVYDYYPAGNLSSLLHGNRESERMPLDWDSRVKITLAAAKGIAHLHAVGGPKF  475

Query  661  THGNIKSSNVLLTQDLNG-CISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
            +HGNIKSSNV++ Q+ +  CISDFGL PLM     P R AGYRAPEVIETRK T KSD+Y
Sbjct  476  SHGNIKSSNVIMKQESSDVCISDFGLAPLMAVPVAPMRGAGYRAPEVIETRKHTHKSDIY  535

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVL+LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMV
Sbjct  536  SFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMRF-QNIEEEMV  594

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            Q+LQVAMACV ++PE+RP MDEVVRMIEEIR  D + RPSS+DN
Sbjct  595  QMLQVAMACVAQMPEVRPTMDEVVRMIEEIRASDSETRPSSDDN  638



>ref|XP_010683445.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683446.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683447.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683448.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=643

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 183/223 (82%), Gaps = 4/223 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMH--GNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGA  668
            YSKDEKLLVYD V  GSL A +H  G+++  +  LDW +R+KI  GAA+G+AHIHS  G 
Sbjct  408  YSKDEKLLVYDHVLAGSLLARLHVSGSKDGEKPPLDWESRIKILLGAAKGIAHIHSAAGG  467

Query  667  RLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDV  488
            R THGNIKSSNV L++D+NGCISDFGL PLM F  +PPR+AGYRAPE +ETRK TQKSDV
Sbjct  468  RFTHGNIKSSNVFLSEDVNGCISDFGLAPLMSFPAVPPRTAGYRAPETVETRKITQKSDV  527

Query  487  YSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEM  308
            YS GVLLLELLTGK PVQS  +++VVDLP+WVQSVVREEWTAEVFD EL+  +Q++E+E+
Sbjct  528  YSFGVLLLELLTGKTPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDTELMR-NQNIEEEL  586

Query  307  VQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            VQ+LQ+AMACV KVP++RP M EVVRMIEE RQ D  +RPS E
Sbjct  587  VQMLQIAMACVSKVPDLRPDMGEVVRMIEETRQSDSSSRPSPE  629



>ref|XP_006371315.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|ERP49112.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=630

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV+++++ GSLSA +HGNR   R +LDWN R+KI  G ARG+A IHS  GA+ 
Sbjct  403  YSKDEKLLVHNYMSAGSLSAFLHGNRAGGRTSLDWNARVKICLGTARGIARIHSEGGAKF  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SNVLLT DL+GCISD GL PLM F T   R+ GYRAPEVIETRK++QKSDVYS
Sbjct  463  FHGNIKASNVLLTPDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEVIETRKASQKSDVYS  522

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD EL+  HQ++E+EMVQ
Sbjct  523  FGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVR-HQNIEEEMVQ  581

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR SS+
Sbjct  582  MLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  622



>gb|EYU42048.1| hypothetical protein MIMGU_mgv1a003031mg [Erythranthe guttata]
Length=614

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 185/226 (82%), Gaps = 3/226 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSV--PGAR  665
            +SKDEKLLVY+ V RGSLS  +HGN+ES  +LDW +R+K+  GAA+GVA+IHS    G +
Sbjct  383  FSKDEKLLVYEHVPRGSLSTQLHGNKESGRSLDWESRVKVLLGAAKGVAYIHSAGAAGGK  442

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMG-FTTIPPRSAGYRAPEVIETRKSTQKSDV  488
            LTHGNIKSSNVLLTQ+ +  I+DFGL P+MG    IP R AGYRAPE+++T KSTQKSD+
Sbjct  443  LTHGNIKSSNVLLTQNSDARITDFGLIPVMGGIPGIPSRGAGYRAPELVQTGKSTQKSDI  502

Query  487  YSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEM  308
            YS GVL+LELLTGKAPVQ   Q+EV DLP+WVQSVVREEWTAEVFDA+LI YH ++E+EM
Sbjct  503  YSFGVLILELLTGKAPVQPMGQDEVEDLPRWVQSVVREEWTAEVFDADLIKYHNNIEEEM  562

Query  307  VQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            VQ+LQ+ +ACV KVPEMRP M EVVRMIEEIR  D +NR SSE ++
Sbjct  563  VQMLQIGLACVAKVPEMRPAMSEVVRMIEEIRLTDSENRTSSEKSR  608



>ref|XP_010999638.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=656

 Score =   299 bits (766),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV+++++ GSLSA +HGNR   R +LDWN R+KI  G ARG+A IHS  GA+ 
Sbjct  429  YSKDEKLLVHNYMSAGSLSAFLHGNRAGGRTSLDWNARVKICLGTARGIARIHSEGGAKF  488

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNV+LT DL+GCISD GL PLM F T   R+ GYRAPEVIETRK++QKSDVYS
Sbjct  489  FHGNIKSSNVILTSDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEVIETRKASQKSDVYS  548

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD EL+  HQ++E+EMVQ
Sbjct  549  FGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVR-HQNIEEEMVQ  607

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR SS+
Sbjct  608  MLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  648



>ref|XP_010999639.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999640.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999641.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=655

 Score =   299 bits (766),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV+++++ GSLSA +HGNR   R +LDWN R+KI  G ARG+A IHS  GA+ 
Sbjct  428  YSKDEKLLVHNYMSAGSLSAFLHGNRAGGRTSLDWNARVKICLGTARGIARIHSEGGAKF  487

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNV+LT DL+GCISD GL PLM F T   R+ GYRAPEVIETRK++QKSDVYS
Sbjct  488  FHGNIKSSNVILTSDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEVIETRKASQKSDVYS  547

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD EL+  HQ++E+EMVQ
Sbjct  548  FGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVR-HQNIEEEMVQ  606

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR SS+
Sbjct  607  MLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  647



>ref|XP_006371316.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
 gb|ERP49113.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
Length=655

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV+++++ GSLSA +HGNR   R +LDWN R+KI  G ARG+A IHS  GA+ 
Sbjct  428  YSKDEKLLVHNYMSAGSLSAFLHGNRAGGRTSLDWNARVKICLGTARGIARIHSEGGAKF  487

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SNVLLT DL+GCISD GL PLM F T   R+ GYRAPEVIETRK++QKSDVYS
Sbjct  488  FHGNIKASNVLLTPDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEVIETRKASQKSDVYS  547

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD EL+  HQ++E+EMVQ
Sbjct  548  FGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVR-HQNIEEEMVQ  606

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR SS+
Sbjct  607  MLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  647



>emb|CDP13882.1| unnamed protein product [Coffea canephora]
Length=639

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMA-LDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV++++  GSLSA +HGNR + +  LDW++R+KI+ GAARG+AHIHS  GAR 
Sbjct  408  YSKDEKLLVHEYMPAGSLSASLHGNRGAGITPLDWDSRMKISLGAARGIAHIHSDGGARF  467

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNVLL ++ +GCI+DFGL P+M    +  R  GY APEVIETRK+TQKSDVYS
Sbjct  468  SHGNIKSSNVLLNKEQDGCITDFGLNPVMNSLGVKTRGIGYHAPEVIETRKATQKSDVYS  527

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK+P+ S+  ++V+DLP+WV+SVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  528  FGVLLLEMLTGKSPIHSSGHDDVIDLPRWVRSVVREEWTAEVFDVELMKY-QNVEEEMVQ  586

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +LQ+A++CV K P+MRP MDEVVR++E+IRQ + +NRPSSEDN+
Sbjct  587  MLQIALSCVAKAPDMRPSMDEVVRLMEDIRQSELENRPSSEDNR  630



>ref|XP_009798129.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798130.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798131.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=625

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VY + + GSLS L+HG+R S R  LDW +R+KI+ GAARG+AHIHSV G + 
Sbjct  404  YSKDEKLMVYGYFSSGSLSMLLHGSRTSGRTPLDWESRVKISLGAARGIAHIHSVGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLL QDL  C+SDFGL P+M F   P R  GYRAPEVIETRK + KSDVYS
Sbjct  464  AHGNIKSSNVLLKQDLEACVSDFGLAPIMNFPAAPTRYPGYRAPEVIETRKHSHKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK P+QS  ++++VDLP+WVQSV++EEWT+EVFD +L+ + Q++E+EMVQ
Sbjct  524  FGVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVLKEEWTSEVFDVDLMRF-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+AMACV KVP+MRP M+EVV+MIEE+RQ D +NR SSE
Sbjct  583  MLQIAMACVAKVPDMRPNMEEVVKMIEEVRQSDSENRQSSE  623



>ref|XP_006435961.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486131.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486132.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR49201.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=627

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VY ++  GSL  L+H NR +   ALDWN+R+KIA G ARG+A IHS  GA+ 
Sbjct  400  YSKDEKLVVYSYMPAGSLFMLLHRNRSDGGTALDWNSRMKIALGTARGIAFIHSEGGAKF  459

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLTQDLNGCISD GL  L+ F T   R+ GYRAPEV ETRK++QKSDVYS
Sbjct  460  THGNIKSSNVLLTQDLNGCISDVGLAHLINFPTTATRTIGYRAPEVTETRKASQKSDVYS  519

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q +  ++VVDLP+WV+SVVREEWTAEVFD EL+ Y Q +E+EMVQ
Sbjct  520  FGVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVELLKY-QDVEEEMVQ  578

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSS  182
            +LQ+A++CV KVP+ RPKMD+VVRMIE+I+QP+  NR SS
Sbjct  579  MLQIALSCVAKVPDSRPKMDDVVRMIEQIQQPELKNRASS  618



>ref|XP_006435960.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486130.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR49200.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=638

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VY ++  GSL  L+H NR +   ALDWN+R+KIA G ARG+A IHS  GA+ 
Sbjct  411  YSKDEKLVVYSYMPAGSLFMLLHRNRSDGGTALDWNSRMKIALGTARGIAFIHSEGGAKF  470

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLTQDLNGCISD GL  L+ F T   R+ GYRAPEV ETRK++QKSDVYS
Sbjct  471  THGNIKSSNVLLTQDLNGCISDVGLAHLINFPTTATRTIGYRAPEVTETRKASQKSDVYS  530

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q +  ++VVDLP+WV+SVVREEWTAEVFD EL+ Y Q +E+EMVQ
Sbjct  531  FGVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVELLKY-QDVEEEMVQ  589

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSS  182
            +LQ+A++CV KVP+ RPKMD+VVRMIE+I+QP+  NR SS
Sbjct  590  MLQIALSCVAKVPDSRPKMDDVVRMIEQIQQPELKNRASS  629



>gb|KDO67579.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
 gb|KDO67580.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
Length=627

 Score =   294 bits (752),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VY ++  GSL  L+H NR +   ALDWN+R+KIA G ARG+A IHS  GA+ 
Sbjct  400  YSKDEKLVVYSYMPAGSLFMLLHRNRSDGGTALDWNSRMKIALGTARGIAFIHSEGGAKF  459

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLLTQDLNGCISD GL  L+ F T   R+ GYRAPEV ETRK++QKSDVYS
Sbjct  460  THGNIKSSNVLLTQDLNGCISDVGLAHLINFPTTATRTIGYRAPEVTETRKASQKSDVYS  519

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+Q +  ++VVDLP+WV+SVVREEWTAEVFD EL+ Y Q +E+EMVQ
Sbjct  520  FGVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVELLKY-QDVEEEMVQ  578

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSS  182
            +LQ+A++CV KVP+ RPKMD+VVRMIE+I+QP+  NR SS
Sbjct  579  MLQIALSCVAKVPDSRPKMDDVVRMIEQIQQPELRNRASS  618



>gb|KJB71491.1| hypothetical protein B456_011G125200 [Gossypium raimondii]
Length=628

 Score =   293 bits (751),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 182/222 (82%), Gaps = 3/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMAL-DWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GS S+L+HG+RES   L DW+TRLKI  GAA+G+ H+H+  G + 
Sbjct  404  YSKDEKLLVYDYIPAGSFSSLLHGSRESGRPLPDWDTRLKICLGAAKGITHLHASGGGKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK SNVLLTQDL+GCISDFGLT LM   T+P R+ GYRAPE IETRK TQKSDVYS
Sbjct  464  VHGNIKPSNVLLTQDLHGCISDFGLTSLMSSPTVPSRAVGYRAPEAIETRKFTQKSDVYS  523

Query  481  lgvlllelLTGKAP-VQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKA  VQ++  E+VVDLP+WVQSVVREEWTAEVFD EL+ Y+  +E+E+V
Sbjct  524  FGVLLLEMLTGKAAVVQTSGHEDVVDLPRWVQSVVREEWTAEVFDIELMKYND-IEEELV  582

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            Q+LQ+AMACV ++P++RP M+EV R IEEIR  D +NRPSS+
Sbjct  583  QMLQIAMACVARLPDVRPSMEEVTRTIEEIRSSDSENRPSSD  624



>ref|XP_009607078.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=625

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VY + +RGSLS L+HG+R S R  LDW +R+KI+ GAARG+AHIHSV G + 
Sbjct  404  YSKDEKLMVYGYFSRGSLSMLLHGSRTSGRTPLDWESRVKISLGAARGIAHIHSVGGPKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLL QDL  CISDFGL P+M F   P R  GYRAPEVIETRK + KSDVYS
Sbjct  464  AHGNIKSSNVLLKQDLEACISDFGLAPIMNFPVAPTRYPGYRAPEVIETRKHSHKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK P+QS  ++++VDLP+WVQSV++EEWT+EVFD +L+ + Q++E+EMVQ
Sbjct  524  FGVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVLKEEWTSEVFDVDLMRF-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+AMACV KV +MRP M+EVV+MI+E+RQ D +NR SSE
Sbjct  583  MLQIAMACVAKVADMRPNMEEVVKMIKEVRQSDSENRQSSE  623



>emb|CDY58565.1| BnaC03g12450D [Brassica napus]
Length=653

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 186/224 (83%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+ + G+LS+L+HGNR S R +LDW +R+KI   AA+GVAH+H V G + 
Sbjct  419  YSKDEKLLVYDYYSSGNLSSLLHGNRGSGRESLDWESRVKITLAAAKGVAHLHEVGGPKF  478

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIK+SNV++ Q+ + C+SDFGL+PLM     P R AGYRAPEVI TRK T KSDVYS
Sbjct  479  SHGNIKASNVIMKQENDVCVSDFGLSPLMSVPIAPMRGAGYRAPEVIVTRKHTHKSDVYS  538

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQSA++E++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  539  FGVLILEMLTGKSPVQSASREDMVDLPRWVQSVVREEWTSEVFDVELMKF-QNIEEEMVQ  597

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPD-FDNRPSSEDN  173
            +LQ+AMACV  VPE+RP MDEVVRMIEEIR  D  + RPSS+DN
Sbjct  598  MLQIAMACVAHVPEVRPSMDEVVRMIEEIRVSDSSETRPSSDDN  641



>ref|XP_008788112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=636

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 182/223 (82%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GS S L+HGN+ + R  LDW++R+KI+ GAARG+AHIH+  G + 
Sbjct  405  YSKDEKLLVYDYVPSGSFSTLLHGNKGAGRTPLDWDSRVKISLGAARGMAHIHTEGGGKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPEVIETRKSTQKSDVY  485
             HGNIK+SNVLLTQDL  CISDFGL PLM     P R   GYRAPEVIETRK TQKSDVY
Sbjct  465  AHGNIKASNVLLTQDLEACISDFGLAPLMNTHATPSRVVVGYRAPEVIETRKYTQKSDVY  524

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKAP+QS  +++V DLP+WVQSVVREEWTAEVFD EL+ Y +++E+EMV
Sbjct  525  SFGVLLLEMLTGKAPLQSPGRDDVADLPRWVQSVVREEWTAEVFDVELMRY-RNIEEEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            Q+LQ+AMACV + P+ RP+M+EV+RMI+E+R  D +NR SSE+
Sbjct  584  QMLQIAMACVARAPDQRPRMEEVIRMIDEVRHSDSENRASSEE  626



>ref|XP_006280146.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
 gb|EOA13044.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
Length=658

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 187/224 (83%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+   G+LSAL+HG   S +M LDW++RLKI   AA+G+AH+H+V G + 
Sbjct  422  YSKDEKLMVYDYYPAGNLSALLHGKPGSEKMPLDWDSRLKITLSAAKGIAHLHAVGGPKF  481

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNV++ QD +GCISDFGL+PLM     P R AGYRAPEVIETRK T KSD+YS
Sbjct  482  SHGNIKSSNVIMKQDSDGCISDFGLSPLMAVPIAPMRGAGYRAPEVIETRKHTHKSDIYS  541

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQS +++++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  542  FGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRF-QNIEEEMVQ  600

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFD-NRPSSEDN  173
            +LQ+AMACV ++PE+RP MD++VRMIEEIR  D +  RPSS+DN
Sbjct  601  MLQIAMACVAQMPEVRPTMDDIVRMIEEIRVSDSETTRPSSDDN  644



>ref|XP_009384331.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384332.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384333.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384334.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384335.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   291 bits (746),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 185/225 (82%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLL+YD+VT G+ S+L+HG++ + +  LDW +R+KI+ GAARGVAHIH+  G + 
Sbjct  403  YSKDEKLLIYDYVTSGNFSSLLHGSKGAGKTPLDWESRVKISLGAARGVAHIHAEGGGKF  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPR-SAGYRAPEVIETRKSTQKSDVY  485
             HG+IKS+NVLLTQ+L+ C++D+GL P M   T   R   GYRAPEVIETRK TQKSDVY
Sbjct  463  IHGDIKSNNVLLTQELDACVADYGLAPFMSSATTSSRIVVGYRAPEVIETRKYTQKSDVY  522

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD EL+  HQ +E+EMV
Sbjct  523  SFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMR-HQHIEEEMV  581

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQ+AMACV K P+ RPKM+E++RMIE+IR  D +NRPSSE +K
Sbjct  582  QMLQIAMACVAKSPDQRPKMEELIRMIEDIRHSDSENRPSSEKSK  626



>dbj|BAH57151.1| AT3G08680 [Arabidopsis thaliana]
Length=256

 Score =   280 bits (715),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 172/225 (76%), Gaps = 6/225 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HGN E  R ALDW TRL+I   AARG++HIHS  GA+L
Sbjct  21   FSKDEKLLVYDYYQGGNFSMLLHGNNEGGRAALDWETRLRICLEAARGISHIHSASGAKL  80

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQ+L+ C+SDFG+ PLM   T IP RS GYRAPE IETRK TQKSDVY
Sbjct  81   LHGNIKSPNVLLTQELHVCVSDFGIAPLMSHHTLIPSRSLGYRAPEAIETRKHTQKSDVY  140

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  141  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  200

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFDNRPSS  182
            Q+LQ+AMACV K P+ RP M+EVV M+EEIR     P   NR SS
Sbjct  201  QMLQIAMACVSKHPDSRPSMEEVVNMMEEIRPSGSGPGSGNRASS  245



>ref|XP_009132067.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=650

 Score =   291 bits (746),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 185/224 (83%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+ + G+LS+L+HGNR S R  LDW +R+KI   AA+GVAH+H V G++ 
Sbjct  416  YSKDEKLLVYDYYSAGNLSSLLHGNRGSGREPLDWESRVKITLAAAKGVAHLHEVGGSKF  475

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNV++ Q+ + C+SDFGL+PLM     P R AGYRAPEVI TRK T KSDVYS
Sbjct  476  SHGNIKSSNVIMKQENDVCVSDFGLSPLMSVPIAPMRGAGYRAPEVIVTRKHTHKSDVYS  535

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  536  FGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKF-QNIEEEMVQ  594

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPD-FDNRPSSEDN  173
            +LQ+AMACV  VPE+RP MDEVVRMIEEIR  D  + RPSS+DN
Sbjct  595  MLQIAMACVAHVPEVRPSMDEVVRMIEEIRVSDSSETRPSSDDN  638



>ref|XP_010443551.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443552.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443553.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=661

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 188/224 (84%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+   G+LS+L+HGNR S ++ +DW++R+KI   AA+G+AH+H+V G + 
Sbjct  425  YSKDEKLMVYDYYPAGNLSSLLHGNRGSEKVPVDWDSRIKITLSAAKGIAHLHAVGGPKF  484

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEVIETRK T KSDVYS
Sbjct  485  SHGNIKSSNVIMKQETDACISDFGLTPLMAVPIAPMRGAGYRAPEVIETRKHTHKSDVYS  544

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+P+QS +++++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  545  FGVLILEMLTGKSPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRF-QNIEEEMVQ  603

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFD-NRPSSEDN  173
            +LQ+AMACV ++PE+RP MD+VVRMIEEIR  D +  RPSS+DN
Sbjct  604  MLQIAMACVAQMPEVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  647



>ref|XP_010483401.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483402.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483407.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483408.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 188/224 (84%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+   G+LS+L+HGNR S ++ LDW++R+KI   AA+G+AH+H+V G + 
Sbjct  420  YSKDEKLMVYDYYPAGNLSSLLHGNRGSEKVPLDWDSRIKITLSAAKGIAHLHAVGGPKF  479

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEVIETRK T K+DVYS
Sbjct  480  SHGNIKSSNVIMKQETDACISDFGLTPLMAVPIAPMRGAGYRAPEVIETRKHTHKTDVYS  539

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+P+QS +++++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  540  FGVLILEMLTGKSPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRF-QNIEEEMVQ  598

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFD-NRPSSEDN  173
            +LQ+AMACV ++P++RP MD+VVRMIEEIR  D +  RPSS+DN
Sbjct  599  MLQIAMACVAQMPDVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  642



>ref|XP_010541472.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010541473.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
Length=628

 Score =   289 bits (740),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 184/223 (83%), Gaps = 4/223 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   G+LS+L+HG+R   R  L W++R+KI+   A+G+AH+H+V G + 
Sbjct  402  YSKDEKLLVYDYYPAGNLSSLLHGSRGGERTPLHWDSRVKISLATAKGIAHLHAVGGPKF  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVL+ Q+ +GCISD GLT LM   T   R+AGYRAPEV ETRK T KSDVYS
Sbjct  462  AHGNIKSSNVLINQETDGCISDSGLTSLMAMPTT--RAAGYRAPEVTETRKQTHKSDVYS  519

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS +++++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  520  FGVLLLEMLTGKAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRF-QNIEEEMVQ  578

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            +LQVAMACV ++P+MRP MD+VVRMIEEIR  D DNRPSSEDN
Sbjct  579  MLQVAMACVARLPDMRPDMDQVVRMIEEIRLSDSDNRPSSEDN  621



>ref|XP_010323112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=627

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY + + G+LS L+HGNR   R  LDW +R+KI+  AA+G+AHIHS+ G + 
Sbjct  406  YSKDEKLLVYGYFSMGNLSMLLHGNRTPGRTPLDWESRVKISLAAAKGIAHIHSMGGPKF  465

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL QD+  CISDFGL P+M F   P R  GYRAPEVIE+RK + KSDVYS
Sbjct  466  THGNIKSSNVLLKQDMEACISDFGLAPIMNFPAAPSRYPGYRAPEVIESRKHSHKSDVYS  525

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK P+QS  ++++VDLP+WVQSVVREEWT+EVFD +L+ + Q++E+EMVQ
Sbjct  526  FGVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVVREEWTSEVFDVDLMRF-QNIEEEMVQ  584

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+AMACV KVP+MRP M+EVVRMIE++RQ + +NR SSE
Sbjct  585  MLQIAMACVVKVPDMRPNMEEVVRMIEDVRQSNSENRHSSE  625



>ref|XP_010541471.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Tarenaya hassleriana]
Length=652

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 184/223 (83%), Gaps = 4/223 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   G+LS+L+HG+R   R  L W++R+KI+   A+G+AH+H+V G + 
Sbjct  426  YSKDEKLLVYDYYPAGNLSSLLHGSRGGERTPLHWDSRVKISLATAKGIAHLHAVGGPKF  485

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVL+ Q+ +GCISD GLT LM   T   R+AGYRAPEV ETRK T KSDVYS
Sbjct  486  AHGNIKSSNVLINQETDGCISDSGLTSLMAMPTT--RAAGYRAPEVTETRKQTHKSDVYS  543

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKAP+QS +++++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  544  FGVLLLEMLTGKAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRF-QNIEEEMVQ  602

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            +LQVAMACV ++P+MRP MD+VVRMIEEIR  D DNRPSSEDN
Sbjct  603  MLQVAMACVARLPDMRPDMDQVVRMIEEIRLSDSDNRPSSEDN  645



>ref|XP_012091108.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012091109.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012091110.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012091111.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012091112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 gb|KDP21623.1| hypothetical protein JCGZ_03294 [Jatropha curcas]
Length=632

 Score =   288 bits (738),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 180/221 (81%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY+++  GS SAL+H NR + R ALDWN R+KI  GAARG+AHIHS+ G + 
Sbjct  405  YSKDEKLLVYNYMRTGSFSALLHSNRGTGRNALDWNARVKICLGAARGIAHIHSLGGVKC  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGN+K+SNVLLT DL+G +SD GLTPLM F     R+ GYRAPEVIET+K  QKSDV+S
Sbjct  465  VHGNVKASNVLLTPDLDGLMSDVGLTPLMNFPATISRTIGYRAPEVIETQKLNQKSDVFS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGKAP+Q+  +++VVDLP+WV+SVVREEWTAEVFD EL+ Y Q++EDEMVQ
Sbjct  525  FGVVLLEMLTGKAPLQAPGRDDVVDLPRWVRSVVREEWTAEVFDVELMKY-QNIEDEMVQ  583

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K P+MRP MDEVVRM+E I+  +  N PSSE
Sbjct  584  MLQIALACVAKAPDMRPTMDEVVRMMEGIQHSESKNLPSSE  624



>gb|EYU36892.1| hypothetical protein MIMGU_mgv1a0177021mg, partial [Erythranthe 
guttata]
Length=208

 Score =   275 bits (703),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = -3

Query  754  RMALDWNTRLKIAGGAARGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLM  575
            R  LDW +R+KI+ GAA+G+AH HS  GA+ THGNIKSSNVLL QDL GC+SDFGL PLM
Sbjct  6    RTPLDWESRVKISLGAAKGIAHAHSAGGAKFTHGNIKSSNVLLNQDLEGCVSDFGLAPLM  65

Query  574  GFTTIPPRSAGYRAPEVIETRKSTQKSDVYSlgvlllelLTGKAPVQSAAQEEVVDLPKW  395
                   RSAGYRAPEV+ETRK T KSDVYS GV+LLE+LTGK P  S A+++++DLP+W
Sbjct  66   NHPATTSRSAGYRAPEVVETRKHTHKSDVYSFGVILLEMLTGKQPTSSPARDDIIDLPRW  125

Query  394  VQSVVREEWTAEVFDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEI  215
            VQSVVREEWTAEVFD EL+ + Q++E+EMVQ+LQ+AMACV K P+MRP MDEVVRMIEE+
Sbjct  126  VQSVVREEWTAEVFDVELMRF-QNIEEEMVQMLQIAMACVAKAPDMRPNMDEVVRMIEEV  184

Query  214  RQPDFDNRPSSEDNK  170
            RQ D +NRPSS++NK
Sbjct  185  RQSDSENRPSSDENK  199



>ref|XP_010453493.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453499.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453515.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   289 bits (739),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 188/224 (84%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+V+D+   G+LS+L+HGNR S ++ LDW++R+KI   AA+G+AH+H+V G + 
Sbjct  420  YSKDEKLMVFDYYPAGNLSSLLHGNRGSEKVPLDWDSRIKITISAAKGIAHLHAVGGPKF  479

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEVIETRK T KSDVYS
Sbjct  480  SHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGAGYRAPEVIETRKHTHKSDVYS  539

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+P+QS ++E++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  540  FGVLILEMLTGKSPIQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMRF-QNIEEEMVQ  598

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFD-NRPSSEDN  173
            +LQ+A+ACV ++P++RP MD+VVRMIEEIR  D +  RPSS+DN
Sbjct  599  MLQIAIACVAQMPDVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  642



>ref|XP_010043603.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW88397.1| hypothetical protein EUGRSUZ_A00785 [Eucalyptus grandis]
Length=613

 Score =   288 bits (736),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 180/219 (82%), Gaps = 3/219 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            YSKDEKLL+YD++T G+ S L+H     R ALDW +R+KI+ G A+G+AHIHS  G R  
Sbjct  398  YSKDEKLLIYDYITGGNFSLLLH--EGGRQALDWASRVKISLGVAKGIAHIHSAGGGRFI  455

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYSl  479
            HGNIKSSNVLLTQDL GCIS+FGLTPL+    +PPRSAGYRAPEV++TRK TQKSD+YS 
Sbjct  456  HGNIKSSNVLLTQDLQGCISEFGLTPLIRTPAVPPRSAGYRAPEVMKTRKPTQKSDIYSF  515

Query  478  gvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQL  299
            GVLLLE+LTGK+P+QS  +E+V DLP+WVQSVVREEWTAEVFD EL+    ++E+E+V++
Sbjct  516  GVLLLEMLTGKSPIQSPRREDVFDLPRWVQSVVREEWTAEVFDEELLR-DGNIEEELVEM  574

Query  298  LQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSS  182
            L++A+ACV ++P+ RP MDEVVRMIEE+R  D +N PSS
Sbjct  575  LKIALACVDRMPDGRPTMDEVVRMIEEVRPSDSENPPSS  613



>emb|CDP06375.1| unnamed protein product [Coffea canephora]
Length=667

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 186/231 (81%), Gaps = 14/231 (6%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR---ESRMALDWNTRLKIAGGAARGVAHIHSVPGA  668
            YSKDEKLLVYDFV  GSLS L+HGNR   + R  LDW +R+KI+ GAARG+AHIH V G 
Sbjct  441  YSKDEKLLVYDFVPSGSLSTLLHGNRSEPDGRRRLDWKSRVKISLGAARGIAHIHCVAGR  500

Query  667  RLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDV  488
            +L+HGNIKSSNVLLTQDL+GC SDFG+TP++G   +P RS+GYRAPEV ETRK TQ SDV
Sbjct  501  KLSHGNIKSSNVLLTQDLSGCASDFGVTPIVG---LPRRSSGYRAPEVSETRKYTQMSDV  557

Query  487  YSlgvlllelLTGKAPVQSAA-------QEEVVDLPKWVQSVVREEWTAEVFDAELINYH  329
            YS GV+LLELLTGKAPV   A       Q+ VVDLP+WVQSV REEWTAEVFDA+L+  +
Sbjct  558  YSFGVVLLELLTGKAPVVQPAGQGQGQGQDGVVDLPRWVQSVAREEWTAEVFDAQLVK-N  616

Query  328  QSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
              +EDEMVQ+LQ+AMACV + P+MRP M++VVRMI+EIRQPD  NRP+S D
Sbjct  617  PDIEDEMVQMLQIAMACVARTPDMRPNMEQVVRMIQEIRQPDPGNRPTSAD  667



>ref|XP_010031063.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031064.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031065.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031066.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW50323.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=633

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 179/220 (81%), Gaps = 2/220 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSL   +HG++ S R  LDWN+R+KI+ G A+ +AHIHS PGA+ 
Sbjct  406  YSKDEKLLVYDYMPYGSLFVHLHGDKGSGRTPLDWNSRMKISLGTAKAIAHIHSEPGAKC  465

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKS NV LTQD +GC+SD GLTPLM  + I PR  GY APEVIE+RK TQKSDVYS
Sbjct  466  VHGNIKSLNVFLTQDHDGCVSDVGLTPLMNLSAITPRVIGYYAPEVIESRKVTQKSDVYS  525

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK P++    ++V+DLP+WV+SVVREEWTAEVFD EL+ Y +++E+EMVQ
Sbjct  526  FGVLLLEMLTGKTPLKHPGLDDVIDLPRWVRSVVREEWTAEVFDVELLKY-ENVEEEMVQ  584

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSS  182
            +LQ+A+ CV KVP+MRPKMDEV R+I+E+R+P+  +RPSS
Sbjct  585  MLQIALTCVTKVPDMRPKMDEVARLIDEVREPEAKDRPSS  624



>ref|XP_010463311.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Camelina sativa]
Length=637

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 174/227 (77%), Gaps = 6/227 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HGN E  R ALDW TRL+I  GAARG++HIHS  GA+L
Sbjct  402  FSKDEKLLVYDYYQGGNFSMLLHGNNEGGRAALDWETRLRICLGAARGISHIHSAAGAKL  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQDL+ C+SDFG+ PLM   T IP RS GYRAPE IETRK TQKSDVY
Sbjct  462  LHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLIPSRSLGYRAPEAIETRKHTQKSDVY  521

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  522  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  581

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFDNRPSSED  176
            Q+LQ+AMACV K P+ RP M+EVV MIEEIR     P   NR SS +
Sbjct  582  QMLQIAMACVSKHPDTRPSMEEVVNMIEEIRPTGSGPGSGNRASSPE  628



>ref|XP_006297193.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 ref|XP_006297194.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30091.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30092.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
Length=633

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 174/227 (77%), Gaps = 6/227 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HGN E  R ALDW TRL+I  GAARG++HIHS  GA+L
Sbjct  398  FSKDEKLLVYDYYQGGNFSMLLHGNNEGGRAALDWETRLRICLGAARGISHIHSAAGAKL  457

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQDL+ C+SDFG+ PLM   T IP RS GYRAPE IETRK TQKSDVY
Sbjct  458  LHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLIPSRSLGYRAPETIETRKHTQKSDVY  517

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  518  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  577

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ----PDFDNRPSSED  176
            Q+LQ+AMACV K P+ RP M+EVV M+EEIR     P   NR SS +
Sbjct  578  QMLQIAMACVSKHPDTRPSMEEVVNMMEEIRPSGSGPGSGNRASSPE  624



>ref|XP_009406050.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406051.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406052.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 179/222 (81%), Gaps = 2/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   G+ S L+HG + + R  LDW+TR+KI+ G ARG+AH+HS  G + 
Sbjct  401  YSKDEKLLVYDYAPSGTFSTLLHGGKGAGRTPLDWDTRVKISLGVARGIAHLHSQGGGKF  460

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLLTQ+L+ C+S+FGL PLM     P R  GYRAPEVIE RKSTQKSDVYS
Sbjct  461  IHGNIKSSNVLLTQELDACVSEFGLAPLMSSAATPSRVVGYRAPEVIEHRKSTQKSDVYS  520

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV LLELLTGK+P QS  +++VVDLP+WVQSVVREEWTAEVFD EL+ Y  ++E++MVQ
Sbjct  521  FGVFLLELLTGKSPFQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRY-PNIEEDMVQ  579

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            +LQVAM CV +V E RPKM++VVRMIE++++ + +NRPSSED
Sbjct  580  MLQVAMQCVVRVAEQRPKMEDVVRMIEDVQRSNSENRPSSED  621



>gb|KJB67957.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67958.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67959.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
Length=609

 Score =   285 bits (730),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 177/221 (80%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY+++  GSL AL+HGNR S R  LDW+TR+KIA G ARG+A+IH+  G + 
Sbjct  382  YSKDEKLLVYNYMPAGSLFALLHGNRTSDRTPLDWDTRMKIALGTARGIANIHTEGGGKF  441

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL+ +L  C+SD GLTPLM       R  GYRAPEVIETRK TQKSDVYS
Sbjct  442  THGNIKSSNVLLSDELEACVSDAGLTPLMNAPLTTSRIVGYRAPEVIETRKITQKSDVYS  501

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LT KAP+Q + Q++VVDLP+WV+SVVREEWTAEVFD EL+ + Q+ ++EMVQ
Sbjct  502  FGVLLLEMLTAKAPLQPSGQDDVVDLPRWVRSVVREEWTAEVFDVELLRF-QTFQEEMVQ  560

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ CV K P+MRP MDE +RMIE++RQ +  NR SSE
Sbjct  561  MLQIALTCVAKTPDMRPTMDEAIRMIEDVRQSESKNRTSSE  601



>gb|KHF99691.1| hypothetical protein F383_18108 [Gossypium arboreum]
Length=609

 Score =   285 bits (730),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 177/221 (80%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY+++  GSL AL+HGNR S R  LDW+TR+KIA G ARG+A+IH+  G + 
Sbjct  382  YSKDEKLLVYNYMPAGSLFALLHGNRTSERTPLDWDTRMKIALGTARGIANIHTEGGGKF  441

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSNVLL+ +L  C+SD GLTPLM       R  GYRAPEVIETRK TQKSDVYS
Sbjct  442  THGNIKSSNVLLSDELEACVSDVGLTPLMNAPLSTSRIVGYRAPEVIETRKITQKSDVYS  501

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LT KAP+Q + Q++VVDLP+WV+SVVREEWTAEVFD EL+ + Q+ ++EMVQ
Sbjct  502  FGVLLLEMLTAKAPLQPSGQDDVVDLPRWVRSVVREEWTAEVFDVELLRF-QTFQEEMVQ  560

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ CV K P+MRP MDE +RMIE++RQ +  NR SSE
Sbjct  561  MLQIALTCVAKTPDMRPTMDEAIRMIEDVRQSESKNRTSSE  601



>ref|XP_002864562.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40821.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score =   286 bits (733),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 186/224 (83%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+V D+   G+LS+L+HGNR S +  LDW++R+KI   AA+G+AH+H+V G + 
Sbjct  422  YSKDEKLMVCDYYPAGNLSSLLHGNRGSEKTPLDWDSRVKITLSAAKGIAHLHAVGGPKF  481

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEV+ETRK T KSDVYS
Sbjct  482  SHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGAGYRAPEVMETRKHTHKSDVYS  541

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQS +++++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  542  FGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRF-QNIEEEMVQ  600

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFD-NRPSSEDN  173
            +LQ+AMACV ++PE+RP MD+VVRMIEEIR  D +  RPSS+DN
Sbjct  601  MLQIAMACVAQMPEVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  644



>ref|XP_010670041.1| PREDICTED: probable inactive receptor kinase At5g58300 [Beta 
vulgaris subsp. vulgaris]
Length=635

 Score =   286 bits (731),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGN-RESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYDF+  GSLSA++HG+    +  LDWN+R+ IA GAARG+ HIHS  G + 
Sbjct  401  FSKDEKLLVYDFIPGGSLSAVLHGHGYNGKTPLDWNSRIAIALGAARGILHIHSEAGGKF  460

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLL+QD  GCISDFGL  LM F  I  RS GY APEVIE RK++QKSDVYS
Sbjct  461  IHGNIKSSNVLLSQDYEGCISDFGLPLLMNFQGITSRSIGYHAPEVIEVRKASQKSDVYS  520

Query  481  lgvlllelLTGKAPVQSA-AQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++++    +V+DLP+WVQSVVREEWT+EVFDAEL+    + E+EMV
Sbjct  521  FGVLLLEILTGKAPLKTSHGHNDVIDLPRWVQSVVREEWTSEVFDAELLRCPNA-EEEMV  579

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
             +LQ+A+ACV +VP+MRPKMD+VVRMIEEIR  + + RPSS++NK
Sbjct  580  HMLQIALACVARVPDMRPKMDDVVRMIEEIRPSESEERPSSDENK  624



>ref|NP_200638.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_001119458.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9LVM0.1|Y5830_ARATH RecName: Full=Probable inactive receptor kinase At5g58300; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAA96921.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL57654.1| unknown protein [Arabidopsis thaliana]
 gb|AAN64529.1| At5g58299/At5g58299 [Arabidopsis thaliana]
 gb|ACN59396.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97030.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AED97031.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=654

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 185/224 (83%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+V D+   G+LS+L+HGNR S +  LDW++R+KI   AA+G+AH+H+  G + 
Sbjct  422  YSKDEKLMVCDYYPAGNLSSLLHGNRGSEKTPLDWDSRVKITLSAAKGIAHLHAAGGPKF  481

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEV+ETRK T KSDVYS
Sbjct  482  SHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGAGYRAPEVMETRKHTHKSDVYS  541

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQS +++++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  542  FGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDIELMRF-QNIEEEMVQ  600

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFD-NRPSSEDN  173
            +LQ+AMACV +VPE+RP MD+VVRMIEEIR  D +  RPSS+DN
Sbjct  601  MLQIAMACVAQVPEVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  644



>ref|XP_007011392.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20202.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 176/221 (80%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY ++  GSL +L+HGNR + R  LDW++R+KIA G ARG+AHIH+  G + 
Sbjct  412  YSKDEKLLVYSYMPAGSLFSLLHGNRSAGRTPLDWDSRMKIALGTARGIAHIHTEGGGKC  471

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKSSN+LL+ +L GC+SD GL PLM       R  GYRAPEVI+TRK TQKSDVYS
Sbjct  472  THGNIKSSNILLSDELEGCVSDVGLAPLMNAPVTMSRIMGYRAPEVIQTRKVTQKSDVYS  531

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LT KAP+Q +  +EVVDLP+WV+SVVREEWTAEVFD EL+ + Q  ++EMVQ
Sbjct  532  FGVLLLEMLTAKAPLQPSGHDEVVDLPRWVRSVVREEWTAEVFDVELLRF-QHFQEEMVQ  590

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K  E RPKMDE+VRMIE+IRQP+  NR SSE
Sbjct  591  MLQIALACVAKTTETRPKMDEIVRMIEDIRQPESKNRTSSE  631



>gb|KCW50324.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
 gb|KCW50325.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=630

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 177/219 (81%), Gaps = 3/219 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            YSKDEKLLVYD++  GSL   +HG+   R  LDWN+R+KI+ G A+ +AHIHS PGA+  
Sbjct  406  YSKDEKLLVYDYMPYGSLFVHLHGS--GRTPLDWNSRMKISLGTAKAIAHIHSEPGAKCV  463

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYSl  479
            HGNIKS NV LTQD +GC+SD GLTPLM  + I PR  GY APEVIE+RK TQKSDVYS 
Sbjct  464  HGNIKSLNVFLTQDHDGCVSDVGLTPLMNLSAITPRVIGYYAPEVIESRKVTQKSDVYSF  523

Query  478  gvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQL  299
            GVLLLE+LTGK P++    ++V+DLP+WV+SVVREEWTAEVFD EL+ Y +++E+EMVQ+
Sbjct  524  GVLLLEMLTGKTPLKHPGLDDVIDLPRWVRSVVREEWTAEVFDVELLKY-ENVEEEMVQM  582

Query  298  LQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSS  182
            LQ+A+ CV KVP+MRPKMDEV R+I+E+R+P+  +RPSS
Sbjct  583  LQIALTCVTKVPDMRPKMDEVARLIDEVREPEAKDRPSS  621



>ref|XP_011622690.1| PREDICTED: probable inactive receptor kinase At5g58300 [Amborella 
trichopoda]
Length=646

 Score =   284 bits (726),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 188/233 (81%), Gaps = 12/233 (5%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHS-VPGAR  665
            YSKDEKLLVYD+V  G+LS L+HGNR + R  LDW+TR++IA GAARG+AH+HS + G +
Sbjct  407  YSKDEKLLVYDYVPTGNLSTLLHGNRGAERTPLDWDTRVRIALGAARGIAHLHSDIGGGK  466

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP---PRSAGYRAPEVIETRKSTQKS  494
             THGNIKSSN+LLT +L   +SDFGL PLM     P   PR+ GYRAPE +ETR++TQKS
Sbjct  467  FTHGNIKSSNILLTPELEPLVSDFGLAPLMS-PPAPGPHPRAPGYRAPETLETRRATQKS  525

Query  493  DVYSlgvlllelLTGKAPVQSA-----AQEEVVDLPKWVQSVVREEWTAEVFDAELINYH  329
            DVYS GVLLLELLTGK+P Q+        E++ DLP+WVQSVVREEWTAEVFD EL+ Y 
Sbjct  526  DVYSFGVLLLELLTGKSPAQAHQAQAQGSEDIADLPRWVQSVVREEWTAEVFDVELMRY-  584

Query  328  QSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q++E+EMVQ+LQVAMACV +VP++RPKM EVV+M+E+++Q D +NRPSSEDN+
Sbjct  585  QNIEEEMVQMLQVAMACVARVPDLRPKMSEVVKMVEDVKQSDSENRPSSEDNR  637



>ref|XP_010464477.1| PREDICTED: probable inactive receptor kinase At3g08680 [Camelina 
sativa]
Length=638

 Score =   283 bits (725),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 174/227 (77%), Gaps = 6/227 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HG+ E  R ALDW TRL+I  GAARG++HIHS  GA+L
Sbjct  403  FSKDEKLLVYDYYQGGNFSMLLHGHNEGGRAALDWETRLRICLGAARGISHIHSAAGAKL  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQDL+ C+SDFG+ PLM   T IP RS GYRAPE IETRK T+KSDVY
Sbjct  463  LHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLIPSRSLGYRAPEAIETRKHTKKSDVY  522

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  523  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  582

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFDNRPSSED  176
            Q+LQ+AMACV K P+ RP M+EVV MIEEIR     P   NR SS +
Sbjct  583  QMLQIAMACVSKHPDTRPSMEEVVNMIEEIRPTGSGPGSGNRASSPE  629



>ref|XP_009146990.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=635

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HGN E  R ALDW  RLKI  GAA+G+AHIHS  GA+L
Sbjct  399  FSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKL  458

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQDLN C+SD+G+ PLM   T +P RS GYRAPE IETRK TQKSDVY
Sbjct  459  LHGNIKSPNVLLTQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVY  518

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  519  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  578

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  212
            Q+LQVAMACV K P+ RP M+EVV M+EE+R
Sbjct  579  QMLQVAMACVSKHPDSRPSMEEVVNMMEEVR  609



>emb|CDY35996.1| BnaA05g29540D [Brassica napus]
Length=635

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HGN E  R ALDW  RLKI  GAA+G+AHIHS  GA+L
Sbjct  399  FSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKL  458

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQDLN C+SD+G+ PLM   T +P RS GYRAPE IETRK TQKSDVY
Sbjct  459  LHGNIKSPNVLLTQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVY  518

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  519  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  578

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  212
            Q+LQVAMACV K P+ RP M+EVV M+EE+R
Sbjct  579  QMLQVAMACVSKHPDSRPSMEEVVNMMEEVR  609



>gb|ACA61611.1| hypothetical protein AP2_E06.2 [Arabidopsis lyrata subsp. petraea]
Length=658

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 185/224 (83%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+V D+   G+LS+L+HGNR S +  LDW++R+KI   AA+G+AH+H+V G + 
Sbjct  422  YSKDEKLMVCDYYPAGNLSSLLHGNRGSEKTPLDWDSRVKITLSAAKGIAHLHAVGGPKF  481

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEV+ETRK T KSDVYS
Sbjct  482  SHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGAGYRAPEVMETRKHTHKSDVYS  541

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQS +++++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  542  FGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRF-QNIEEEMVQ  600

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFD-NRPSSEDN  173
            +LQ+AMACV ++ E+RP MD+VVRMIEEIR  D +  RPSS+DN
Sbjct  601  MLQIAMACVAQMHEVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  644



>ref|XP_006357316.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Solanum 
tuberosum]
Length=592

 Score =   280 bits (717),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 178/210 (85%), Gaps = 3/210 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            YSKDEKLLV +++  GSLS+ ++GN  +R  LDW+TRLK++ GAA+G+AHIHS  G + T
Sbjct  385  YSKDEKLLVCEYIPYGSLSSALYGNGRTR--LDWDTRLKVSLGAAKGIAHIHSEGGVKFT  442

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYSl  479
            HGNIK+SN+LLT+DL+GCISDFGL+PLM +T I  ++AGY APEVIETRK TQKSDVYS 
Sbjct  443  HGNIKASNILLTRDLDGCISDFGLSPLMNYTAIKNKAAGYHAPEVIETRKGTQKSDVYSF  502

Query  478  gvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQL  299
            GVL+LELLTGK+P+     E+VV+LP+WV++VV+EEWTAEVFDAEL+ YH ++++EMV +
Sbjct  503  GVLVLELLTGKSPLPLPRHEDVVNLPRWVRAVVKEEWTAEVFDAELMKYH-NIQEEMVHM  561

Query  298  LQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            LQ+A+ CV KVP+MRP MDEV++MIE+I+ 
Sbjct  562  LQIALLCVAKVPDMRPSMDEVIKMIEQIKH  591



>ref|XP_006587908.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
 gb|KHN29485.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 170/210 (81%), Gaps = 3/210 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ T GS S L+HG  E+ R  LDW+TRLKI  GAARG+AHIHS  G +L
Sbjct  396  YSKDEKLMVYDYSTAGSFSKLLHGTTETGRAPLDWDTRLKIMVGAARGIAHIHSANGRKL  455

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNV+L+ DL GCISDFGLTPL  F     RS GY APEVIE+RKST+KSDVYS
Sbjct  456  VHGNIKSSNVILSIDLQGCISDFGLTPLTNFCA-SSRSPGYGAPEVIESRKSTKKSDVYS  514

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK PVQ +  +EVVDLPKWVQSVVREEWTAEVFD EL+ Y  ++EDE+VQ
Sbjct  515  FGVLLLEMLTGKTPVQYSGHDEVVDLPKWVQSVVREEWTAEVFDLELMRY-PNIEDELVQ  573

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIR  212
            +LQ+AMACV  +P+ RP M+EVV+ IEEIR
Sbjct  574  MLQLAMACVAAMPDTRPSMEEVVKTIEEIR  603



>ref|XP_006407752.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
 gb|ESQ49205.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
Length=639

 Score =   281 bits (719),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 174/228 (76%), Gaps = 7/228 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HG+ E  R ALDW TRL+I  GAARG++HIHS  GA+L
Sbjct  403  FSKDEKLLVYDYYQGGNFSMLLHGSNEGGRAALDWETRLRICLGAARGISHIHSATGAKL  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQDL+ C+SDFG+ PLM   T +P RS GYRAPE IETRK TQKSDVY
Sbjct  463  LHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVY  522

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  523  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  582

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ-----PDFDNRPSSED  176
            Q+LQ+AMACV K P+ RP M+EVV M+EEIR      P   NR SS +
Sbjct  583  QMLQIAMACVSKHPDSRPSMEEVVNMMEEIRPSTGSGPGSANRASSPE  630



>ref|XP_006602721.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_003551618.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
Length=607

 Score =   280 bits (716),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 171/210 (81%), Gaps = 3/210 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ T GS S L+HG  E+ R  LDW+TRLKI  GAARG+AHIHS  G +L
Sbjct  396  YSKDEKLMVYDYSTAGSFSKLLHGTTETGRAPLDWHTRLKIIVGAARGLAHIHSANGKKL  455

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNV+L+ DL GCISDFGLTPL  F     RS GY +PEVIE+RKSTQKSDVYS
Sbjct  456  VHGNIKSSNVILSIDLQGCISDFGLTPLTNFCG-SSRSPGYGSPEVIESRKSTQKSDVYS  514

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK PVQ +  +EVVDLPKWVQSVVREEWTAEVFD EL+ Y  ++EDE+VQ
Sbjct  515  FGVLLLEMLTGKTPVQYSGHDEVVDLPKWVQSVVREEWTAEVFDLELMRY-PNIEDELVQ  573

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIR  212
            +LQ+AMACV  +P++RP M+EVVR IEE+R
Sbjct  574  MLQLAMACVAVMPDVRPSMEEVVRTIEELR  603



>emb|CDY02808.1| BnaC02g10810D [Brassica napus]
Length=421

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 181/224 (81%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            Y+KDEKL+V D+   G+LS+L+HGN    R +LDW++RL+I   AA+GVAH+H V G + 
Sbjct  187  YNKDEKLMVCDYYPGGNLSSLLHGNLGGERRSLDWDSRLRIILAAAKGVAHLHQVGGPKF  246

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSN+++ Q+ + C+SD+GLT LM     P R AGYRAPEVIETRK T KSDVYS
Sbjct  247  SHGNIKSSNMIMKQESDVCVSDYGLTSLMAVPVTPMRGAGYRAPEVIETRKHTHKSDVYS  306

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD EL+   Q++E+EMVQ
Sbjct  307  FGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKV-QNIEEEMVQ  365

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPD-FDNRPSSEDN  173
            +LQ+AMACV +V E+RP MD+VVRMIEEIR  D  + RPSS+DN
Sbjct  366  MLQIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSETRPSSDDN  409



>ref|NP_187480.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_974257.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9C9Y8.1|Y3868_ARATH RecName: Full=Probable inactive receptor kinase At3g08680; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51359.1|AC012562_20 putative protein kinase; 49514-51513 [Arabidopsis thaliana]
 gb|ACN59313.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE74662.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AEE74663.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=640

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 173/227 (76%), Gaps = 6/227 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HGN E  R ALDW TRL+I   AARG++HIHS  GA+L
Sbjct  405  FSKDEKLLVYDYYQGGNFSMLLHGNNEGGRAALDWETRLRICLEAARGISHIHSASGAKL  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQ+L+ C+SDFG+ PLM   T IP RS GYRAPE IETRK TQKSDVY
Sbjct  465  LHGNIKSPNVLLTQELHVCVSDFGIAPLMSHHTLIPSRSLGYRAPEAIETRKHTQKSDVY  524

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  525  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  584

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ----PDFDNRPSSED  176
            Q+LQ+AMACV K P+ RP M+EVV M+EEIR     P   NR SS +
Sbjct  585  QMLQIAMACVSKHPDSRPSMEEVVNMMEEIRPSGSGPGSGNRASSPE  631



>emb|CDY27986.1| BnaC05g43880D [Brassica napus]
Length=631

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 166/211 (79%), Gaps = 2/211 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HGN E  R ALDW  RLKI  GAA+G+AHIHS  GA+L
Sbjct  395  FSKDEKLLVYDYYQGGNFSMLLHGNNEGGRGALDWEQRLKICLGAAKGIAHIHSSSGAKL  454

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLL QDLN C+SD+G+ PLM   T +P RS GYRAPE IETRK TQKSDVY
Sbjct  455  LHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPEAIETRKHTQKSDVY  514

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  515  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  574

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  212
            Q+LQVAMACV K P+ RP M+EVV M+EE+R
Sbjct  575  QMLQVAMACVSKHPDSRPSMEEVVNMMEEVR  605



>ref|XP_009386109.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386110.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386111.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=633

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 181/224 (81%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMA-LDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+   G+LSAL+HG+R++  A LDW++R+KI+ G ARG+AHIH   G +L
Sbjct  402  YSKDEKLLVYDYAPCGNLSALLHGSRDAAKAPLDWDSRVKISLGVARGIAHIHVQGGGKL  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKS+NVLLTQ+L+ C+S+FGL  LM     P R  GYRAPEV+E +KST+KSDVYS
Sbjct  462  IHGNIKSANVLLTQELSACVSEFGLALLMNCAATPSRIMGYRAPEVLEQQKSTEKSDVYS  521

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV LLELLTGK+PVQ+   +EVVDLP+WVQSVVREEWTAEVFD EL+ Y  ++E++MVQ
Sbjct  522  FGVFLLELLTGKSPVQTPGHDEVVDLPRWVQSVVREEWTAEVFDVELMKY-PNIEEDMVQ  580

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            +L VAM CV +VP+ RP M++VVRMIE++R  + ++RPSSE+ K
Sbjct  581  MLHVAMQCVARVPDRRPTMEDVVRMIEDVRHSNSESRPSSEEGK  624



>gb|KHN40609.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 170/210 (81%), Gaps = 3/210 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ T GS S L+HG  E+ R  LDW+TRLKI  GAARG+AHIHS  G +L
Sbjct  396  YSKDEKLMVYDYSTAGSFSKLLHGTTETGRAPLDWHTRLKIIVGAARGLAHIHSANGKKL  455

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNV+L+ DL GCISDFGLTPL  F     RS GY +PEVIE+RKSTQKSDVYS
Sbjct  456  VHGNIKSSNVILSIDLQGCISDFGLTPLTNFCG-SSRSPGYGSPEVIESRKSTQKSDVYS  514

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK PVQ +  +EVVDLPKWVQSVVREEWTAEVFD EL+ Y  ++EDE+VQ
Sbjct  515  FGVLLLEMLTGKTPVQYSGHDEVVDLPKWVQSVVREEWTAEVFDLELMRY-PNIEDELVQ  573

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIR  212
            +LQ+AMACV  +P+ RP M+EVVR IEE+R
Sbjct  574  MLQLAMACVAVMPDARPSMEEVVRTIEELR  603



>ref|XP_002882579.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58838.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 172/227 (76%), Gaps = 6/227 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+   G+ S L+HGN E  R ALDW TRL+I   AARG++HIHS  GA+L
Sbjct  404  FSKDEKLLVYDYYQGGNFSMLLHGNNEGGRAALDWETRLRICLEAARGISHIHSASGAKL  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQ+L  C+SDFG+ PLM   T IP RS GYRAPE IETRK TQKSDVY
Sbjct  464  LHGNIKSPNVLLTQELQVCVSDFGIAPLMSHHTLIPSRSLGYRAPEAIETRKHTQKSDVY  523

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  524  SFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFDNRPSSED  176
            Q+LQ+AMACV K P+ RP M+EVV M+EEIR     P   NR SS +
Sbjct  584  QMLQIAMACVSKHPDSRPTMEEVVNMMEEIRPSGSGPGSGNRASSPE  630



>ref|XP_007011393.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY20203.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=634

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 173/220 (79%), Gaps = 5/220 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            YSKDEKLLVY ++  GSL +L+HG    R  LDW++R+KIA G ARG+AHIH+  G + T
Sbjct  412  YSKDEKLLVYSYMPAGSLFSLLHG----RTPLDWDSRMKIALGTARGIAHIHTEGGGKCT  467

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYSl  479
            HGNIKSSN+LL+ +L GC+SD GL PLM       R  GYRAPEVI+TRK TQKSDVYS 
Sbjct  468  HGNIKSSNILLSDELEGCVSDVGLAPLMNAPVTMSRIMGYRAPEVIQTRKVTQKSDVYSF  527

Query  478  gvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQL  299
            GVLLLE+LT KAP+Q +  +EVVDLP+WV+SVVREEWTAEVFD EL+ + Q  ++EMVQ+
Sbjct  528  GVLLLEMLTAKAPLQPSGHDEVVDLPRWVRSVVREEWTAEVFDVELLRF-QHFQEEMVQM  586

Query  298  LQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            LQ+A+ACV K  E RPKMDE+VRMIE+IRQP+  NR SSE
Sbjct  587  LQIALACVAKTTETRPKMDEIVRMIEDIRQPESKNRTSSE  626



>ref|XP_009123870.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
 ref|XP_009123879.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=618

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 172/228 (75%), Gaps = 7/228 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLV+D+   G+ S L+HGN E  R ALDW TRLKI  GAA+G++HIHS  GA+L
Sbjct  382  FSKDEKLLVFDYYQGGNFSLLLHGNNEGGRAALDWETRLKICLGAAKGISHIHSASGAKL  441

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQDLN C+SD+ + PLM   T +P RS GYRAPE IETRK T KSDVY
Sbjct  442  LHGNIKSPNVLLTQDLNACVSDYSIAPLMSHHTLLPSRSLGYRAPEAIETRKHTHKSDVY  501

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++A  EE+VDLPKWVQSVVREEWT EVFD ELI    ++E+EMV
Sbjct  502  SFGVLLLEMLTGKAAGKTAGHEELVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMV  561

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ-----PDFDNRPSSED  176
            Q LQ+AMACV + P+ RP M+EVV M+EEIR      P   NR SS +
Sbjct  562  QTLQIAMACVSRHPDSRPSMEEVVNMMEEIRASTGSGPGSANRASSPE  609



>ref|XP_009391668.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391669.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   278 bits (712),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 177/223 (79%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GS SAL+HGNR + R ALDW++R+KI  G A G+AHIHS  GA+L
Sbjct  421  YSKDEKLLVYDYVPTGSFSALLHGNRGTDRPALDWDSRVKIILGTAYGIAHIHSKGGAKL  480

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPR-SAGYRAPEVIETRKSTQKSDVY  485
             HGNIKSSN+LL QDL   +SD+GL  LM     P R   GYRAPE IE RK TQKSD+Y
Sbjct  481  AHGNIKSSNILLNQDLKPVVSDYGLMVLMNLPAKPSRIVVGYRAPETIEARKITQKSDIY  540

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKAP+QS   ++VVDLP+WVQSVVREEWTAEVFD EL+   Q+ E+EMV
Sbjct  541  SFGVLLLEMLTGKAPLQSQGHDDVVDLPRWVQSVVREEWTAEVFDRELMG-SQNTEEEMV  599

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            Q+LQ+AMACV +VP+ RP+++EV++ IEEIRQ   ++RPSSED
Sbjct  600  QMLQIAMACVARVPDRRPRIEEVIQRIEEIRQSGSESRPSSED  642



>ref|XP_007140053.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
 gb|ESW12047.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
Length=607

 Score =   277 bits (709),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 167/209 (80%), Gaps = 3/209 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ T GS S L+HG RE+ R  LDW++RLKI  GAARGV HIHS  G +L
Sbjct  396  YSKDEKLMVYDYSTAGSFSKLLHGTRETGRAPLDWDSRLKIVVGAARGVCHIHSANGRKL  455

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNV+LT DL GCISDFGLTPL  F     RS GY APEVIETRKSTQKSDVYS
Sbjct  456  VHGNIKSSNVILTIDLQGCISDFGLTPLTNFCA-SSRSPGYGAPEVIETRKSTQKSDVYS  514

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK PVQ +  +E VDLPKWVQSVVREEWTAEVFD EL+ Y  ++EDE+VQ
Sbjct  515  FGVLLLEMLTGKTPVQYSGHDEEVDLPKWVQSVVREEWTAEVFDLELMRY-PNIEDELVQ  573

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEI  215
            +LQ+AMACV  +P+ RP M EVV+ IEEI
Sbjct  574  MLQLAMACVAVMPDSRPSMVEVVKTIEEI  602



>ref|XP_009410507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 176/223 (79%), Gaps = 4/223 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR--ESRMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKLL+YD+V  G+LS+L+HGN+    +  LDW +R+K++ GAARG+  IH     +
Sbjct  403  YSKDEKLLIYDYVPSGNLSSLLHGNKGGAGKTPLDWESRIKVSLGAARGIGCIHIDGSGK  462

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPR-SAGYRAPEVIETRKSTQKSDV  488
              HG+IKS+N+LLTQ+L+ C+ D+GL PLM     P R   GYRAPEVIETRK TQKSDV
Sbjct  463  FIHGDIKSNNILLTQELDACVCDYGLAPLMNSAATPSRIVVGYRAPEVIETRKYTQKSDV  522

Query  487  YSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEM  308
            YS GVLLLE+LTGKAP+QS  +++V DLP+WVQSVVREEWTAEVFD EL+ Y   +E+EM
Sbjct  523  YSFGVLLLEMLTGKAPLQSPGRDDVADLPRWVQSVVREEWTAEVFDVELMRYPH-IEEEM  581

Query  307  VQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            VQ+LQ+AMACV K P+ RPKM+EV+RMIE+I+  D +NRPSSE
Sbjct  582  VQMLQIAMACVSKAPDQRPKMEEVIRMIEDIQHSDSENRPSSE  624



>gb|KHN48152.1| Putative inactive receptor kinase [Glycine soja]
Length=250

 Score =   263 bits (673),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 175/224 (78%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVP-GAR  665
            YSKDEKLLVYD+++RGSL +L+HGNR   R  LDW++R+KIA GAA+G+A IH+    ++
Sbjct  21   YSKDEKLLVYDYISRGSLFSLLHGNRGMGRAPLDWDSRMKIALGAAKGIASIHTDHMDSK  80

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
            LTHGNIKSSNVL+ Q  +GCI+D GLTP+M   +   R+ GYRAPEV E R+ TQKSDVY
Sbjct  81   LTHGNIKSSNVLINQQHDGCITDVGLTPMMSTQSTMSRANGYRAPEVTEYRRITQKSDVY  140

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLELLTGKAP+     E++VDLP+WV+SVVREEWTAEVFD EL+   Q  E+EMV
Sbjct  141  SFGVLLLELLTGKAPLGYPGYEDMVDLPRWVRSVVREEWTAEVFDEELLR-GQYFEEEMV  199

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            Q+LQ+A+ACV KV + RP MDE VR IEEIR P+  NR +S ++
Sbjct  200  QMLQIALACVAKVSDNRPTMDETVRNIEEIRLPELKNRNTSSES  243



>gb|EEE55588.1| hypothetical protein OsJ_03884 [Oryza sativa Japonica Group]
Length=251

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 175/225 (78%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMA-LDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSL+ ++HGN+ +  A LDW TR+KI+ G ARG+AH+H+  G + 
Sbjct  21   YSKDEKLLVYDYIPSGSLAVVLHGNKATGKAPLDWETRVKISLGVARGIAHLHAEGGGKF  80

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGN+KSSN+LL+Q+L+GC+S+FGL  LM     P R  GYRAPEV+ET+K TQKSDVYS
Sbjct  81   IHGNLKSSNILLSQNLDGCVSEFGLAQLMTIPPAPARLVGYRAPEVLETKKPTQKSDVYS  140

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVL+LE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWTAEVFD +L+  H ++EDEMV
Sbjct  141  FGVLVLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDVDLLR-HPNIEDEMV  199

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQVAMACV   P+ RPKMDEV+R I EIR     +R   E+ +
Sbjct  200  QMLQVAMACVAAPPDQRPKMDEVIRRIVEIRNSYSGSRTPPEEKQ  244



>gb|KEH23299.1| LRR receptor-like kinase [Medicago truncatula]
Length=611

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 167/210 (80%), Gaps = 2/210 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ T GS S L+HG  ++ R  LDW +RLKI  GAA+G+AHIHS  G + 
Sbjct  399  YSKDEKLVVYDYFTSGSFSKLLHGTGDTGRTQLDWESRLKIMAGAAKGIAHIHSANGRKH  458

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLLT DL GCISDFGLTPL      P    GYRAPEV E+RK TQKSDVYS
Sbjct  459  VHGNIKSSNVLLTIDLQGCISDFGLTPLTSLCVSPKSPPGYRAPEVNESRKYTQKSDVYS  518

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK PVQ +  ++VVDLPKWVQSVVREEWTAEVFD +L+ Y  ++E+++VQ
Sbjct  519  FGVLLLEMLTGKTPVQYSGHDDVVDLPKWVQSVVREEWTAEVFDLDLMRY-SNIEEDLVQ  577

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIR  212
            +LQ+AMACV ++P+ RP M+EVVRMIE+IR
Sbjct  578  MLQLAMACVAEMPDTRPSMEEVVRMIEDIR  607



>gb|KEH35517.1| receptor-like kinase [Medicago truncatula]
Length=635

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 174/222 (78%), Gaps = 2/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY ++  GSL  L+HGN+ + R   DWN+R+K+A GAA+G+A IH+  G + 
Sbjct  407  YSKDEKLLVYSYMPEGSLFFLLHGNKGAGRTPFDWNSRVKVALGAAKGIAFIHTEGGQKF  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVL+T++ + CISD GL PLM       R+ GYRAPEV +++K TQKSDVYS
Sbjct  467  THGNIKSTNVLITEEFDSCISDVGLPPLMNAPATMSRTNGYRAPEVTDSKKITQKSDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGK P++    E+VVDLP+WV+SVVREEWTAEVFD EL+   Q +E+EMVQ
Sbjct  527  FGVLLLELLTGKVPMRYPGYEDVVDLPRWVRSVVREEWTAEVFDEELLR-GQYVEEEMVQ  585

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            +LQ+A+ACV K P+MRP+MDE VRMIEEI+ P+F NR SSE 
Sbjct  586  MLQIALACVAKTPDMRPRMDEAVRMIEEIKNPEFKNRTSSES  627



>ref|XP_004511532.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Cicer arietinum]
Length=356

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 174/223 (78%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+  +GS+SAL+HG R E ++ LDWNTR+KIA GAARG+AHIHS  G +L
Sbjct  114  YSKDEKLIVYDYYNQGSISALLHGKRGEDKVPLDWNTRIKIALGAARGLAHIHSENGGKL  173

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPEVIETRKSTQKSDVY  485
             HGN+KSSN+ L     GC+SD GL  +M   T P  R+AGYRAPEV +TRK+TQ SDVY
Sbjct  174  IHGNVKSSNIFLNTKQYGCVSDLGLATIMSSVTQPVSRAAGYRAPEVTDTRKATQASDVY  233

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLELLTGK+P+ +   +E++ L +WV SVVREEWTAEVFD EL+    ++E+EMV
Sbjct  234  SFGVVLLELLTGKSPIHTTRGDEIIHLVRWVHSVVREEWTAEVFDLELMRC-PNIEEEMV  292

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            ++LQ+AM+CV ++ + RPKM E+V MIE +RQ D +NRPSSE+
Sbjct  293  EMLQIAMSCVVRMHDQRPKMSEIVSMIENVRQIDIENRPSSEN  335



>ref|XP_007220535.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
 gb|EMJ21734.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
Length=631

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 174/221 (79%), Gaps = 3/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY+++  GSL A +HG+R++ R  LDW++R+KI+ G A+G+AHIHS  GA+ 
Sbjct  405  YSKDEKLLVYNYMPAGSLFAHLHGSRDAGRSPLDWDSRVKISLGVAKGIAHIHS-EGAKC  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKS+NVLLTQDL  CI+D GL+PLM F     R+ GYRAPE  + RK + KSDVYS
Sbjct  464  SHGNIKSTNVLLTQDLEACITDVGLSPLMNFPATMSRATGYRAPEATDMRKISHKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK  +Q    + V+DLP+WV+SVVREEWTAEVFD EL+   Q +E+EMVQ
Sbjct  524  FGVLLLEMLTGKTTLQYPGHDSVIDLPRWVKSVVREEWTAEVFDLELLR-QQHIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K+PE RP MDEVVRMIEEIRQ D   RPSSE
Sbjct  583  MLQIALACVSKLPEARPSMDEVVRMIEEIRQSDTKTRPSSE  623



>ref|XP_004308997.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011470006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=643

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 178/226 (79%), Gaps = 7/226 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YS+DEKLLVY+++  GSL A +HG+R++ R+ LDWN+RLKIA G AR +AHIHS  G + 
Sbjct  413  YSRDEKLLVYNYMPAGSLFAHLHGSRDAGRIPLDWNSRLKIALGIARAIAHIHSEGGVKC  472

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF---TTIPPRSAGYRAPEVIETRKSTQKSD  491
             HGNIKS+NVLLT++L  CISD GLTPLM F   T++  R+ GYRAPE I+ RK + KSD
Sbjct  473  IHGNIKSTNVLLTEELEACISDVGLTPLMNFPVATSMSRRATGYRAPEAIDMRKMSDKSD  532

Query  490  VYSlgvlllelLTGKAPVQSAAQEE--VVDLPKWVQSVVREEWTAEVFDAELINYHQSME  317
            VYS GVLLLE+LTGK  +Q+A   +  VVDLP+WV+SVVREEWTAEVFD EL+   Q +E
Sbjct  533  VYSFGVLLLEMLTGKTTLQNAGHYDDVVVDLPRWVKSVVREEWTAEVFDLELLK-QQGIE  591

Query  316  DEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +EMVQ+LQ+A+ACV K+PE RPKMD+VVRM+EE RQ D   RPSSE
Sbjct  592  EEMVQMLQIALACVAKLPESRPKMDDVVRMLEEFRQSDTKTRPSSE  637



>ref|XP_002281635.1| PREDICTED: probable inactive receptor kinase At2g26730 [Vitis 
vinifera]
 emb|CBI28134.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 180/224 (80%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYDF+  GSLSAL+HG+R S R  LDW+ R++IA  AARG+AH+H V G ++
Sbjct  410  FSKDEKLLVYDFMAAGSLSALLHGSRGSGRTPLDWDNRMRIALSAARGIAHLH-VSG-KV  467

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D + C+SDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  468  VHGNIKSSNILLRPDHDACVSDFGLNPLFGNSTPPNRVAGYRAPEVMETRKVTFKSDVYS  527

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  528  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  586

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  587  LLQIAMACVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDD  630



>emb|CDY32713.1| BnaA02g07750D [Brassica napus]
Length=651

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 180/224 (80%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            Y+KDEKL+V D+   G+LS+L+HGN    R  LDW++RL+I   AA+GVAH+H V G + 
Sbjct  417  YNKDEKLMVCDYYPGGNLSSLLHGNLGGERRFLDWDSRLRIILAAAKGVAHLHQVGGPKF  476

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSN+++ Q+ + C+SD+GLT LM     P R AGYRAPEVIETRK T KSDVYS
Sbjct  477  SHGNIKSSNMIMKQESDVCVSDYGLTSLMAVPVTPMRGAGYRAPEVIETRKHTHKSDVYS  536

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD EL+   Q++E+EMVQ
Sbjct  537  FGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKV-QNIEEEMVQ  595

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPD-FDNRPSSEDN  173
            +LQ+AMACV +V E+RP MD+VVRMIEEIR  D  + RPSS+DN
Sbjct  596  MLQIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSETRPSSDDN  639



>ref|XP_007013302.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY30921.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=650

 Score =   273 bits (698),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 147/224 (66%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYDF+  GSLSAL+HG+R S R  LDW++R++IA  AARG+ H+H     ++
Sbjct  407  YSKDEKLLVYDFMRDGSLSALLHGSRGSGRTPLDWDSRMRIALSAARGLTHLHV--SGKV  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D   CISDFGL PL G TT P R AGYRAPEV+ETRK T KSDVYS
Sbjct  465  VHGNIKSSNILLRPDHEACISDFGLNPLFGNTTPPSRVAGYRAPEVVETRKVTFKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH S+E+EMVQ
Sbjct  525  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-SIEEEMVQ  583

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AM CV  VP+ RP M++VVRMIE++ + + D+  R SS+D
Sbjct  584  LLQIAMTCVSTVPDQRPAMEDVVRMIEDMNRGETDDGLRQSSDD  627



>ref|XP_010915719.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915720.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915721.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=640

 Score =   273 bits (697),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 175/223 (78%), Gaps = 5/223 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ ++GS+++L+HG R E R  LDW TRLKIA GAARG+AHIHS    +L
Sbjct  402  YSKDEKLMVYDYFSQGSVASLLHGKRGEDRTPLDWETRLKIAIGAARGIAHIHSQNNGKL  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPP--RSAGYRAPEVIETRKSTQKSDV  488
             HGNIKSSN  L     GCISD GLT LM    +PP  R+AGYRAPEV++ RK+TQ SDV
Sbjct  462  VHGNIKSSNAFLNNQQYGCISDLGLTSLMN-PMVPPVSRTAGYRAPEVVDLRKTTQASDV  520

Query  487  YSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEM  308
            YS GVL+LELLTGK+P+Q    +EVV L +WVQSVVREEWTAEVFD EL+ Y  ++E+EM
Sbjct  521  YSFGVLMLELLTGKSPIQITGGDEVVHLVRWVQSVVREEWTAEVFDVELMRY-PNIEEEM  579

Query  307  VQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            V++LQ+AM CV ++PE RPKM EVVRMIE++R+ D  NRPSSE
Sbjct  580  VEMLQIAMTCVVRMPEQRPKMSEVVRMIEDVRRFDTGNRPSSE  622



>ref|XP_004492584.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=611

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 167/210 (80%), Gaps = 2/210 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ T GS S L+HG+ E  R  LDW++RLKI  GAA+G+AHIHS  G +L
Sbjct  399  YSKDEKLMVYDYFTTGSFSKLLHGSSEMGRTPLDWDSRLKIMAGAAKGIAHIHSANGRKL  458

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLL+ DL G ISDFGLTPL      P    GY+APEV E+RKSTQKSDVYS
Sbjct  459  VHGNIKSSNVLLSIDLQGSISDFGLTPLTSLCVSPKSPPGYQAPEVNESRKSTQKSDVYS  518

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK P Q +  ++VVDLPKWVQSVVREEWTAEVFD EL+ Y  ++E+E+VQ
Sbjct  519  FGVLLLEMLTGKTPAQYSGHDDVVDLPKWVQSVVREEWTAEVFDLELMRY-PNIEEELVQ  577

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIR  212
            +LQ+AMACV  +P+ RP M+EVV+MIE+IR
Sbjct  578  MLQLAMACVAVMPDTRPSMEEVVKMIEDIR  607



>ref|XP_004502808.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502809.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502810.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Cicer arietinum]
Length=644

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 175/223 (78%), Gaps = 2/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY+++  GSL  L+HGN+ + R   DW++R+KIA GAA+G+A IHS  G + 
Sbjct  416  YSKDEKLLVYNYMPGGSLFFLLHGNKGAGRTPFDWDSRVKIALGAAKGIAFIHSEGGPKF  475

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVL+TQ+L+ CISD GL PLM       R+ GYRAPEV ++RK TQKSDVYS
Sbjct  476  THGNIKSTNVLITQELDSCISDVGLPPLMNTPATMSRANGYRAPEVTDSRKITQKSDVYS  535

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK P++    E+ VDLP+WV+SVVREEWTAEVFD E++   Q +E+EMVQ
Sbjct  536  FGVLLLEMLTGKVPMRYPGYEDFVDLPRWVRSVVREEWTAEVFDEEVLR-GQYVEEEMVQ  594

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            +LQ+ +ACV K P+MRP+MDE VRMIEEI+ P+F NR SSE +
Sbjct  595  MLQIGLACVAKTPDMRPRMDEAVRMIEEIKHPEFKNRTSSESD  637



>ref|XP_002529343.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33010.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=657

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 176/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYDF+  GSLSAL+HG+R S R  LDW+ R++IA  AARG+AH+H V   ++
Sbjct  414  YSKDEKLLVYDFMAAGSLSALLHGSRGSGRTPLDWDNRMRIAMSAARGLAHLHVV--GKV  471

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D +  ISDF L PL G  T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  472  VHGNIKSSNILLRPDQDAAISDFALNPLFGTATPPSRVAGYRAPEVVETRKVTFKSDVYS  531

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  532  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  590

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE+I + + D+  R SS+D
Sbjct  591  LLQIAMACVSTVPDQRPAMQEVVRMIEDINRGETDDGLRQSSDD  634



>ref|XP_010921194.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=349

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 168/212 (79%), Gaps = 3/212 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GS S L+HGNR S R  LDW++R+K+  G A G+AHIHS  G + 
Sbjct  122  YSKDEKLLVYDYVPTGSFSTLLHGNRGSERTPLDWDSRVKVILGTAHGIAHIHSEGGPKF  181

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKSSN+LL QDLN  +SD+GL+PLM    T+     GYRAPE +ETRK TQKSDVY
Sbjct  182  VHGNIKSSNILLGQDLNPLVSDYGLSPLMNPPATLSQLMVGYRAPETMETRKITQKSDVY  241

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLE+LTGKAP+QS   ++V DLP+WVQSVVREEWTAEVFD EL+  H + E+E+V
Sbjct  242  SFGVVLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEWTAEVFDVELMMDHNN-EEELV  300

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            ++LQ+AM+CV + PE RP+M++VVRMIEEIR+
Sbjct  301  RMLQIAMSCVARTPEQRPRMEDVVRMIEEIRK  332



>emb|CDX88667.1| BnaA03g09820D [Brassica napus]
Length=625

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 178/224 (79%), Gaps = 16/224 (7%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+ + G+LS+L+HGNR S R  LDW +R+KI   AA+GVAH+H V G++ 
Sbjct  404  YSKDEKLLVYDYYSAGNLSSLLHGNRGSGREPLDWESRVKITLAAAKGVAHLHEVGGSKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSNV++ Q+ + C+SDFG              AGYRAPEVI TRK T KSDVYS
Sbjct  464  SHGNIKSSNVIMKQENDVCVSDFG-------------GAGYRAPEVIVTRKHTHKSDVYS  510

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD EL+ + Q++E+EMVQ
Sbjct  511  FGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKF-QNIEEEMVQ  569

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPD-FDNRPSSEDN  173
            +LQ+AMACV  VPE+RP MDEVVRMIEEIR  D  + RPSS+DN
Sbjct  570  MLQIAMACVAHVPEVRPSMDEVVRMIEEIRVSDSSETRPSSDDN  613



>ref|XP_008234182.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=601

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 174/221 (79%), Gaps = 3/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY+++  GSL A +HG+R++ R  LDW++R+KI+   A+G+AHIHS  GA+ 
Sbjct  375  YSKDEKLLVYNYMPAGSLFAHLHGSRDAGRSPLDWDSRVKISLEVAKGIAHIHS-EGAKC  433

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKS+NVLLTQDL  CI+D GL+PLM F     R+ GYRAPE  + RK + KSDVYS
Sbjct  434  SHGNIKSTNVLLTQDLEACITDVGLSPLMNFPATMSRATGYRAPEATDMRKISHKSDVYS  493

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK  +Q    + V+DLP+WV+SVVREEWTAEVFD EL+   Q +E+EMVQ
Sbjct  494  FGVLLLEMLTGKTTLQYPGHDSVIDLPRWVKSVVREEWTAEVFDLELLR-QQHIEEEMVQ  552

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K+PE RP+MDEVVRMIEEIRQ D   RPSSE
Sbjct  553  MLQIALACVSKLPEARPRMDEVVRMIEEIRQSDTKTRPSSE  593



>ref|XP_009126766.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=651

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 180/224 (80%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            Y+KDEKL+V D+   G+LS+L+HGN    R  LDW++RL+I   AA+GVAH+H V G + 
Sbjct  417  YNKDEKLMVCDYYPGGNLSSLLHGNLGGERRFLDWDSRLRIILAAAKGVAHLHQVGGPKF  476

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKSSN+++ Q+ + C+SD+GLT LM     P R AGYRAPEVIETRK T KSDVYS
Sbjct  477  SHGNIKSSNMIMKQENDVCVSDYGLTSLMVVPVTPMRGAGYRAPEVIETRKHTHKSDVYS  536

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD EL+   Q++E+EMVQ
Sbjct  537  FGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKV-QNIEEEMVQ  595

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPD-FDNRPSSEDN  173
            +LQ+AMACV +V E+RP MD+VVRMIEEIR  D  + RPSS+DN
Sbjct  596  MLQIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSETRPSSDDN  639



>ref|XP_006451034.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
 ref|XP_006451035.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
 gb|ESR64274.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
 gb|ESR64275.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
Length=654

 Score =   271 bits (694),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLSAL+HG+R S R  LDW+ R++IA  AARG+AH+H     ++
Sbjct  411  YSKDEKLLVYDYMPAGSLSALLHGSRGSGRTPLDWDNRMRIALSAARGLAHLHV--SGKI  468

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SN+LL  D + C+SDFGL PL G TT P R AGYRAPEV+ETRK T KSDVYS
Sbjct  469  VHGNIKASNILLRPDHDACVSDFGLNPLFGNTTPPTRVAGYRAPEVVETRKVTFKSDVYS  528

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  529  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  587

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AM CV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  588  LLQIAMGCVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDD  631



>ref|XP_012078693.1| PREDICTED: probable inactive receptor kinase At2g26730 [Jatropha 
curcas]
 gb|KDP32336.1| hypothetical protein JCGZ_13261 [Jatropha curcas]
Length=652

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYDF+  GSLSAL+HG+R S R  LDW+ R++IA  AARG+AH+H V   ++
Sbjct  409  YSKDEKLLVYDFMAAGSLSALLHGSRGSGRTPLDWDNRMRIAMSAARGLAHLHVV--GKV  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D +  +SDFGL PL G  T P R AGYRAPEV+ETRK T K+DVYS
Sbjct  467  VHGNIKSSNILLRPDHDASVSDFGLNPLFGTATPPSRVAGYRAPEVVETRKVTFKADVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  527  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  585

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EV+RMIE+I + + D+  R SS+D
Sbjct  586  LLQIAMACVSTVPDQRPAMQEVLRMIEDINRGETDDGLRQSSDD  629



>ref|XP_007136405.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 ref|XP_007136406.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08399.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08400.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
Length=640

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 174/221 (79%), Gaps = 2/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VY+++  GSL  L+HGN+ + R  LDW++R+KI  GAA+G+A IHS  G + 
Sbjct  413  YSKDEKLMVYNYMPGGSLFFLLHGNKGAGRTPLDWDSRVKIVHGAAKGIAFIHSEGGPKF  472

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGNIKS+NVL++Q+L GCISD GL PLM       RS GYRAPEV +++K TQKSDVYS
Sbjct  473  THGNIKSNNVLISQELEGCISDVGLPPLMNTPATMSRSNGYRAPEVTDSKKITQKSDVYS  532

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GV+LLE+LTGK P++    E+VVDLP+WV+SVVREEWTAEVFD EL+   Q +E+EMVQ
Sbjct  533  FGVVLLEMLTGKTPLRYPGYEDVVDLPRWVRSVVREEWTAEVFDEELLR-GQYVEEEMVQ  591

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K  E RP+MDEV RMIEEI+ P+  NRPSSE
Sbjct  592  MLQIALACVAKGSENRPRMDEVARMIEEIKHPELKNRPSSE  632



>ref|XP_006475765.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Citrus 
sinensis]
 gb|KDO80389.1| hypothetical protein CISIN_1g036334mg [Citrus sinensis]
Length=654

 Score =   271 bits (692),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 176/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLSAL+HG+R S R  LDW+ R++IA  AARG+AH+H     ++
Sbjct  411  YSKDEKLLVYDYMPAGSLSALLHGSRGSGRTPLDWDNRMRIALSAARGLAHLHV--SGKI  468

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SN+LL  D + C+SDFGL PL G TT P R AGYRAPEV+ETRK T KSDVYS
Sbjct  469  VHGNIKASNILLRPDHDACVSDFGLNPLFGNTTPPTRVAGYRAPEVVETRKVTFKSDVYS  528

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  529  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  587

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AM CV  VP+ RP M EVVRMIE + + + D+  R SS+D
Sbjct  588  LLQIAMGCVSTVPDQRPAMQEVVRMIENMNRGETDDGLRQSSDD  631



>gb|EEE64112.1| hypothetical protein OsJ_18944 [Oryza sativa Japonica Group]
Length=638

 Score =   270 bits (691),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++T GSL A +HGNR + R  LDW TR+KI+  AARG+AH+H+  G + 
Sbjct  407  YSKDEKLLVYDYMTPGSLCAALHGNRTAGRTTLDWATRVKISLEAARGIAHLHAEGGGKF  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL+Q L+ CIS+FGL  LM    IP R  GYRAPEV+ET++ TQKSDVYS
Sbjct  467  IHGNIKSSNILLSQGLSACISEFGLAQLMAIPHIPARLIGYRAPEVLETKRQTQKSDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWT+EVFDA+L+  H + EDEMV
Sbjct  527  YGVLLLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTSEVFDADLLR-HPNSEDEMV  585

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            Q+LQ+AMACV  VP+ RP+M+EVVR IEEIR      R S ED
Sbjct  586  QMLQLAMACVAIVPDQRPRMEEVVRRIEEIRNSSSGTRLSPED  628



>ref|NP_001055854.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|AAT01376.1| putative phytosulfokine receptor kinase [Oryza sativa Japonica 
Group]
 dbj|BAF17768.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|EAY98442.1| hypothetical protein OsI_20356 [Oryza sativa Indica Group]
 dbj|BAG99879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=638

 Score =   270 bits (691),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++T GSL A +HGNR + R  LDW TR+KI+  AARG+AH+H+  G + 
Sbjct  407  YSKDEKLLVYDYMTPGSLCAALHGNRTAGRTTLDWATRVKISLEAARGIAHLHAEGGGKF  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL+Q L+ CIS+FGL  LM    IP R  GYRAPEV+ET++ TQKSDVYS
Sbjct  467  IHGNIKSSNILLSQGLSACISEFGLAQLMAIPHIPARLIGYRAPEVLETKRQTQKSDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWT+EVFDA+L+  H + EDEMV
Sbjct  527  YGVLLLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTSEVFDADLLR-HPNSEDEMV  585

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            Q+LQ+AMACV  VP+ RP+M+EVVR IEEIR      R S ED
Sbjct  586  QMLQLAMACVAIVPDQRPRMEEVVRRIEEIRNSSSGTRLSPED  628



>ref|XP_004287382.1| PREDICTED: probable inactive receptor kinase At2g26730 [Fragaria 
vesca subsp. vesca]
Length=654

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 178/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD++T GSLSAL+HG+R S R  LDW+ R++IA  AARG+AH+H     ++
Sbjct  410  FSKDEKLLVYDYMTAGSLSALLHGSRGSGRTPLDWDNRMRIALSAARGLAHLHV--AGKV  467

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D +  ISDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  468  VHGNIKSSNILLRPDHDATISDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYS  527

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  528  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  586

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  587  LLQIAMACVSTVPDQRPAMQEVVRMIEDMNRAETDDGLRQSSDD  630



>ref|XP_004241083.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Solanum lycopersicum]
Length=593

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 173/211 (82%), Gaps = 4/211 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            YSKDEKLLV ++V  GSLS+ ++GN  +R  LDW+TRLK+  GAA+G+AHIHS  G + T
Sbjct  385  YSKDEKLLVCEYVPYGSLSSALYGNGRTR--LDWDTRLKVCLGAAKGIAHIHSEGGTKFT  442

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPEVIETRKSTQKSDVYS  482
            HGNIK+SN+LLT+DL+GCISDFGL+PLM  T+I    A GY APEVIETRK TQKSDVYS
Sbjct  443  HGNIKASNILLTRDLDGCISDFGLSPLMNHTSIKNNKAVGYHAPEVIETRKGTQKSDVYS  502

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LELLTGK+P+     E+VV+LP+WV++VV+EEWTAEVFDA L+ YH ++++EMV 
Sbjct  503  FGVLVLELLTGKSPLPLPGHEDVVNLPRWVRAVVKEEWTAEVFDAVLMKYH-NIQEEMVH  561

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            +LQ+A+ CV KVP+MRP M EV++MIE+I+ 
Sbjct  562  MLQIALLCVAKVPDMRPSMGEVIKMIEQIKH  592



>gb|KHG24076.1| hypothetical protein F383_10304 [Gossypium arboreum]
Length=650

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 176/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV DF+  GSLSAL+HG+R S R  L W+ R++IA   ARG+AH+H V G ++
Sbjct  407  YSKDEKLLVSDFMRDGSLSALLHGSRGSGRTPLGWDNRMRIALSTARGLAHLH-VSG-KV  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SNVLL  D + CISDFGL PL G TT P R AGYRAPEV+ETRK T KSDVYS
Sbjct  465  VHGNIKASNVLLRPDQDACISDFGLNPLFGNTTPPSRVAGYRAPEVLETRKVTFKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH S+E+EMVQ
Sbjct  525  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-SIEEEMVQ  583

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AM CV  VP+ RP M EVVRMIEE+ + + D+  R SS+D
Sbjct  584  LLQIAMTCVSTVPDQRPSMQEVVRMIEEMNRVETDDGLRQSSDD  627



>ref|XP_007204237.1| hypothetical protein PRUPE_ppa002548mg [Prunus persica]
 gb|EMJ05436.1| hypothetical protein PRUPE_ppa002548mg [Prunus persica]
Length=659

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD++  GSLSAL+HG+R S R  LDW+ R+KIA  AARG+AH+H     ++
Sbjct  415  FSKDEKLLVYDYMAAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHV--SGKV  472

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  + +  +SDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  473  VHGNIKSSNILLRPEHDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYS  532

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  533  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  591

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  592  LLQIAMACVSTVPDQRPAMQEVVRMIEDMNRAETDDGLRQSSDD  635



>ref|XP_006654545.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=638

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 176/223 (79%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++T GSL A +HGNR + R +LDW TR+KI+  AARG+AH+H+  G + 
Sbjct  407  YSKDEKLLVYDYITPGSLCAALHGNRTAGRTSLDWVTRVKISLEAARGIAHLHAEGGGKF  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL+Q L+ CIS+FGL  LM    IP R  GYRAPEV+ET+++TQKSDVYS
Sbjct  467  IHGNIKSSNILLSQGLSACISEFGLAQLMAIPHIPARLIGYRAPEVLETKRATQKSDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +++ ++ LP+WVQSVVREEWT+EVFDA+L+    S EDEMV
Sbjct  527  FGVLLLEMLTGKAPLRSPGRDDSIEHLPRWVQSVVREEWTSEVFDADLLRQPNS-EDEMV  585

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            Q+LQ+AMACV  +P+ RP+MDEVV+ IEEIR      R S ED
Sbjct  586  QMLQLAMACVAILPDQRPRMDEVVKRIEEIRNSSSGTRSSPED  628



>ref|XP_002324958.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF03523.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=621

 Score =   267 bits (683),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 176/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV DF+  GSLSAL+HG+R S R  LDW+ R++IA   ARG+AH+H     ++
Sbjct  378  YSKDEKLLVSDFMPVGSLSALLHGSRGSGRTPLDWDNRMRIAMSTARGLAHLHI--AGKV  435

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D + C+SD+GL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  436  IHGNIKSSNILLRPDNDACVSDYGLNPLFGTSTPPSRVAGYRAPEVVETRKVTFKSDVYS  495

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  496  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  554

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  555  LLQIAMACVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDD  598



>ref|XP_009363779.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=635

 Score =   268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 176/221 (80%), Gaps = 3/221 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +S +EKLLVY+++  GSL A +HG+ +  R  LDW++R+KI+ G A+G+AHIHSV GA+ 
Sbjct  409  FSTEEKLLVYNYMPAGSLFARLHGSSDVGRSPLDWDSRVKISLGIAKGLAHIHSV-GAKC  467

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKS+N+LLTQ+L  CISD GL+PLM F     R+ GYRAPE ++ RK+T KSDVYS
Sbjct  468  SHGNIKSTNILLTQELEACISDVGLSPLMSFPPAMSRAIGYRAPEAVDMRKTTHKSDVYS  527

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKA ++    + VVDLP+WV+SVVREEWTAEVFD EL+ +H  +E+EMVQ
Sbjct  528  FGVLLLEMLTGKATLEYLGHDCVVDLPRWVKSVVREEWTAEVFDLELLKHHH-IEEEMVQ  586

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +LQ+A+ACV K+PE RP MDEVVRMIEE+RQ D   RPSSE
Sbjct  587  VLQIALACVTKLPETRPNMDEVVRMIEELRQSDTKTRPSSE  627



>gb|EMT17815.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=634

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GSL+A++HGN+ + R ALDW TR+KI+ G ARG+AH+H+    + 
Sbjct  407  YSKDEKLLVYDYVPAGSLAAVLHGNKATGRAALDWETRVKISLGVARGLAHLHAEGSGKF  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGN+KSSN+LL+Q+L+GC+S+FGL  LM     P R  GYRAPEV+ET+K TQKSDVYS
Sbjct  467  IHGNLKSSNILLSQNLDGCVSEFGLAQLMTTLPAPARLIGYRAPEVLETKKPTQKSDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +E+ V+ LP+WVQSVVREEWTAEVFD +L+  H ++EDEMV
Sbjct  527  FGVLLLEMLTGKAPLRSPGREDSVEHLPRWVQSVVREEWTAEVFDVDLLR-HPNIEDEMV  585

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            QLLQVAMACV   P+ RPKMDEV+R I EIR 
Sbjct  586  QLLQVAMACVAVAPDQRPKMDEVIRRIAEIRN  617



>gb|KJB54134.1| hypothetical protein B456_009G022300 [Gossypium raimondii]
Length=650

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 176/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV DF+  GSLSAL+HG+R S R  L W+ R++IA   ARG+AH+H V G ++
Sbjct  407  YSKDEKLLVSDFMRDGSLSALLHGSRGSGRTPLGWDNRMRIALSTARGLAHLH-VSG-KV  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SNVLL  D + CISDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  465  VHGNIKASNVLLRSDQDACISDFGLNPLFGNSTPPSRVAGYRAPEVLETRKVTFKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH S+E+EMVQ
Sbjct  525  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-SIEEEMVQ  583

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AM CV  VP+ RP M EVVRMIEE+ + + D+  R SS+D
Sbjct  584  LLQIAMTCVSTVPDQRPSMQEVVRMIEEMNRVETDDGLRQSSDD  627



>ref|XP_008242698.1| PREDICTED: probable inactive receptor kinase At2g26730 [Prunus 
mume]
Length=659

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD++  GSLSAL+HG+R S R  LDW+ R+KIA  AARG+AH+H     ++
Sbjct  415  FSKDEKLLVYDYMAAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHV--SGKV  472

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  + +  +SDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  473  VHGNIKSSNILLRPEHDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYS  532

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  533  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  591

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  592  LLQIAMACVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDD  635



>gb|ACZ98536.1| protein kinase [Malus domestica]
Length=655

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLV D+++ GSLSAL+HG+R S R  LDW+ R+KIA  AARG+AH+H     ++
Sbjct  411  FSKDEKLLVSDYMSAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHV--SGKV  468

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  469  VHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYS  528

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  529  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  587

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  588  LLQIAMACVSTVPDQRPAMQEVVRMIEDMNRAETDDGLRQSSDD  631



>emb|CDY22164.1| BnaC01g39370D [Brassica napus]
Length=565

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 167/226 (74%), Gaps = 7/226 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            + KDEKLLV+D+   G+ S L+HGN +  R ALDW TR+KI  GAA+G+AHIHS  GA+L
Sbjct  179  FPKDEKLLVFDYYQGGNFSMLLHGNDDGGRAALDWETRVKICLGAAKGIAHIHSASGAKL  238

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTT-IPPRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKS NVLLTQDLN C+SD+G+ PLM     +  RS GY APE IETR+ T KSD+Y
Sbjct  239  LHGNIKSPNVLLTQDLNACVSDYGIAPLMSHHAFLSSRSLGYIAPEAIETRQHTHKSDMY  298

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKA  ++A  EEVVDLPKWVQSVVREEWT EVFD ELI    + E+EMV
Sbjct  299  SFGVLLLEMLTGKAAGKTAGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNAEEEMV  358

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ-----PDFDNRPSS  182
            Q LQ+AMACV K P+ RP M+EVV M+EEIR      P   NR SS
Sbjct  359  QTLQIAMACVSKHPDSRPSMEEVVNMMEEIRAFTGSGPGSANRASS  404



>ref|XP_008343962.1| PREDICTED: probable inactive receptor kinase At2g26730 [Malus 
domestica]
Length=656

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLV D+++ GSLSAL+HG+R S R  LDW+ R+KIA  AARG+AH+H     ++
Sbjct  412  FSKDEKLLVSDYMSAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHV--SGKV  469

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  470  VHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYS  529

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  530  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  588

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  589  LLQIAMACVSTVPDQRPAMQEVVRMIEDMNRAETDDGLRQSSDD  632



>ref|XP_008386031.1| PREDICTED: probable inactive receptor kinase At2g26730 [Malus 
domestica]
Length=656

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLV D+++ GSLSAL+HG+R S R  LDW+ R+KIA  AARG+AH+H     ++
Sbjct  412  FSKDEKLLVSDYMSAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHV--SGKV  469

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  470  VHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYS  529

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  530  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  588

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  589  LLQIAMACVSTVPDQRPAMQEVVRMIEDMNRAETDDGLRQSSDD  632



>ref|XP_010925785.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010925786.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=641

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 174/224 (78%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+   GS++A +HG R E R+ LDW TRLKIA GAARG+AHIH+    +L
Sbjct  402  YSKDEKLIVYDYFAHGSVAAWLHGKRGEDRIPLDWETRLKIAVGAARGIAHIHTGNNGKL  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPP--RSAGYRAPEVIETRKSTQKSDV  488
             HGNIKSSNV L     GC+SD GLT LM   TIPP  R+AGYRAPEV++ RK+TQ SDV
Sbjct  462  VHGNIKSSNVFLNNRQYGCVSDLGLTSLMN-PTIPPVSRTAGYRAPEVVDLRKATQASDV  520

Query  487  YSlgvlllelLTGKAPVQ-SAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDE  311
            YS GVL+LELLTGK+P+Q     +EV+ L +WV SVVREEWTAEVFD EL+ Y  ++E+E
Sbjct  521  YSFGVLMLELLTGKSPIQIKGGGDEVIHLVRWVHSVVREEWTAEVFDLELMRY-PNIEEE  579

Query  310  MVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            MV++LQ+AM CV ++PE RP+M EVVRMIE++R+ D  NRPSSE
Sbjct  580  MVEMLQIAMTCVARMPEQRPRMTEVVRMIEDVRRFDTGNRPSSE  623



>gb|KHG18372.1| hypothetical protein F383_03411 [Gossypium arboreum]
Length=651

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 173/224 (77%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YS DEKLLVYDF+  GSLSAL+HG+R S R  LDW+ R+KIA   ARG+ H+H    A+L
Sbjct  409  YSIDEKLLVYDFMHDGSLSALLHGSRGSGRTPLDWDNRMKIALSTARGLEHLHV--SAKL  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D   CISDFGL PL G TT P R AGYRAPE++ET K T +SDVYS
Sbjct  467  VHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEILETCKVTFESDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH S+E+EMVQ
Sbjct  527  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-SIEEEMVQ  585

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AM CV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  586  LLQIAMTCVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDD  629



>ref|XP_009374078.1| PREDICTED: probable inactive receptor kinase At2g26730 [Pyrus 
x bretschneideri]
Length=594

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 176/224 (79%), Gaps = 7/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+++ GSLSAL+HG+R S R  LDW  R+KIA  AARG+A +H     ++
Sbjct  351  FSKDEKLLVYDYMSAGSLSALLHGSRGSGRTPLDWGNRMKIALSAARGIARLHV---CKV  407

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  408  IHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYS  467

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ +H ++E+EMVQ
Sbjct  468  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRFH-NIEEEMVQ  526

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  527  LLQIAMACVSTVPDQRPAMQEVVRMIEDMNRAETDDGLRQSSDD  570



>ref|XP_010098956.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB76258.1| putative inactive receptor kinase [Morus notabilis]
Length=659

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYDF+  GSLSAL+HG+R S R  LDW++R++IA GAARG+ H+H     ++
Sbjct  416  YSKDEKLLVYDFMAAGSLSALLHGSRGSGRTPLDWDSRMRIAIGAARGLTHLHV--SEKI  473

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D + C+SDFGL  L G +T P R AGYRAPEV ETRK T KSDVYS
Sbjct  474  VHGNIKSSNILLRPDHDACVSDFGLHSLFGSSTPPNRVAGYRAPEVFETRKFTFKSDVYS  533

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  534  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  592

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AM+CV  VP+ RP M EV+RMIE++ + + D+  R SS+D
Sbjct  593  LLQIAMSCVSTVPDQRPGMQEVLRMIEDMNRGETDDGLRQSSDD  636



>gb|EEC75189.1| hypothetical protein OsI_11426 [Oryza sativa Indica Group]
Length=495

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 172/225 (76%), Gaps = 4/225 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE--SRMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKL+VY++V  GS SA++HG +    +  LDWNTR+KI  G ARG+AHIH+  G++
Sbjct  263  YSKDEKLVVYEYVATGSFSAMLHGIKGIVEKTPLDWNTRMKIILGTARGIAHIHAEGGSK  322

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPEVIETRKSTQKSDV  488
            L HGNIK++NVLL QD N  +SD+GL+ LM F     R   GYRAPE  E+RK T KSDV
Sbjct  323  LAHGNIKATNVLLDQDHNPYVSDYGLSALMSFPISTSRVVVGYRAPETFESRKFTHKSDV  382

Query  487  YSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEM  308
            YS GVLL+E+LTGKAP+QS  Q++VVDLP+WV SVVREEWTAEVFD EL+ Y  ++EDE+
Sbjct  383  YSFGVLLMEMLTGKAPLQSQGQDDVVDLPRWVHSVVREEWTAEVFDVELMKY-LNIEDEL  441

Query  307  VQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            VQ+LQ+AMAC  + PE RP M EV+RMIEE+RQ   ++R SS +N
Sbjct  442  VQMLQLAMACTSRSPERRPTMAEVIRMIEELRQSASESRDSSNEN  486



>ref|XP_003611028.1| Probably inactive receptor-like protein kinase [Medicago truncatula]
 gb|AES93986.1| LRR receptor-like kinase [Medicago truncatula]
Length=610

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ ++GS+SAL+HG R E R+ALDWNTR+K+A GAARG+AHIHS  G +L
Sbjct  364  YSKDEKLVVYDYFSQGSISALLHGKRGEDRVALDWNTRIKLALGAARGLAHIHSKNGGKL  423

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPEVIETRKSTQKSDVY  485
             HGN+KSSN+ L     GC+SD GL  +M     P  R++GYRAPEV +TRK+TQ SDVY
Sbjct  424  VHGNVKSSNIFLNTKQYGCVSDLGLATIMSSVVQPISRASGYRAPEVTDTRKATQPSDVY  483

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLELLTGK+P+ +   +E+V L +WV SVVREEWTAEVFD EL+    ++E+EMV
Sbjct  484  SFGVVLLELLTGKSPIHTTRGDEIVHLVRWVHSVVREEWTAEVFDLELMRC-PNIEEEMV  542

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            ++LQ+AM+C  ++P+ RP M E+V+MIE +RQ D +NRPSSE+
Sbjct  543  EMLQIAMSCATRMPDQRPMMSEIVKMIENVRQLDIENRPSSEN  585



>ref|XP_004300851.1| PREDICTED: probable inactive receptor kinase At4g23740 [Fragaria 
vesca subsp. vesca]
Length=635

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ T+GS SA++HG R E R+ LDW+TRL+IA GAARG+AHIH+  G +L
Sbjct  388  YSKDEKLMVYDYHTQGSFSAMLHGRRGEDRIPLDWDTRLRIAIGAARGIAHIHTENGGKL  447

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPEVIETRKSTQKSDVY  485
             HGN+K+SN+ L     GC+SD GLT +M     P  R++GYRAPEV +TRK+ Q +DVY
Sbjct  448  VHGNVKASNIFLNTQQYGCVSDIGLTTIMSSLAAPISRASGYRAPEVTDTRKAAQPADVY  507

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLELLTGK+P+ + A +E+V L +WV SVVREEWTAEVFD EL+ Y   +E+EMV
Sbjct  508  SFGVMLLELLTGKSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDLELMRY-PGIEEEMV  566

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            ++LQ+AM+CV ++P+ RPKM +VV+MIE +R  D DNRPSSE+
Sbjct  567  EMLQIAMSCVARMPDQRPKMLDVVKMIENVRHMDNDNRPSSEN  609



>ref|XP_010047774.1| PREDICTED: probable inactive receptor kinase At2g26730 [Eucalyptus 
grandis]
 gb|KCW79754.1| hypothetical protein EUGRSUZ_C01100 [Eucalyptus grandis]
Length=663

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 174/224 (78%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLSAL+HG+R S R  LDW  RLKIA    RG+AH+H+    ++
Sbjct  420  YSKDEKLLVYDYMAAGSLSALLHGSRGSGRTPLDWENRLKIAIATGRGLAHLHAA--GKV  477

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLL  D N C+SDFGL PL G  T P R AGYRAPEV+ETR+ T +SDVYS
Sbjct  478  VHGNIKSSNVLLRPDHNACVSDFGLNPLFGTATPPNRVAGYRAPEVVETRRVTFQSDVYS  537

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  538  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQ  596

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AM+CV   P+ RP M EVVRM+EE+ + + D+  R SS+D
Sbjct  597  LLQIAMSCVAVAPDQRPPMVEVVRMMEEMNRGETDDGLRQSSDD  640



>ref|XP_011009200.1| PREDICTED: probable inactive receptor kinase At2g26730 [Populus 
euphratica]
Length=653

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV DF+  GSLSAL+HG+R S R  LDW+ R++IA   ARG+AH+H     ++
Sbjct  410  YSKDEKLLVSDFMPAGSLSALLHGSRGSGRTPLDWDNRMRIAMSTARGLAHLHI--AGKV  467

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  + + C+SD+GL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  468  IHGNIKSSNILLRPEHDACVSDYGLNPLFGTSTPPSRVAGYRAPEVVETRKVTFKSDVYS  527

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  528  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  586

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M+EVVRMIE++ + + D+  R SS+D
Sbjct  587  LLQIAMACVSTVPDQRPAMEEVVRMIEDMNRGETDDGLRQSSDD  630



>ref|XP_010249925.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nelumbo 
nucifera]
Length=649

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLSAL+HG+R S R  LDW+ R+KIA  A RG+AH+H V G ++
Sbjct  406  YSKDEKLLVYDYMPAGSLSALLHGSRGSGRTPLDWDNRMKIALSAGRGLAHLH-VSG-KI  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SN+LL  DL  CI+DFGL P+ G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  464  VHGNIKASNILLRSDLGACIADFGLNPVFGGSTPPNRVAGYRAPEVVETRKVTFKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL  Y Q++E+EMVQ
Sbjct  524  FGVLLLELLTGKAPNQASFGEEGIDLPRWVQSVVREEWTAEVFDVELTRY-QNIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP +  VVRM+E+I + + D+  R SS+D
Sbjct  583  LLQIAMACVSTVPDQRPDIQVVVRMMEDINRTETDDGLRQSSDD  626



>ref|XP_004511531.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Cicer arietinum]
Length=607

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 174/223 (78%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+  +GS+SAL+HG R E ++ LDWNTR+KIA GAARG+AHIHS  G +L
Sbjct  365  YSKDEKLIVYDYYNQGSISALLHGKRGEDKVPLDWNTRIKIALGAARGLAHIHSENGGKL  424

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPEVIETRKSTQKSDVY  485
             HGN+KSSN+ L     GC+SD GL  +M   T P  R+AGYRAPEV +TRK+TQ SDVY
Sbjct  425  IHGNVKSSNIFLNTKQYGCVSDLGLATIMSSVTQPVSRAAGYRAPEVTDTRKATQASDVY  484

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLELLTGK+P+ +   +E++ L +WV SVVREEWTAEVFD EL+    ++E+EMV
Sbjct  485  SFGVVLLELLTGKSPIHTTRGDEIIHLVRWVHSVVREEWTAEVFDLELMRC-PNIEEEMV  543

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            ++LQ+AM+CV ++ + RPKM E+V MIE +RQ D +NRPSSE+
Sbjct  544  EMLQIAMSCVVRMHDQRPKMSEIVSMIENVRQIDIENRPSSEN  586



>ref|XP_002454913.1| hypothetical protein SORBIDRAFT_03g001310 [Sorghum bicolor]
 gb|EES00033.1| hypothetical protein SORBIDRAFT_03g001310 [Sorghum bicolor]
Length=560

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 168/222 (76%), Gaps = 3/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+ +RGS+S ++HG R E RM LDW TRLKIA GAARGVAHIH+    R 
Sbjct  317  YSKDEKLLVYDYYSRGSVSNMLHGKRGEDRMPLDWETRLKIAVGAARGVAHIHTENNGRF  376

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SNV + +   GCISD GL  LM   T   RS GY APEV +TRK++Q SDVYS
Sbjct  377  VHGNIKASNVFINKHEYGCISDLGLALLMNPITARSRSLGYCAPEVADTRKASQSSDVYS  436

Query  481  lgvlllelLTGKAPVQ-SAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GV +LELLTGK+PVQ +    EVV L +WVQSVVREEWTAEVFD EL+ Y  ++E+EMV
Sbjct  437  FGVFILELLTGKSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDGELLRY-PNIEEEMV  495

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            ++LQ+AMACV + PE RPKM +VVR IEE+R+ D   RPS+E
Sbjct  496  EMLQIAMACVSRTPERRPKMADVVRTIEEVRRSDTGTRPSTE  537



>ref|XP_010322111.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Solanum lycopersicum]
Length=594

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 172/212 (81%), Gaps = 5/212 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLS-ALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV ++V  GSLS AL  GN  +R  LDW+TRLK+  GAA+G+AHIHS  G + 
Sbjct  385  YSKDEKLLVCEYVPYGSLSSALYAGNGRTR--LDWDTRLKVCLGAAKGIAHIHSEGGTKF  442

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPEVIETRKSTQKSDVY  485
            THGNIK+SN+LLT+DL+GCISDFGL+PLM  T+I    A GY APEVIETRK TQKSDVY
Sbjct  443  THGNIKASNILLTRDLDGCISDFGLSPLMNHTSIKNNKAVGYHAPEVIETRKGTQKSDVY  502

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVL+LELLTGK+P+     E+VV+LP+WV++VV+EEWTAEVFDA L+ YH ++++EMV
Sbjct  503  SFGVLVLELLTGKSPLPLPGHEDVVNLPRWVRAVVKEEWTAEVFDAVLMKYH-NIQEEMV  561

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
             +LQ+A+ CV KVP+MRP M EV++MIE+I+ 
Sbjct  562  HMLQIALLCVAKVPDMRPSMGEVIKMIEQIKH  593



>ref|XP_009371417.1| PREDICTED: probable inactive receptor kinase At2g26730 [Pyrus 
x bretschneideri]
Length=655

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 179/224 (80%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLV D+++ GSLSAL+HG+R S R  LDW+ R+KIA  AARG+AH+H V G ++
Sbjct  411  FSKDEKLLVSDYMSAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLH-VSG-KV  468

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  469  VHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYS  528

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  529  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  587

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRM+E++ + + D+  R SS+D
Sbjct  588  LLQIAMACVSTVPDQRPAMQEVVRMMEDMNRAETDDGLRQSSDD  631



>gb|KHN37771.1| Putative inactive receptor kinase [Glycine soja]
Length=297

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 170/225 (76%), Gaps = 7/225 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSLSAL+HG+R S R  LDW+TR+KIA GAARG+A +H     +L
Sbjct  53   YSKDEKLLVYDYMAAGSLSALLHGSRGSGRTPLDWDTRMKIALGAARGLACLHV--SCKL  110

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+L       C+SDFGL P+        R AGYRAPEV ETRK T KSDVYS
Sbjct  111  VHGNIKSSNILFHPTHEACVSDFGLNPIFANPVPLNRVAGYRAPEVQETRKVTFKSDVYS  170

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVL+LELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFDAEL+ YH ++E+EMVQ
Sbjct  171  FGVLMLELLTGKAPNQASLSEEGIDLPRWVQSVVREEWTAEVFDAELMRYH-NIEEEMVQ  229

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN---RPSSED  176
            LLQ+AM CV  VP+ RP MDEVV MI++I + +  +   R SS+D
Sbjct  230  LLQIAMTCVSLVPDQRPNMDEVVHMIQDISRSETTDDGLRQSSDD  274



>gb|KJB64834.1| hypothetical protein B456_010G067400 [Gossypium raimondii]
Length=651

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 173/224 (77%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            Y+ DEKLLVYDF+  GSLSAL+HG+R S R  LDW+ R+KIA   ARG+ H+H    A+L
Sbjct  409  YAIDEKLLVYDFMHDGSLSALLHGSRGSGRTPLDWDNRMKIALSTARGLEHLHV--SAKL  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D   CISDFGL PL G TT P R AGYRAPE++ET K T +SDVYS
Sbjct  467  VHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEILETCKVTFESDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH S+E+EMVQ
Sbjct  527  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-SIEEEMVQ  585

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AM CV  VP+ RP M EVVRMIE++ + + D+  R SS+D
Sbjct  586  LLQIAMTCVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDD  629



>gb|AFK45382.1| unknown [Medicago truncatula]
Length=610

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ ++GS+SAL+HG R E R+ALDWNTR+K+A GAARG+AHIHS  G +L
Sbjct  364  YSKDEKLVVYDYFSQGSISALLHGKRGEDRVALDWNTRIKLALGAARGLAHIHSKNGGKL  423

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPEVIETRKSTQKSDVY  485
             HGN+KSSN+ L     GC+SD GL  +M     P  R++GYRAPEV +TRK+TQ SDVY
Sbjct  424  VHGNVKSSNIFLNTKQYGCVSDLGLATIMSSVVQPISRASGYRAPEVTDTRKATQPSDVY  483

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLELLTGK+P+ +   +E+V L +WV SVVREEWTAEVFD EL+    ++E+EMV
Sbjct  484  SFGVVLLELLTGKSPIHTTRGDEIVHLVRWVHSVVREEWTAEVFDLELMRC-PNIEEEMV  542

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            ++LQ+AM+C  ++P+ RP M E+V+MIE +RQ D +NRP+SE+
Sbjct  543  EMLQIAMSCATRMPDQRPMMSEIVKMIENVRQLDIENRPTSEN  585



>ref|XP_008813233.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=636

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 174/225 (77%), Gaps = 12/225 (5%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES--RMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKLLVYD+V  GS S L+HG +    R  LDW++R+++  G A GVAHIHS  G +
Sbjct  407  YSKDEKLLVYDYVPTGSFSTLLHGMKRGGERTPLDWDSRVRVILGTAHGVAHIHSEGGPK  466

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYRAPEVIETRKSTQ  500
              HGNIKSSN+LL+QDLN  +SD+GL+PLM     PP +      GYRAPE +ETRK TQ
Sbjct  467  FVHGNIKSSNILLSQDLNPFVSDYGLSPLMN----PPATLSQVVVGYRAPETVETRKVTQ  522

Query  499  KSDVYSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSM  320
            KSDVYS GVLLLE+LTGKAP+QS   ++V DLP+WVQSVVREEWTAEVFD EL+ Y Q++
Sbjct  523  KSDVYSFGVLLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEWTAEVFDVELMRY-QNI  581

Query  319  EDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPS  185
            E+E+V++L +AM+CV + PE RP+M++V+RMIEEIR+   ++RPS
Sbjct  582  EEELVRMLHIAMSCVARTPEQRPRMEDVIRMIEEIRKSGSESRPS  626



>ref|XP_003518282.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=648

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 175/224 (78%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVP-GAR  665
            YSKDEKLLVYD+++RGSL +L+HGNR   R  LDW++R+KIA GAA+G+A IH+    ++
Sbjct  419  YSKDEKLLVYDYISRGSLFSLLHGNRGMGRAPLDWDSRMKIALGAAKGIASIHTDHMDSK  478

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
            LTHGNIKSSNVL+ Q  +GCI+D GLTP+M   +   R+ GYRAPEV E R+ TQKSDVY
Sbjct  479  LTHGNIKSSNVLINQQHDGCITDVGLTPMMSTQSTMSRANGYRAPEVTEYRRITQKSDVY  538

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLELLTGKAP+     E++VDLP+WV+SVVREEWTAEVFD EL+   Q  E+EMV
Sbjct  539  SFGVLLLELLTGKAPLGYPGYEDMVDLPRWVRSVVREEWTAEVFDEELLR-GQYFEEEMV  597

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            Q+LQ+A+ACV KV + RP MDE VR IEEIR P+  NR +S ++
Sbjct  598  QMLQIALACVAKVSDNRPTMDETVRNIEEIRLPELKNRNTSSES  641



>ref|XP_010921193.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=634

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 169/216 (78%), Gaps = 11/216 (5%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GS S L+HGNR S R  LDW++R+K+  G A G+AHIHS  G + 
Sbjct  407  YSKDEKLLVYDYVPTGSFSTLLHGNRGSERTPLDWDSRVKVILGTAHGIAHIHSEGGPKF  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYRAPEVIETRKSTQK  497
             HGNIKSSN+LL QDLN  +SD+GL+PLM     PP +      GYRAPE +ETRK TQK
Sbjct  467  VHGNIKSSNILLGQDLNPLVSDYGLSPLMN----PPATLSQLMVGYRAPETMETRKITQK  522

Query  496  SDVYSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSME  317
            SDVYS GV+LLE+LTGKAP+QS   ++V DLP+WVQSVVREEWTAEVFD EL+  H + E
Sbjct  523  SDVYSFGVVLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEWTAEVFDVELMMDHNN-E  581

Query  316  DEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            +E+V++LQ+AM+CV + PE RP+M++VVRMIEEIR+
Sbjct  582  EELVRMLQIAMSCVARTPEQRPRMEDVVRMIEEIRK  617



>ref|XP_008376328.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=635

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 173/220 (79%), Gaps = 3/220 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +S +EKLLVY+++  GSL A +HGN +  R  LDW++R+KI+ G A+G+AHIHSV GA+ 
Sbjct  409  FSTEEKLLVYNYMPAGSLFAHLHGNSDIGRSPLDWDSRVKISLGIAKGLAHIHSV-GAKC  467

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            +HGNIKS+N+LLTQ+L  CISD GL+PLM F     R+ GYR PE I+ RK+T KSDVYS
Sbjct  468  SHGNIKSTNILLTQELEACISDVGLSPLMNFPPAMSRAIGYRPPEAIDMRKTTHKSDVYS  527

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGKA ++    + VVDLP+WV+SVVREEWTAEVFD EL+ +H  +E+EMVQ
Sbjct  528  FGVLLLEMLTGKATLEYLGHDCVVDLPRWVKSVVREEWTAEVFDLELLKHHH-IEEEMVQ  586

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSS  182
            +LQ+A+ACV K+PE RP MDEVVRMI E+RQ D   RPSS
Sbjct  587  VLQIALACVTKLPETRPNMDEVVRMIGELRQSDTKTRPSS  626



>dbj|BAB62593.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB93368.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAY76289.1| hypothetical protein OsI_04221 [Oryza sativa Indica Group]
Length=637

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 175/225 (78%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMA-LDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GSL+ ++HGN+ +  A LDW TR+KI+ G ARG+AH+H+  G + 
Sbjct  407  YSKDEKLLVYDYIPSGSLAVVLHGNKATGKAPLDWETRVKISLGVARGIAHLHAEGGGKF  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGN+KSSN+LL+Q+L+GC+S+FGL  LM     P R  GYRAPEV+ET+K TQKSDVYS
Sbjct  467  IHGNLKSSNILLSQNLDGCVSEFGLAQLMTIPPAPARLVGYRAPEVLETKKPTQKSDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVL+LE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWTAEVFD +L+  H ++EDEMV
Sbjct  527  FGVLVLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDVDLLR-HPNIEDEMV  585

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQVAMACV   P+ RPKMDEV+R I EIR     +R   E+ +
Sbjct  586  QMLQVAMACVAAPPDQRPKMDEVIRRIVEIRNSYSGSRTPPEEKQ  630



>gb|KHN25658.1| Putative inactive receptor kinase [Glycine soja]
Length=425

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 175/227 (77%), Gaps = 5/227 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ T+GSLSAL+HG R E R+ LDW+ R+KIA GAARG+A IH   G +L
Sbjct  189  YSKDEKLMVYDYYTQGSLSALLHGKRGEDRVPLDWDNRMKIALGAARGLACIHCENGGKL  248

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPEVIETRKSTQKSDVY  485
             HGNI+SSN+ L     GC+SD GL  +M    IP  R+AGYRAPEV +TRK+TQ SDVY
Sbjct  249  VHGNIRSSNIFLNSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEVTDTRKATQPSDVY  308

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLELLTGK+PV +   +E+V L +WV SVVREEWTAEVFD ELI Y  ++E+EMV
Sbjct  309  SFGVVLLELLTGKSPVYTTGSDEIVHLVRWVHSVVREEWTAEVFDLELIRY-PNIEEEMV  367

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDF-DNRPS-SEDNK  170
            ++LQ+AM+CV +VP+ RPKM E+V+MIE +RQ +   N+PS S +N+
Sbjct  368  EMLQIAMSCVVRVPDQRPKMLELVKMIENVRQIEIVVNQPSISSENQ  414



>ref|XP_006644911.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=630

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 175/225 (78%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GSL+A++HGN+ + R  LDW TR+KI+ G ARG+AH+H+    + 
Sbjct  405  YSKDEKLLVYDYVPSGSLAAVLHGNKAAGRAPLDWETRVKISLGVARGLAHLHAEGSGKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGN+KSSN+LL+Q+L+GC+S+FGL  LM     P R  GYRAPEV+ET+K TQKSDVYS
Sbjct  465  IHGNLKSSNILLSQNLDGCVSEFGLAQLMTIPPAPARLVGYRAPEVLETKKPTQKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVL+LE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWTAEVFD +L+  H ++EDEMV
Sbjct  525  FGVLVLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDVDLLR-HPNIEDEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQVAMACV   PE RPKMDEV++ I EIR     +R   E+ +
Sbjct  584  QMLQVAMACVAIPPEQRPKMDEVIKKILEIRNSYSGSRTPPEEKQ  628



>ref|XP_004139332.1| PREDICTED: probable inactive receptor kinase At2g26730 [Cucumis 
sativus]
 gb|KGN60644.1| Protein kinase [Cucumis sativus]
Length=653

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 167/209 (80%), Gaps = 4/209 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+++ GSLSA +HG+R S R  LDW++R++IA  A RG+AH+H     ++
Sbjct  409  FSKDEKLLVYDYISTGSLSASLHGSRGSGRTPLDWDSRMRIALSAGRGLAHLHLT--GKV  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D + CISDFGL PL G  T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  467  VHGNIKSSNILLRPDHDACISDFGLNPLFGTATPPNRVAGYRAPEVVETRKVTFKSDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q +  E+ +DLP+WVQSVVREEWTAEVFDAEL+ +H  +E+EMVQ
Sbjct  527  YGVLLLELLTGKAPNQQSLGEDGIDLPRWVQSVVREEWTAEVFDAELMRFHN-IEEEMVQ  585

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEI  215
            LLQ+AM+CV  VP+ RP M EVVRMIE++
Sbjct  586  LLQIAMSCVSTVPDQRPAMPEVVRMIEDM  614



>ref|XP_008458016.1| PREDICTED: probable inactive receptor kinase At2g26730 [Cucumis 
melo]
Length=652

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 167/209 (80%), Gaps = 4/209 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD+++ GSLSA +HG+R S R  LDW++R++IA  A RG+AH+H     ++
Sbjct  408  FSKDEKLLVYDYISTGSLSASLHGSRGSGRTPLDWDSRMRIALSAGRGLAHLHLT--GKV  465

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL  D + CISDFGL PL G  T P R AGYRAPEV+ETRK T KSDVYS
Sbjct  466  VHGNIKSSNILLRPDHDACISDFGLNPLFGTATPPNRVAGYRAPEVVETRKVTFKSDVYS  525

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q +  E+ +DLP+WVQSVVREEWTAEVFDAEL+ +H  +E+EMVQ
Sbjct  526  YGVLLLELLTGKAPNQQSLGEDGIDLPRWVQSVVREEWTAEVFDAELMRFHN-IEEEMVQ  584

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEI  215
            LLQ+AM+CV  VP+ RP M EVVRMIE++
Sbjct  585  LLQIAMSCVSTVPDQRPAMPEVVRMIEDM  613



>ref|XP_011084098.1| PREDICTED: probable inactive receptor kinase At2g26730 [Sesamum 
indicum]
Length=672

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 180/227 (79%), Gaps = 9/227 (4%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD++  GSLSAL+HG+R S R  L+W+ RL+IA  AARG+AH+H V G+ +
Sbjct  425  FSKDEKLLVYDYMPAGSLSALLHGSRGSGRTPLEWDNRLRIALSAARGLAHLH-VSGS-V  482

Query  661  THGNIKSSNVLLTQD-LNGCISDFGLTPLMGFTTIPP--RSAGYRAPEVIETRKSTQKSD  491
             HGNIKSSNVLL QD LN C+SD+GL PL   +T PP  R  GYRAPEV+ETRK T KSD
Sbjct  483  VHGNIKSSNVLLKQDNLNACVSDYGLNPLFLNSTTPPNHRIMGYRAPEVLETRKVTFKSD  542

Query  490  VYSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDE  311
            VYS GVLLLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+E
Sbjct  543  VYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NVEEE  601

Query  310  MVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            MVQLLQ+ MACV  VP+ RP M EV+RMIE++ + D D+  R SS+D
Sbjct  602  MVQLLQIGMACVATVPDQRPTMQEVLRMIEDMNRGDTDDGLRQSSDD  648



>ref|XP_010662595.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662596.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662597.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662598.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 174/222 (78%), Gaps = 3/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYDF  +GS+S+++HG R + R++LDW TRL+IA GAARG+AHIH+  G +L
Sbjct  383  YSKDEKLMVYDFYGQGSVSSILHGRRGDGRVSLDWETRLRIALGAARGIAHIHTENGGKL  442

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIK+SN+ L     GC+SD GL  LM  T +P  R+AGYRAPEV +TRK++Q SDVY
Sbjct  443  VHGNIKASNIFLNSRRYGCVSDLGLGTLMTPTPMPMTRAAGYRAPEVTDTRKASQASDVY  502

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLELLTGK+P+ +   +EV+ L +WV SVVREEWTAEVFD EL+ Y  ++E+EMV
Sbjct  503  SFGVLLLELLTGKSPIHNTGGDEVIHLVRWVNSVVREEWTAEVFDVELLRY-PNIEEEMV  561

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            ++LQ+ M CV K+PE RPKM EVV+M+E I+Q +  NRPSSE
Sbjct  562  EMLQIGMNCVVKMPEQRPKMAEVVKMMESIQQVNTGNRPSSE  603



>ref|NP_001050019.1| Os03g0332900 [Oryza sativa Japonica Group]
 gb|ABF95778.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95779.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11933.1| Os03g0332900 [Oryza sativa Japonica Group]
 dbj|BAG95872.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59003.1| hypothetical protein OsJ_10722 [Oryza sativa Japonica Group]
Length=634

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 172/225 (76%), Gaps = 4/225 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR--ESRMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKL+VY++V  GS SA++HG +    +  LDWNTR+KI  G ARG+AHIH+  G++
Sbjct  402  YSKDEKLVVYEYVATGSFSAMLHGIKGIAEKTPLDWNTRMKIILGTARGIAHIHAEGGSK  461

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPEVIETRKSTQKSDV  488
            L HGNIK++NVLL QD N  +SD+GL+ LM F     R   GYRAPE  E+RK T KSDV
Sbjct  462  LAHGNIKATNVLLDQDHNPYVSDYGLSALMSFPISTSRVVVGYRAPETFESRKFTHKSDV  521

Query  487  YSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEM  308
            YS GVLL+E+LTGKAP+QS  Q++VVDLP+WV SVVREEWTAEVFD EL+ Y  ++EDE+
Sbjct  522  YSFGVLLMEMLTGKAPLQSQGQDDVVDLPRWVHSVVREEWTAEVFDVELMKY-LNIEDEL  580

Query  307  VQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            VQ+LQ+AMAC  + PE RP M EV+RMIEE+RQ   ++R SS +N
Sbjct  581  VQMLQLAMACTSRSPERRPTMAEVIRMIEELRQSASESRDSSNEN  625



>gb|EPS74415.1| hypothetical protein M569_00340 [Genlisea aurea]
Length=629

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 173/216 (80%), Gaps = 8/216 (4%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIH----SVP  674
            +SKDEKLLVY+++  GSLSA +HGNRE  R ALDW+ RL IA GAARG+AHIH     V 
Sbjct  403  FSKDEKLLVYEYMPAGSLSAALHGNREMGRTALDWDARLNIALGAARGLAHIHHSEDDVD  462

Query  673  GARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKS  494
                 HGNIKSSN+LLT +L+GC+SDFGL+ ++ +  +  R AGYRAPEVIETRK +QKS
Sbjct  463  ANHHIHGNIKSSNILLTLNLDGCVSDFGLSSMLSYIQVKHRVAGYRAPEVIETRKVSQKS  522

Query  493  DVYSlgvlllelLTGKAPVQ--SAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSM  320
            DVYS GVLLLE+LTGK+P+Q  +    +VVDLP+WV+SVVREEWTAEVFD EL+   +++
Sbjct  523  DVYSFGVLLLEMLTGKSPLQHTTGYNNDVVDLPRWVRSVVREEWTAEVFDEELLKL-KNI  581

Query  319  EDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  212
            E+E+VQ+LQ+A++CV KVPE+RP M EVVRMIEEIR
Sbjct  582  EEELVQMLQIALSCVAKVPEIRPTMVEVVRMIEEIR  617



>ref|XP_003564492.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=633

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 169/212 (80%), Gaps = 3/212 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GSL+A++HGN+ + R  LDW TR+KI+ G ARG+AH+H+    + 
Sbjct  406  YSKDEKLLVYDYVPSGSLAAVLHGNKTTGRAPLDWETRVKISLGVARGIAHLHAEGSGKF  465

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
            THGN+KSSN+LL+Q+L+GC S+FGL  LM     P R  GYRAPEV+ET+K TQKSDVYS
Sbjct  466  THGNLKSSNILLSQNLDGCASEFGLAQLMSNVPAPARLIGYRAPEVMETKKPTQKSDVYS  525

Query  481  lgvlllelLTGKAPVQSAAQEEVV-DLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +++ V DLP+WVQSVVREEWTAEVFD +L+  H ++EDEMV
Sbjct  526  FGVLLLEMLTGKAPLRSPGRDDSVGDLPRWVQSVVREEWTAEVFDVDLLR-HPNIEDEMV  584

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            QLLQVAMACV   PE RPKM+EVV  I EIR 
Sbjct  585  QLLQVAMACVAIPPEQRPKMEEVVGRITEIRN  616



>ref|XP_004970381.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Setaria 
italica]
Length=635

 Score =   263 bits (671),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV+D+V  GSL+A++HGN+ + R  LDW TR+KI+   ARG+AH+H+  G + 
Sbjct  405  YSKDEKLLVFDYVPSGSLAAVLHGNKSAGRAPLDWETRVKISLDVARGIAHLHAEGGGKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SNVLL+Q+ +GC+S+FGL  LM      PR  GYRAPEV+ET+KSTQKSDVYS
Sbjct  465  IHGNIKASNVLLSQNQDGCVSEFGLAQLMTTPQAAPRLVGYRAPEVLETKKSTQKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWTAEVFD +L+  H ++EDEMV
Sbjct  525  FGVLLLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDVDLLR-HPNVEDEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            Q+LQ+AMACV  VP+ RPKM+EV+R I EIR 
Sbjct  584  QMLQIAMACVAAVPDQRPKMEEVIRRITEIRN  615



>ref|XP_009336254.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=654

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 175/222 (79%), Gaps = 5/222 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+  +GS+SAL+HG R E R  LDW+TRL+IA GAARG+AHIH+  G +L
Sbjct  414  YSKDEKLMVYDYYNQGSISALLHGRRGEDRNPLDWDTRLRIAIGAARGIAHIHTANGGKL  473

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPP--RSAGYRAPEVIETRKSTQKSDV  488
             HGN+K+SN+ +     GC+SD GL  +M  +  PP  R+AGYRAPEV +TRKS Q +DV
Sbjct  474  VHGNVKASNIFVNTQQYGCVSDVGLATIMS-SLAPPISRAAGYRAPEVTDTRKSGQPADV  532

Query  487  YSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEM  308
            YS GV+LLELLTGK+P+ + A +E+V L +WV SVVREEWTAEVFD EL+ Y  ++E+EM
Sbjct  533  YSFGVVLLELLTGKSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDIELMRY-LNIEEEM  591

Query  307  VQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSS  182
            V++LQ+AM+CV ++P+ RPKM +VV+MIE +RQ D DNRPSS
Sbjct  592  VEMLQIAMSCVVRMPDQRPKMLDVVKMIESVRQADNDNRPSS  633



>ref|XP_002456542.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
 gb|EES01662.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
Length=635

 Score =   263 bits (671),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV+D+V  GSL+A++HGN+ S R  L+W TR+KI+   ARG+AH+H+  G + 
Sbjct  405  YSKDEKLLVFDYVPSGSLAAVLHGNKASGRAPLNWETRVKISLDVARGIAHLHAEGGGKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SNVLL+Q+L+GC+S+FGL  +M      PR  GYRAPEV+ET+KSTQKSDVYS
Sbjct  465  IHGNIKASNVLLSQNLDGCVSEFGLAQIMTTPQTAPRLVGYRAPEVLETKKSTQKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWTAEVFD +L+  H ++EDEMV
Sbjct  525  FGVLLLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDVDLLR-HPNVEDEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            Q+LQ+AMACV   PE RPKM+EV+R I EIR 
Sbjct  584  QMLQIAMACVAIAPEQRPKMEEVIRRITEIRN  615



>ref|XP_010254253.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nelumbo 
nucifera]
Length=648

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 174/224 (78%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYDF+  GSLSAL+HG+R S R  LDW+ R+KIA  A RG+AH+H     ++
Sbjct  406  YSKDEKLLVYDFMPSGSLSALLHGSRGSGRTPLDWDNRIKIALSAGRGLAHLHV--SEKI  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SN+LL  DL  C++DFGL PL G    P R AGYRAPEV+ETR+ T KSDVYS
Sbjct  464  VHGNIKASNILLRSDLEACLADFGLNPLFGSAVPPNRVAGYRAPEVVETRRVTFKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP  ++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  524  FGVLLLELLTGKAPNLASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  582

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            LLQ+AMACV  VP  RP +++VVRMIE++ + + D+  R SS+D
Sbjct  583  LLQIAMACVSIVPAERPPIEQVVRMIEDMNRTETDDGLRQSSDD  626



>gb|KHN25793.1| Putative inactive receptor kinase [Glycine soja]
Length=642

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 174/224 (78%), Gaps = 4/224 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY+++  GSL  L+HGNR + R  LDW++R+KI  GAA+G+A IHS  G + 
Sbjct  411  YSKDEKLLVYNYMPGGSLFFLLHGNRGAGRTPLDWDSRVKILLGAAKGIAFIHSEGGPKF  470

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKS+NVL+TQ+L+GCISD GL PLM       R+ GYRAPEV +++K T KSDVYS
Sbjct  471  AHGNIKSTNVLITQELDGCISDVGLPPLMNTPATMSRANGYRAPEVTDSKKITHKSDVYS  530

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK P++    E+VVDLP+WV+SVVREEWTAEVFD EL+   Q +E+EMVQ
Sbjct  531  FGVLLLEMLTGKTPLRYPGYEDVVDLPRWVRSVVREEWTAEVFDEELLR-GQYVEEEMVQ  589

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN--RPSSED  176
            +LQ+A+ACV K P+ RP+MD+VVRM+EEI+ P+  N  R SSE 
Sbjct  590  MLQIALACVAKGPDQRPRMDQVVRMLEEIKHPELKNYHRQSSES  633



>ref|XP_007141331.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 ref|XP_007141332.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13325.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13326.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
Length=644

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 178/225 (79%), Gaps = 3/225 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHS-VPGAR  665
            +SKDEKLLVYD++  GSL +L+HGNR   R  LDW++R+KIA GAA+G+A IH+    ++
Sbjct  415  FSKDEKLLVYDYMPGGSLFSLLHGNRGMGRAPLDWDSRMKIALGAAKGIASIHTDHMDSK  474

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
            LTHGNIKSSNVL+TQ+ +GCI+D GLTP+M   +   ++ GYRAPEV E R+ TQKSDVY
Sbjct  475  LTHGNIKSSNVLITQEHDGCITDVGLTPVMTTQSTMSKTNGYRAPEVTEYRRITQKSDVY  534

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLE+LTGKAP+  +  E++VDLP+WV+SVVREEWTAEVFD EL+   Q  E+EMV
Sbjct  535  SFGVLLLEMLTGKAPMGYSGYEDMVDLPRWVRSVVREEWTAEVFDEELLR-GQYFEEEMV  593

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            Q+LQ+A+ACV KV + RP MDE VR IEEIR PD +NR +S +++
Sbjct  594  QMLQIALACVAKVADNRPTMDETVRNIEEIRLPDLNNRNTSSESE  638



>ref|XP_008810859.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=644

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 170/226 (75%), Gaps = 11/226 (5%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESR-MALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+ S L+HGNR +    LDW++R+KI  G A G+AHIHS  G + 
Sbjct  413  YSKDEKLLVYDYVPTGNFSTLLHGNRGTEGTPLDWDSRVKIILGTAHGIAHIHSEGGPKF  472

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYRAPEVIETRKSTQK  497
             HGNIKSSNVLL  DLN  +SD+GL+PLM     PP +      GYRAPE IETRK TQK
Sbjct  473  VHGNIKSSNVLLNHDLNPFVSDYGLSPLMN----PPANLSRVVVGYRAPETIETRKITQK  528

Query  496  SDVYSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSME  317
            SDVYS GVLLLE+LTGKAP+Q    ++V DLP+WVQSVVREEWTAEVFD EL+ Y Q++E
Sbjct  529  SDVYSFGVLLLEMLTGKAPLQGQGHDDVADLPRWVQSVVREEWTAEVFDVELLRY-QNIE  587

Query  316  DEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +++VQ+LQ+AM+CV + PE RP+M+EV+ MI EI+Q     RPS E
Sbjct  588  EQLVQMLQIAMSCVARTPEQRPRMEEVITMIGEIQQFGSKGRPSLE  633



>ref|XP_008649769.1| PREDICTED: probable inactive receptor kinase At5g58300 [Zea mays]
 ref|XP_008649770.1| PREDICTED: probable inactive receptor kinase At5g58300 [Zea mays]
 gb|AFW78394.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=634

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 175/225 (78%), Gaps = 4/225 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSV-PGAR  665
            YSKDEKLLVYD+V  GSL A +HGN+ + R  LDW TR+KIA G ARG+A++HSV  G +
Sbjct  405  YSKDEKLLVYDYVPLGSLCAALHGNKAAGRTPLDWETRVKIALGTARGMAYLHSVGSGGK  464

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVY  485
              HGNIKSSN+LL+Q+L  C+++FGL  LM    + PR  GYR+PEV+ETRK TQKSDVY
Sbjct  465  FIHGNIKSSNILLSQELGACVTEFGLAQLMSTPHVHPRLVGYRSPEVLETRKPTQKSDVY  524

Query  484  SlgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEM  308
            S GVLLLE+LTGKAP++S  +++ ++ LP+WVQSVVREEWT+EVFD +L+  H ++EDEM
Sbjct  525  SFGVLLLEMLTGKAPLRSPGRDDSIEHLPRWVQSVVREEWTSEVFDVDLLR-HPNLEDEM  583

Query  307  VQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            VQ+L VAMACV  VP+ RP+M+EVV  IEEIR    D + S EDN
Sbjct  584  VQMLHVAMACVAVVPDERPRMEEVVGRIEEIRSSYSDTKTSPEDN  628



>ref|XP_003568238.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=634

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 170/210 (81%), Gaps = 4/210 (2%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GSLSA +HGN+ + R  LDW  R+KI+ GAARG+AH+H+  G + 
Sbjct  403  YSKDEKLLVYDYVLAGSLSAALHGNKSAGRTPLDWGARVKISLGAARGIAHLHA-EGGKF  461

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKS+N+LL+Q+L+ C+S+FGL  LM    IPPR  GYRAPEV+ET+K TQKSDVYS
Sbjct  462  IHGNIKSNNILLSQELSACVSEFGLAQLMATPHIPPRLVGYRAPEVLETKKPTQKSDVYS  521

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +++ ++ LP+WVQSVVREEWT+EVFD +L+  H + EDEMV
Sbjct  522  FGVLLLEMLTGKAPLRSPGRDDSIEHLPRWVQSVVREEWTSEVFDVDLLR-HPNTEDEMV  580

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEI  215
            Q+LQVAMACV   P+ RP+M+EVVR IEEI
Sbjct  581  QMLQVAMACVAVAPDQRPRMEEVVRRIEEI  610



>ref|XP_010109178.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC21107.1| putative inactive receptor kinase [Morus notabilis]
Length=635

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 170/223 (76%), Gaps = 2/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESR-MALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVY+++  GSL   +HG R +    L+W+ R+KI+ GAA+G+AHIHS  G + 
Sbjct  407  YSKDEKLLVYNYMPVGSLFTRLHGFRGAESTPLNWDLRVKISLGAAKGIAHIHSEGGPKC  466

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSNVLL+QDL  CI+DFGL  ++ F  I  R  GYRAPE I+TRK TQKSDVYS
Sbjct  467  IHGNIKSSNVLLSQDLEACITDFGLAQIVNFPPIISRILGYRAPEAIDTRKLTQKSDVYS  526

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLE+LTGK P++     EVVDLP+WV+SVVREEWT+EVFD E++     +E+EMVQ
Sbjct  527  FGVLLLEMLTGKIPIRYPGHNEVVDLPRWVRSVVREEWTSEVFDVEILR-QTYVEEEMVQ  585

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            +LQ+A+ACV KVP+ RP M+EVV+MIE++R P    RPSSE +
Sbjct  586  MLQIALACVSKVPDSRPNMEEVVKMIEDVRPPQTKTRPSSESD  628



>ref|XP_010938046.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=641

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 168/216 (78%), Gaps = 11/216 (5%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GS S ++HGNR + R  LDW++R+KI  G A G+AHIHS  G + 
Sbjct  410  YSKDEKLLVYDYIPTGSFSTVLHGNRGTERTPLDWDSRVKIILGTAHGIAHIHSKGGPKF  469

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYRAPEVIETRKSTQK  497
             HGNIKSSN+LL QD N  +SD+GL+PLM     PP +      GYRAPE +ETRK TQK
Sbjct  470  VHGNIKSSNILLNQDRNPFVSDYGLSPLMN----PPANLSRVVVGYRAPETMETRKITQK  525

Query  496  SDVYSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSME  317
            SDVYS GVLLLE+LTGKAP+Q    ++V DLP+WVQSVVREEWTAEVFD EL+ Y Q++E
Sbjct  526  SDVYSFGVLLLEMLTGKAPLQCQGHDDVADLPRWVQSVVREEWTAEVFDVELMRY-QNIE  584

Query  316  DEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            +++VQ+LQ+AM+CV + PE RP M+EV+RMIEEI+Q
Sbjct  585  EQLVQMLQIAMSCVARTPEQRPGMEEVIRMIEEIQQ  620



>emb|CBI22555.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 174/222 (78%), Gaps = 3/222 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYDF  +GS+S+++HG R + R++LDW TRL+IA GAARG+AHIH+  G +L
Sbjct  383  YSKDEKLMVYDFYGQGSVSSILHGRRGDGRVSLDWETRLRIALGAARGIAHIHTENGGKL  442

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIK+SN+ L     GC+SD GL  LM  T +P  R+AGYRAPEV +TRK++Q SDVY
Sbjct  443  VHGNIKASNIFLNSRRYGCVSDLGLGTLMTPTPMPMTRAAGYRAPEVTDTRKASQASDVY  502

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GVLLLELLTGK+P+ +   +EV+ L +WV SVVREEWTAEVFD EL+ Y  ++E+EMV
Sbjct  503  SFGVLLLELLTGKSPIHNTGGDEVIHLVRWVNSVVREEWTAEVFDVELLRY-PNIEEEMV  561

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            ++LQ+ M CV K+PE RPKM EVV+M+E I+Q +  NRPSSE
Sbjct  562  EMLQIGMNCVVKMPEQRPKMAEVVKMMESIQQVNTGNRPSSE  603



>ref|XP_002441272.1| hypothetical protein SORBIDRAFT_09g023570 [Sorghum bicolor]
 gb|EES19702.1| hypothetical protein SORBIDRAFT_09g023570 [Sorghum bicolor]
Length=633

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 176/224 (79%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GSL A +HGN+ + R  LDW TR+KIA GAARG+A++H+  G + 
Sbjct  405  YSKDEKLLVYDYVPLGSLCAALHGNKAAGRTPLDWETRVKIALGAARGMAYLHAEGGGKF  464

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+L++Q+L+ C+++FGL  LM    + PR  GYR+PEV+ETRK TQKSDVYS
Sbjct  465  IHGNIKSSNILISQELSACVTEFGLAQLMATPHVHPRLIGYRSPEVLETRKPTQKSDVYS  524

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +++ ++ LP+WVQSVVREEWT+EVFD +L+  H ++EDEMV
Sbjct  525  FGVLLLEMLTGKAPLRSPGRDDSIEHLPRWVQSVVREEWTSEVFDVDLLR-HPNVEDEMV  583

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            Q+L VAMACV  VP+ RP+M+EVV  IEEIR    + + S EDN
Sbjct  584  QMLHVAMACVAVVPDERPRMEEVVSRIEEIRSSYSETKTSPEDN  627



>ref|XP_008794990.1| PREDICTED: probable inactive receptor kinase At4g23740 [Phoenix 
dactylifera]
 ref|XP_008794991.1| PREDICTED: probable inactive receptor kinase At4g23740 [Phoenix 
dactylifera]
Length=642

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 174/224 (78%), Gaps = 6/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+ + GS+++L+HG R E R  LDW TR+K+A GAARG+AHIH+    +L
Sbjct  403  YSKDEKLMVYDYFSHGSVASLLHGKRGEDRPPLDWETRIKVAIGAARGIAHIHTKNNGKL  462

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPP--RSAGYRAPEVIETRKSTQKSDV  488
             HGNIKSSNV L     GC+SD GL  LM    IPP  R+AGYRAPEV++ RK++Q SDV
Sbjct  463  VHGNIKSSNVFLNNQQYGCVSDLGLASLMN-PMIPPVSRTAGYRAPEVVDLRKASQASDV  521

Query  487  YSlgvlllelLTGKAPVQ-SAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDE  311
            YS GVL+LELLTGK+P+Q     +EVV L +WVQSVVREEWTAEVFD EL+ Y  ++E+E
Sbjct  522  YSFGVLVLELLTGKSPIQIIGGGDEVVHLVRWVQSVVREEWTAEVFDVELMRY-PNIEEE  580

Query  310  MVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +V++LQ+AM CV ++PE RPKM EVVRMIE++R+ D  NRPSSE
Sbjct  581  LVEMLQIAMTCVVRMPEQRPKMSEVVRMIEDVRRFDTGNRPSSE  624



>gb|EYU35188.1| hypothetical protein MIMGU_mgv1a002709mg [Erythranthe guttata]
Length=645

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 179/232 (77%), Gaps = 13/232 (6%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVY+++  GSLS+ +HGNR + R ALDW TRL I  GAARG+AHIHS  GA+ 
Sbjct  409  FSKDEKLLVYEYMPAGSLSSALHGNRGTGRTALDWETRLNITLGAARGLAHIHSDGGAKH  468

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPP---RSAGYRAPEVI-ETR---KST  503
            THGNIKSSN+LL + L+ CISDFGL  L   TT P    R AGYRAPEVI E+R    +T
Sbjct  469  THGNIKSSNILLNESLDACISDFGLNSLSN-TTAPAVKYRVAGYRAPEVIAESRVKASAT  527

Query  502  QKSDVYSlgvlllelLTGKAPVQSAAQEE-VVDLPKWVQSVVREEWTAEVFDAELINYHQ  326
            QKSDVYS GV+LLE+LTGK+P+Q    +E VVDLP+WV+SVVREEWTAEVFD EL+ Y +
Sbjct  528  QKSDVYSFGVVLLEMLTGKSPIQYLGYDEVVVDLPRWVRSVVREEWTAEVFDVELMQY-R  586

Query  325  SMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDNK  170
            ++E+EMVQLLQ+ ++CV K  + RP MDEVVRMIE+IR   +  R SSEDN+
Sbjct  587  NIEEEMVQLLQIGLSCVAKAADARPSMDEVVRMIEDIRADKY--RTSSEDNR  636



>ref|XP_010533192.1| PREDICTED: probable inactive receptor kinase At2g26730 [Tarenaya 
hassleriana]
Length=660

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 174/225 (77%), Gaps = 7/225 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLV+DF+  GSLSAL+HG+R S R  LDW  R++IA  AARG+AHIH    A+L
Sbjct  416  YSKDEKLLVFDFLPTGSLSALLHGSRGSGRTPLDWENRMRIAITAARGLAHIHV--SAKL  473

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIK+SN+LL  +    ISDFGL  L G T  P R AGYRAPEV+ETRK+T KSDVYS
Sbjct  474  VHGNIKASNILLQPNHEARISDFGLNSLFGNTNPPNRLAGYRAPEVLETRKATSKSDVYS  533

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGK+P Q++  EE +DLP+WVQSVVREEWTAEVFD EL+ YH ++E+EMVQ
Sbjct  534  FGVLLLELLTGKSPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYH-NIEEEMVQ  592

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEI-RQPDFDN--RPSSED  176
            LLQ+AMACV  VP+ RP M EVVRMIE++ R    D+  R SS+D
Sbjct  593  LLQIAMACVSTVPDQRPAMQEVVRMIEDVSRNETTDDGLRQSSDD  637



>ref|NP_001169737.1| uncharacterized LOC100383618 precursor [Zea mays]
 gb|ACN34721.1| unknown [Zea mays]
 tpg|DAA64145.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=636

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 178/227 (78%), Gaps = 10/227 (4%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR--ESRMALDWNTRLKIAGGAARGVAHIHSVPGAR  665
            YSKDEKL+VYD++  GS+SA++HG R   ++  LDWN+R+KI  G A G+AHIHS  GA+
Sbjct  404  YSKDEKLIVYDYIDTGSVSAMLHGIRGVTAKTPLDWNSRMKIILGTAYGIAHIHSEGGAK  463

Query  664  LTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA----GYRAPEVIETRKSTQK  497
            LTHGN+KS+NVL+ QD N  +SD+GL+ L   T++P  ++    GYRAPE++E RK TQK
Sbjct  464  LTHGNVKSTNVLVDQDHNPSVSDYGLSAL---TSVPVNASRVVVGYRAPEIVENRKITQK  520

Query  496  SDVYSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSME  317
            SDVYS GVLL+E+LTGKAP+Q+   ++VVDLP+WV SVVREEWTAEVFD EL+  HQ++E
Sbjct  521  SDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVFDVELMK-HQNIE  579

Query  316  DEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            +E+VQ+LQ+AM C  K P+ RP M+EV+RMIE +RQ   ++R SS++
Sbjct  580  EELVQMLQIAMVCTAKSPDRRPTMEEVIRMIEGLRQSTSESRASSDE  626



>ref|XP_002960794.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
 ref|XP_002983874.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ14886.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ38333.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
Length=649

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 169/216 (78%), Gaps = 2/216 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            +SKDEKLLVYD++  GSLSAL+HG R + R  LDW +R++IA GAARG+ ++H   G+  
Sbjct  387  FSKDEKLLVYDYMPMGSLSALLHGTRGAGRTPLDWVSRVRIALGAARGITYLHEQGGSNF  446

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+LL ++ +  +SDFGL  L   ++   R  GYRAPEV ETRKSTQ+SDVYS
Sbjct  447  VHGNIKSSNILLKKNYDAAVSDFGLAQLFNSSSAASRIVGYRAPEVAETRKSTQRSDVYS  506

Query  481  lgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMVQ  302
             GVLLLELLTGKAP Q++  +E +DLP+WVQSVVREEWTAEVFD EL+ Y Q++E+EMVQ
Sbjct  507  FGVLLLELLTGKAPTQASLNDEGIDLPRWVQSVVREEWTAEVFDLELMRY-QNIEEEMVQ  565

Query  301  LLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDN  194
            LLQVAMACV   P+ RPKM +VVRMIE+IR  D D+
Sbjct  566  LLQVAMACVATSPDQRPKMKDVVRMIEDIRAVDTDD  601



>ref|XP_008810858.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 170/226 (75%), Gaps = 11/226 (5%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESR-MALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  G+ S L+HGNR +    LDW++R+KI  G A G+AHIHS  G + 
Sbjct  454  YSKDEKLLVYDYVPTGNFSTLLHGNRGTEGTPLDWDSRVKIILGTAHGIAHIHSEGGPKF  513

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYRAPEVIETRKSTQK  497
             HGNIKSSNVLL  DLN  +SD+GL+PLM     PP +      GYRAPE IETRK TQK
Sbjct  514  VHGNIKSSNVLLNHDLNPFVSDYGLSPLMN----PPANLSRVVVGYRAPETIETRKITQK  569

Query  496  SDVYSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSME  317
            SDVYS GVLLLE+LTGKAP+Q    ++V DLP+WVQSVVREEWTAEVFD EL+ Y Q++E
Sbjct  570  SDVYSFGVLLLEMLTGKAPLQGQGHDDVADLPRWVQSVVREEWTAEVFDVELLRY-QNIE  628

Query  316  DEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            +++VQ+LQ+AM+CV + PE RP+M+EV+ MI EI+Q     RPS E
Sbjct  629  EQLVQMLQIAMSCVARTPEQRPRMEEVITMIGEIQQFGSKGRPSLE  674



>ref|XP_004961732.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Setaria 
italica]
Length=632

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRE-SRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD+V  GSLSA +HGN+   R  LDW TR+KIA G ARG+A++H   G + 
Sbjct  404  YSKDEKLLVYDYVPLGSLSAALHGNKAVGRNPLDWETRVKIALGTARGMAYLHGEVGGKF  463

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVIETRKSTQKSDVYS  482
             HGNIKSSN+L++Q+L+ C+++FGL  LM    + PR  GYR+PE++ET+K TQKSDVYS
Sbjct  464  IHGNIKSSNILISQELSACVTEFGLAQLMAPPHVHPRLIGYRSPEILETKKPTQKSDVYS  523

Query  481  lgvlllelLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
             GVLLLE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWT+EVFD +L+  H ++EDEMV
Sbjct  524  FGVLLLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTSEVFDVDLLR-HPNVEDEMV  582

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSED  176
            Q+LQVAMACV  VP+ RP+M+EVVR IEEIR    + + S ED
Sbjct  583  QMLQVAMACVAVVPDERPRMEEVVRRIEEIRNSYSETKTSPED  625



>gb|KEH35437.1| receptor-like kinase [Medicago truncatula]
Length=347

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 169/225 (75%), Gaps = 9/225 (4%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRESRMALDWNTRLKIAGGAARGVAHIHSVPGARLT  659
            YSKD+KL+V D+  +GS+S+++HG R  R  LDW++RL+IA G ARG+AHIH+  G +L 
Sbjct  120  YSKDDKLVVSDYYQQGSVSSILHGKRRERRTLDWDSRLRIATGTARGIAHIHTQQGGKLV  179

Query  658  HGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP---PRSAGYRAPEVIETRKSTQKSDV  488
            HGNIK+SN+ L     GC+SD GL  LM  ++IP    R+ GYRAPEVI+TRK+T  SDV
Sbjct  180  HGNIKASNIFLNSQGYGCVSDIGLVTLM--SSIPSQGARATGYRAPEVIDTRKATHSSDV  237

Query  487  YSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEM  308
            YS GVLLLELLTGK PV S   E+ V L +WV+SVVREEWTAEVFD EL+ Y  S+E+EM
Sbjct  238  YSFGVLLLELLTGKPPVYSTEGEQAVHLVRWVKSVVREEWTAEVFDTELLRY-SSIEEEM  296

Query  307  VQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSEDN  173
            V++LQ+ MAC  ++P+ RPKM EVVRM+E IR    +NRPSS ++
Sbjct  297  VEMLQIGMACAARMPDQRPKMAEVVRMMEGIRH---ENRPSSTES  338



>ref|XP_010938045.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=682

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 168/216 (78%), Gaps = 11/216 (5%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNRES-RMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKLLVYD++  GS S ++HGNR + R  LDW++R+KI  G A G+AHIHS  G + 
Sbjct  451  YSKDEKLLVYDYIPTGSFSTVLHGNRGTERTPLDWDSRVKIILGTAHGIAHIHSKGGPKF  510

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYRAPEVIETRKSTQK  497
             HGNIKSSN+LL QD N  +SD+GL+PLM     PP +      GYRAPE +ETRK TQK
Sbjct  511  VHGNIKSSNILLNQDRNPFVSDYGLSPLMN----PPANLSRVVVGYRAPETMETRKITQK  566

Query  496  SDVYSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSME  317
            SDVYS GVLLLE+LTGKAP+Q    ++V DLP+WVQSVVREEWTAEVFD EL+ Y Q++E
Sbjct  567  SDVYSFGVLLLEMLTGKAPLQCQGHDDVADLPRWVQSVVREEWTAEVFDVELMRY-QNIE  625

Query  316  DEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  209
            +++VQ+LQ+AM+CV + PE RP M+EV+RMIEEI+Q
Sbjct  626  EQLVQMLQIAMSCVARTPEQRPGMEEVIRMIEEIQQ  661



>ref|XP_007038934.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY23435.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=630

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 176/224 (79%), Gaps = 7/224 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+V+D+  +GS+SAL+HG R E R +LDW TRLKIA GAARG+AHIHS    +L
Sbjct  385  YSKDEKLVVHDYYDQGSVSALLHGKRGEGRTSLDWETRLKIAVGAARGIAHIHSQNNGKL  444

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPP---RSAGYRAPEVIETRKSTQKSD  491
             HGNIK+SN+ L  +  GC+SD GL  +M  + +PP   R+AGYRAPEV +TRK+TQ SD
Sbjct  445  VHGNIKASNIFLNSEGYGCVSDIGLAAVM--SPMPPPVMRAAGYRAPEVADTRKATQASD  502

Query  490  VYSlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDE  311
            VYS GVLLLE+LTGK+P+ +   EE+V L +WV SVVREEWTAEVFD EL+ Y  ++E+E
Sbjct  503  VYSFGVLLLEILTGKSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELLRY-PNIEEE  561

Query  310  MVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFDNRPSSE  179
            MV++LQ+ M+CV ++PE RPKM ++VRM+EEIR+ +  ++PSSE
Sbjct  562  MVEMLQIGMSCVVRMPEQRPKMSDLVRMVEEIRRANAGSQPSSE  605



>emb|CDY03526.1| BnaC01g15560D [Brassica napus]
Length=256

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 171/227 (75%), Gaps = 7/227 (3%)
 Frame = -3

Query  838  YSKDEKLLVYDFVTRGSLSALMHGNR-ESRMALDWNTRLKIAGGAARGVAHIHSVPGARL  662
            YSKDEKL+VYD+   GS+++L+HGNR E+R+ LDW TR+ IA GAA+G+A IH     +L
Sbjct  20   YSKDEKLMVYDYFGNGSVASLLHGNRGENRVPLDWETRMSIAIGAAKGIARIHRENNGKL  79

Query  661  THGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPEVIETRKSTQKSDVY  485
             HGNIKSSN+ L  + NGC+SD GLT +M     P  R AGYRAPEV +TRKS+Q SDVY
Sbjct  80   VHGNIKSSNIFLNSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVY  139

Query  484  SlgvlllelLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAELINYHQSMEDEMV  305
            S GV+LLELLTGK+P+ + A +E++ L +WV SVVREEWTAEVFD EL+ Y  ++E+EMV
Sbjct  140  SFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRY-TNIEEEMV  198

Query  304  QLLQVAMACVGKVPEMRPKMDEVVRMIEEI--RQPDF--DNRPSSED  176
            ++LQ+AM+CV K P+ RPKM ++VR+IE +  RQ     D +P SE+
Sbjct  199  EMLQIAMSCVVKAPDQRPKMSDLVRLIESVGNRQASLGPDPKPKSEN  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1812563152356