BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1463

Length=827
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365013.1|  PREDICTED: subtilisin-like protease-like           348   2e-110   Solanum tuberosum [potatoes]
ref|XP_009606152.1|  PREDICTED: subtilisin-like protease SBT5.4         348   2e-110   Nicotiana tomentosiformis
emb|CDP01740.1|  unnamed protein product                                341   8e-108   Coffea canephora [robusta coffee]
ref|XP_004233282.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    340   2e-107   Solanum lycopersicum
ref|XP_010317055.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    340   3e-107   
ref|XP_009782970.1|  PREDICTED: subtilisin-like protease SBT5.4         338   2e-106   Nicotiana sylvestris
ref|XP_002300539.2|  hypothetical protein POPTR_0001s460002g            317   1e-102   
gb|KHN45603.1|  Subtilisin-like protease                                312   3e-101   Glycine soja [wild soybean]
ref|XP_010649319.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    323   4e-101   Vitis vinifera
ref|XP_011098007.1|  PREDICTED: subtilisin-like protease SBT3.5         323   5e-101   Sesamum indicum [beniseed]
ref|XP_010649320.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    322   6e-101   Vitis vinifera
ref|XP_002263237.2|  PREDICTED: subtilisin-like protease SBT3.5 i...    323   8e-101   Vitis vinifera
gb|KDP24910.1|  hypothetical protein JCGZ_24288                         318   1e-100   Jatropha curcas
ref|XP_002528535.1|  Cucumisin precursor, putative                      321   4e-100   Ricinus communis
emb|CBI37484.3|  unnamed protein product                                321   5e-100   Vitis vinifera
gb|KHN28302.1|  Subtilisin-like protease                                320   5e-100   Glycine soja [wild soybean]
ref|XP_003516513.1|  PREDICTED: subtilisin-like protease-like           317   2e-98    Glycine max [soybeans]
ref|XP_012087565.1|  PREDICTED: subtilisin-like protease SBT3.5         316   3e-98    Jatropha curcas
gb|KHN41792.1|  Subtilisin-like protease                                313   9e-98    Glycine soja [wild soybean]
ref|XP_003538919.1|  PREDICTED: subtilisin-like protease-like           314   2e-97    Glycine max [soybeans]
gb|AFK43318.1|  unknown                                                 297   4e-97    Lotus japonicus
ref|XP_003534221.1|  PREDICTED: subtilisin-like protease-like           313   5e-97    Glycine max [soybeans]
ref|XP_008379676.1|  PREDICTED: subtilisin-like protease                294   2e-96    
ref|XP_008242125.1|  PREDICTED: subtilisin-like protease                311   3e-96    Prunus mume [ume]
ref|XP_002317030.2|  hypothetical protein POPTR_0011s14930g             311   3e-96    
ref|XP_007204641.1|  hypothetical protein PRUPE_ppa001800mg             310   5e-96    Prunus persica
ref|XP_006599275.1|  PREDICTED: subtilisin-like protease-like iso...    309   5e-96    Glycine max [soybeans]
gb|KHN38839.1|  Subtilisin-like protease                                310   6e-96    Glycine soja [wild soybean]
ref|XP_003547892.1|  PREDICTED: subtilisin-like protease-like iso...    310   7e-96    Glycine max [soybeans]
ref|XP_011038086.1|  PREDICTED: subtilisin-like protease SBT3.5         309   1e-95    Populus euphratica
ref|XP_009359651.1|  PREDICTED: subtilisin-like protease SBT5.4         309   2e-95    Pyrus x bretschneideri [bai li]
ref|XP_010270603.1|  PREDICTED: subtilisin-like protease SBT5.3         309   2e-95    Nelumbo nucifera [Indian lotus]
gb|KCW53326.1|  hypothetical protein EUGRSUZ_J02574                     305   7e-95    Eucalyptus grandis [rose gum]
ref|XP_006467138.1|  PREDICTED: subtilisin-like protease-like iso...    306   9e-95    Citrus sinensis [apfelsine]
gb|KCW53325.1|  hypothetical protein EUGRSUZ_J02574                     305   1e-94    Eucalyptus grandis [rose gum]
ref|XP_006425216.1|  hypothetical protein CICLE_v10024941mg             306   2e-94    Citrus clementina [clementine]
ref|XP_007158047.1|  hypothetical protein PHAVU_002G119700g             305   5e-94    Phaseolus vulgaris [French bean]
ref|XP_010033628.1|  PREDICTED: subtilisin-like protease SBT5.4         305   5e-94    Eucalyptus grandis [rose gum]
ref|XP_009369762.1|  PREDICTED: subtilisin-like protease SBT5.4         305   6e-94    Pyrus x bretschneideri [bai li]
ref|XP_007156353.1|  hypothetical protein PHAVU_003G279300g             305   7e-94    Phaseolus vulgaris [French bean]
gb|KDO71607.1|  hypothetical protein CISIN_1g004205mg                   305   7e-94    Citrus sinensis [apfelsine]
ref|XP_007046422.1|  Subtilisin-like serine endopeptidase family ...    303   2e-93    
ref|XP_004287692.1|  PREDICTED: subtilisin-like protease SBT3.5         302   5e-93    Fragaria vesca subsp. vesca
ref|XP_008344175.1|  PREDICTED: subtilisin-like protease isoform X1     300   2e-92    
gb|KCW53324.1|  hypothetical protein EUGRSUZ_J02574                     303   3e-92    Eucalyptus grandis [rose gum]
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...    300   3e-92    
ref|XP_011004403.1|  PREDICTED: subtilisin-like protease SBT3.5         300   3e-92    Populus euphratica
ref|XP_010928976.1|  PREDICTED: subtilisin-like protease SBT3.5         300   3e-92    Elaeis guineensis
ref|XP_004512298.1|  PREDICTED: subtilisin-like protease-like iso...    300   4e-92    Cicer arietinum [garbanzo]
gb|KEH27645.1|  subtilisin-like serine protease                         299   4e-92    Medicago truncatula
ref|XP_010101169.1|  Subtilisin-like protease                           300   4e-92    
ref|XP_004512297.1|  PREDICTED: subtilisin-like protease-like iso...    300   6e-92    Cicer arietinum [garbanzo]
ref|XP_003612438.1|  Subtilisin-like protease                           299   9e-92    Medicago truncatula
ref|XP_008796284.1|  PREDICTED: subtilisin-like protease SBT5.3         298   3e-91    Phoenix dactylifera
ref|XP_010927443.1|  PREDICTED: subtilisin-like protease SBT3.5         288   4e-89    
ref|XP_004509478.1|  PREDICTED: subtilisin-like protease SDD1-lik...    287   2e-87    
ref|XP_004509477.1|  PREDICTED: subtilisin-like protease SDD1-lik...    287   3e-87    Cicer arietinum [garbanzo]
gb|KEH20335.1|  subtilisin-like serine protease                         282   1e-85    Medicago truncatula
ref|XP_003629039.1|  Serine protease-like protein                       282   2e-85    Medicago truncatula
gb|EYU31525.1|  hypothetical protein MIMGU_mgv1a001949mg                274   1e-82    Erythranthe guttata [common monkey flower]
ref|XP_009420549.1|  PREDICTED: subtilisin-like protease SBT5.3         274   3e-82    Musa acuminata subsp. malaccensis [pisang utan]
gb|ERN11499.1|  hypothetical protein AMTR_s00022p00110120               270   1e-81    Amborella trichopoda
ref|XP_006849918.2|  PREDICTED: subtilisin-like protease SBT3.5         270   4e-81    
ref|XP_008344176.1|  PREDICTED: subtilisin-like protease isoform X2     266   2e-79    
ref|XP_004965849.1|  PREDICTED: cucumisin-like                          263   5e-78    Setaria italica
ref|XP_002437302.1|  hypothetical protein SORBIDRAFT_10g024550          250   3e-73    
gb|EEE66042.1|  hypothetical protein OsJ_22024                          247   6e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01729.1|  hypothetical protein OsI_23755                          246   2e-71    Oryza sativa Indica Group [Indian rice]
ref|NP_001174909.1|  Os06g0624100                                       247   3e-71    
ref|XP_008648121.1|  PREDICTED: putative subtilase family protein...    234   5e-68    Zea mays [maize]
ref|NP_001169603.1|  putative subtilase family protein precursor        234   2e-67    Zea mays [maize]
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      187   1e-50    Setaria italica
ref|XP_007217687.1|  hypothetical protein PRUPE_ppa001727mg             187   1e-50    Prunus persica
gb|ACN35690.1|  unknown                                                 179   2e-50    Zea mays [maize]
gb|EAZ09847.1|  hypothetical protein OsI_32138                          187   2e-50    Oryza sativa Indica Group [Indian rice]
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             186   6e-50    
ref|XP_002965730.1|  hypothetical protein SELMODRAFT_407350             186   7e-50    
gb|EMT32146.1|  Subtilisin-like protease                                176   7e-50    
ref|XP_002971605.1|  hypothetical protein SELMODRAFT_95668              185   9e-50    
ref|XP_008357992.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    183   1e-49    
dbj|BAK05842.1|  predicted protein                                      184   1e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007153620.1|  hypothetical protein PHAVU_003G050900g             184   2e-49    Phaseolus vulgaris [French bean]
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    184   3e-49    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007214967.1|  hypothetical protein PRUPE_ppa001732mg             183   3e-49    Prunus persica
gb|KJB52411.1|  hypothetical protein B456_008G260500                    183   4e-49    Gossypium raimondii
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          182   6e-49    Sorghum bicolor [broomcorn]
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5         182   6e-49    Brachypodium distachyon [annual false brome]
ref|XP_008778788.1|  PREDICTED: subtilisin-like protease SBT5.4         178   7e-49    
ref|XP_008229767.1|  PREDICTED: subtilisin-like protease                182   9e-49    Prunus mume [ume]
gb|ACP18876.1|  subtilisin-like serine protease                         182   1e-48    Carica papaya [mamon]
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g             181   2e-48    Phaseolus vulgaris [French bean]
ref|XP_008342263.1|  PREDICTED: subtilisin-like protease                181   2e-48    
ref|XP_009361505.1|  PREDICTED: subtilisin-like protease SBT5.3         181   2e-48    Pyrus x bretschneideri [bai li]
emb|CDP14562.1|  unnamed protein product                                171   2e-48    Coffea canephora [robusta coffee]
ref|XP_009344070.1|  PREDICTED: subtilisin-like protease SBT5.3         181   2e-48    Pyrus x bretschneideri [bai li]
gb|AGN12874.1|  putative transcription factor DYSFUNCTIONAL TAPET...    181   2e-48    Sisymbrium irio
ref|XP_002509667.1|  Xylem serine proteinase 1 precursor, putative      181   2e-48    Ricinus communis
gb|KJB42692.1|  hypothetical protein B456_007G164000                    180   5e-48    Gossypium raimondii
gb|ERM97026.1|  hypothetical protein AMTR_s00122p00026080               179   8e-48    Amborella trichopoda
ref|XP_011629200.1|  PREDICTED: subtilisin-like protease SBT3.5         179   1e-47    Amborella trichopoda
ref|XP_003537841.1|  PREDICTED: cucumisin-like                          179   1e-47    Glycine max [soybeans]
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             179   1e-47    
gb|KHN39834.1|  Cucumisin                                               179   1e-47    Glycine soja [wild soybean]
gb|KDP25551.1|  hypothetical protein JCGZ_20707                         179   1e-47    Jatropha curcas
ref|XP_002965691.1|  hypothetical protein SELMODRAFT_407291             178   2e-47    
ref|XP_010099424.1|  Subtilisin-like protease                           174   2e-47    
ref|XP_002971639.1|  hypothetical protein SELMODRAFT_412127             178   2e-47    
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    179   2e-47    Pyrus x bretschneideri [bai li]
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    179   2e-47    Pyrus x bretschneideri [bai li]
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor     178   2e-47    Zea mays [maize]
gb|AAO61749.1|AF366558_1  subtilisin-like seed-specific protein         169   2e-47    Arachis hypogaea [goober]
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like           178   2e-47    
ref|XP_011470880.1|  PREDICTED: subtilisin-like protease SBT3.3         178   2e-47    Fragaria vesca subsp. vesca
ref|XP_009137186.1|  PREDICTED: subtilisin-like protease SBT5.3         178   2e-47    Brassica rapa
ref|XP_008392653.1|  PREDICTED: subtilisin-like protease                176   2e-47    
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             178   2e-47    
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         178   2e-47    Phoenix dactylifera
emb|CDY70485.1|  BnaA03g58450D                                          178   3e-47    Brassica napus [oilseed rape]
ref|XP_006829608.2|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    178   3e-47    
ref|XP_010445236.1|  PREDICTED: subtilisin-like protease SBT3.5         179   3e-47    
ref|NP_001267495.1|  SUB1 homolog precursor                             178   3e-47    Glycine max [soybeans]
ref|XP_010942535.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    178   3e-47    Elaeis guineensis
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3         177   3e-47    
ref|XP_010942534.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    177   4e-47    
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                177   4e-47    Malus domestica [apple tree]
ref|XP_009128706.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    177   4e-47    Brassica rapa
ref|XP_010942533.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    178   4e-47    Elaeis guineensis
ref|XP_010942532.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    178   4e-47    
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    177   5e-47    
dbj|BAC22315.1|  putative subtilisin-like serine protease AIR3          177   6e-47    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    177   6e-47    Brassica rapa
ref|XP_003524185.1|  PREDICTED: subtilisin-like protease-like           177   7e-47    Glycine max [soybeans]
ref|XP_010488664.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    177   8e-47    Camelina sativa [gold-of-pleasure]
gb|AES70685.2|  subtilisin-like serine protease                         176   1e-46    Medicago truncatula
ref|XP_008380083.1|  PREDICTED: subtilisin-like protease                175   1e-46    
ref|XP_003600434.1|  Subtilisin-like protease                           176   1e-46    
ref|XP_010514315.1|  PREDICTED: subtilisin-like protease SBT5.3         176   1e-46    
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3         176   1e-46    Sesamum indicum [beniseed]
ref|XP_002517380.1|  Xylem serine proteinase 1 precursor, putative      176   1e-46    
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3         176   1e-46    
ref|XP_012087230.1|  PREDICTED: subtilisin-like protease SBT1.2         179   1e-46    
ref|XP_004957134.1|  PREDICTED: subtilisin-like protease-like           176   1e-46    Setaria italica
ref|XP_006664000.1|  PREDICTED: subtilisin-like protease SDD1-like      176   1e-46    Oryza brachyantha
ref|XP_006662913.1|  PREDICTED: cucumisin-like                          176   2e-46    Oryza brachyantha
ref|XP_006423460.1|  hypothetical protein CICLE_v10027857mg             175   2e-46    
gb|KDO40058.1|  hypothetical protein CISIN_1g006582mg                   175   2e-46    Citrus sinensis [apfelsine]
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    176   2e-46    Nelumbo nucifera [Indian lotus]
ref|XP_006413792.1|  hypothetical protein EUTSA_v10024501mg             175   2e-46    Eutrema salsugineum [saltwater cress]
ref|XP_009394968.1|  PREDICTED: subtilisin-like protease SBT5.3         175   2e-46    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002981864.1|  hypothetical protein SELMODRAFT_115574             175   2e-46    
ref|XP_002305456.2|  hypothetical protein POPTR_0004s16850g             175   2e-46    Populus trichocarpa [western balsam poplar]
gb|AFV08661.1|  subtilisin-like protease                                175   3e-46    Glycine max [soybeans]
gb|AAK74005.1|  At2g04160/T16B23.1                                      171   3e-46    Arabidopsis thaliana [mouse-ear cress]
gb|KHN34449.1|  Subtilisin-like protease SDD1                           175   3e-46    Glycine soja [wild soybean]
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    175   3e-46    Nelumbo nucifera [Indian lotus]
emb|CBI23066.3|  unnamed protein product                                175   3e-46    Vitis vinifera
ref|XP_006660048.1|  PREDICTED: subtilisin-like protease-like           175   3e-46    
ref|XP_010436465.1|  PREDICTED: subtilisin-like protease SBT3.5         174   3e-46    
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3         175   3e-46    Nicotiana sylvestris
ref|XP_010488663.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    175   3e-46    
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             175   3e-46    Citrus clementina [clementine]
ref|XP_002273195.2|  PREDICTED: subtilisin-like protease SBT3.5         175   3e-46    Vitis vinifera
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...    175   3e-46    Citrus sinensis [apfelsine]
ref|XP_002960359.1|  hypothetical protein SELMODRAFT_437460             175   3e-46    
ref|XP_006487362.1|  PREDICTED: subtilisin-like protease SDD1-lik...    174   3e-46    Citrus sinensis [apfelsine]
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g             175   3e-46    
ref|XP_006391365.1|  hypothetical protein EUTSA_v10018142mg             175   4e-46    
ref|XP_012086639.1|  PREDICTED: subtilisin-like protease SBT3.5         175   4e-46    Jatropha curcas
dbj|BAJ34472.1|  unnamed protein product                                171   4e-46    Eutrema halophilum
gb|EYU39037.1|  hypothetical protein MIMGU_mgv1a021904mg                174   4e-46    Erythranthe guttata [common monkey flower]
gb|EEC83379.1|  hypothetical protein OsI_28793                          177   4e-46    Oryza sativa Indica Group [Indian rice]
emb|CDX94033.1|  BnaC07g36670D                                          175   4e-46    
gb|EAZ42320.1|  hypothetical protein OsJ_26892                          177   4e-46    Oryza sativa Japonica Group [Japonica rice]
emb|CAN77487.1|  hypothetical protein VITISV_020248                     174   5e-46    Vitis vinifera
ref|XP_011037192.1|  PREDICTED: subtilisin-like protease SBT3.5         174   5e-46    Populus euphratica
emb|CBI16560.3|  unnamed protein product                                174   5e-46    Vitis vinifera
ref|XP_010651399.1|  PREDICTED: subtilisin-like protease SBT3.5         174   5e-46    Vitis vinifera
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease                174   5e-46    Nicotiana tomentosiformis
ref|XP_002524587.1|  Xylem serine proteinase 1 precursor, putative      174   5e-46    Ricinus communis
ref|XP_003525747.1|  PREDICTED: subtilisin-like protease SDD1-like      174   6e-46    Glycine max [soybeans]
ref|NP_001131603.1|  uncharacterized protein LOC100192953               169   6e-46    
ref|XP_006602868.1|  PREDICTED: subtilisin-like protease-like           174   6e-46    Glycine max [soybeans]
emb|CDX94251.1|  BnaC02g29110D                                          174   6e-46    
emb|CDP06146.1|  unnamed protein product                                174   6e-46    Coffea canephora [robusta coffee]
ref|XP_010644656.1|  PREDICTED: subtilisin-like protease SBT5.4         174   6e-46    Vitis vinifera
gb|EAZ25541.1|  hypothetical protein OsJ_09366                          174   6e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010943376.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    174   6e-46    
gb|AES80526.2|  subtilisin-like serine protease                         174   6e-46    Medicago truncatula
gb|KHN40540.1|  Subtilisin-like protease                                174   6e-46    Glycine soja [wild soybean]
ref|XP_010449086.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    174   7e-46    Camelina sativa [gold-of-pleasure]
ref|XP_002967356.1|  hypothetical protein SELMODRAFT_408319             174   7e-46    
gb|ACF80197.1|  unknown                                                 167   7e-46    Zea mays [maize]
ref|NP_001063751.1|  Os09g0530800                                       174   7e-46    
ref|XP_002298974.2|  hypothetical protein POPTR_0001s45470g             174   8e-46    
ref|XP_006602865.1|  PREDICTED: subtilisin-like protease-like           174   8e-46    Glycine max [soybeans]
gb|ABF93923.1|  subtilase family protein, putative                      174   8e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002509658.1|  Xylem serine proteinase 1 precursor, putative      174   8e-46    
emb|CBI39824.3|  unnamed protein product                                174   8e-46    Vitis vinifera
ref|XP_003624308.1|  Subtilisin-like serine protease                    174   8e-46    
ref|XP_004964095.1|  PREDICTED: subtilisin-like protease-like           173   8e-46    
gb|KHN40543.1|  Subtilisin-like protease                                173   8e-46    Glycine soja [wild soybean]
ref|XP_004515784.1|  PREDICTED: subtilisin-like protease SDD1-like      173   1e-45    Cicer arietinum [garbanzo]
ref|XP_004967192.1|  PREDICTED: subtilisin-like protease-like           174   1e-45    
ref|XP_010647520.1|  PREDICTED: subtilisin-like protease SBT5.3         173   1e-45    Vitis vinifera
ref|XP_003571633.1|  PREDICTED: subtilisin-like protease SBT5.3         173   1e-45    Brachypodium distachyon [annual false brome]
ref|XP_003634152.2|  PREDICTED: subtilisin-like protease SBT3.5         173   1e-45    Vitis vinifera
ref|XP_002985742.1|  hypothetical protein SELMODRAFT_424716             172   1e-45    
gb|KEH35216.1|  subtilisin-like serine protease                         172   1e-45    Medicago truncatula
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             173   1e-45    
ref|XP_006449983.1|  hypothetical protein CICLE_v10018000mg             173   1e-45    
gb|KEH35215.1|  subtilisin-like serine protease                         172   1e-45    Medicago truncatula
gb|EEC68285.1|  hypothetical protein OsI_36335                          173   1e-45    Oryza sativa Indica Group [Indian rice]
gb|ACN36528.1|  unknown                                                 167   1e-45    Zea mays [maize]
ref|XP_002982819.1|  hypothetical protein SELMODRAFT_179856             173   1e-45    
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3         173   1e-45    Camelina sativa [gold-of-pleasure]
ref|XP_004502100.1|  PREDICTED: subtilisin-like protease-like           173   1e-45    Cicer arietinum [garbanzo]
ref|XP_010107369.1|  Subtilisin-like protease                           173   1e-45    
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5         173   1e-45    Populus euphratica
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3         173   1e-45    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011081168.1|  PREDICTED: subtilisin-like protease SDD1           173   2e-45    
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         173   2e-45    Populus euphratica
dbj|BAK07347.1|  predicted protein                                      173   2e-45    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW61874.1|  putative subtilase family protein                       173   2e-45    
ref|XP_012078498.1|  PREDICTED: subtilisin-like protease SBT5.4         173   2e-45    Jatropha curcas
ref|XP_002275429.1|  PREDICTED: subtilisin-like protease                172   2e-45    Vitis vinifera
ref|XP_002986601.1|  hypothetical protein SELMODRAFT_425502             172   2e-45    
gb|KCW88587.1|  hypothetical protein EUGRSUZ_A00964                     169   2e-45    Eucalyptus grandis [rose gum]
ref|XP_010092450.1|  Subtilisin-like protease                           167   2e-45    
ref|XP_011044970.1|  PREDICTED: subtilisin-like protease SBT5.3         172   2e-45    Populus euphratica
ref|NP_001132028.1|  uncharacterized protein LOC100193436               166   2e-45    
gb|KEH29866.1|  subtilisin-like serine protease                         172   2e-45    Medicago truncatula
ref|XP_003601486.1|  Subtilisin-like protease                           172   2e-45    Medicago truncatula
gb|KJB22186.1|  hypothetical protein B456_004G034100                    172   3e-45    Gossypium raimondii
ref|XP_002465976.1|  hypothetical protein SORBIDRAFT_01g049280          172   3e-45    Sorghum bicolor [broomcorn]
gb|AES88343.2|  subtilisin-like serine protease                         172   3e-45    Medicago truncatula
ref|XP_011626021.1|  PREDICTED: subtilisin-like protease SBT5.3         172   3e-45    
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3         172   3e-45    Populus euphratica
ref|XP_011088876.1|  PREDICTED: subtilisin-like protease SBT5.3         172   3e-45    
ref|XP_002991849.1|  hypothetical protein SELMODRAFT_236400             172   3e-45    
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3         172   3e-45    
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3         172   3e-45    Brassica rapa
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                172   3e-45    Prunus mume [ume]
ref|XP_010100157.1|  Subtilisin-like protease SDD1                      172   3e-45    
ref|XP_008348301.1|  PREDICTED: subtilisin-like protease                172   3e-45    
ref|XP_002982832.1|  hypothetical protein SELMODRAFT_234125             172   3e-45    
ref|XP_011012624.1|  PREDICTED: subtilisin-like protease SBT5.3         172   3e-45    Populus euphratica
ref|XP_002993007.1|  hypothetical protein SELMODRAFT_236650             172   3e-45    
gb|AAM15440.1|  subtilisin-like serine protease AIR3                    171   3e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529680.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    172   3e-45    Tarenaya hassleriana [spider flower]
gb|KEH31683.1|  subtilisin-like serine protease                         172   3e-45    Medicago truncatula
ref|XP_002982899.1|  hypothetical protein SELMODRAFT_116988             172   3e-45    
ref|XP_010529679.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    172   4e-45    Tarenaya hassleriana [spider flower]
ref|XP_010529681.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    171   4e-45    Tarenaya hassleriana [spider flower]
gb|AAX95895.1|  Subtilase family, putative                              172   4e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g             172   4e-45    Phaseolus vulgaris [French bean]
ref|XP_007210725.1|  hypothetical protein PRUPE_ppa022363mg             172   4e-45    Prunus persica
gb|EAY88497.1|  hypothetical protein OsI_09968                          172   4e-45    Oryza sativa Indica Group [Indian rice]
emb|CAB65690.1|  subtilisin-like protein                                159   5e-45    Solanum lycopersicum var. cerasiforme [cherry tomato]
ref|XP_002985792.1|  hypothetical protein SELMODRAFT_181997             171   6e-45    
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3         171   6e-45    Nicotiana sylvestris
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                171   6e-45    Tarenaya hassleriana [spider flower]
gb|ABK96588.1|  unknown                                                 162   7e-45    Populus trichocarpa x Populus deltoides
ref|XP_003576659.2|  PREDICTED: subtilisin-like protease SBT5.4         171   7e-45    
emb|CDP09846.1|  unnamed protein product                                171   8e-45    Coffea canephora [robusta coffee]
ref|XP_012067182.1|  PREDICTED: subtilisin-like protease SBT3.5         171   8e-45    Jatropha curcas
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg             171   8e-45    
ref|XP_002965274.1|  hypothetical protein SELMODRAFT_406544             171   8e-45    
ref|XP_007132413.1|  hypothetical protein PHAVU_011G092600g             171   8e-45    Phaseolus vulgaris [French bean]
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease                171   9e-45    Prunus mume [ume]
ref|XP_006469398.1|  PREDICTED: subtilisin-like protease-like iso...    170   9e-45    Citrus sinensis [apfelsine]
ref|XP_002317663.1|  subtilase family protein                           171   9e-45    Populus trichocarpa [western balsam poplar]
gb|KGN43389.1|  hypothetical protein Csa_7G030520                       171   9e-45    Cucumis sativus [cucumbers]
ref|XP_010437012.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    170   9e-45    Camelina sativa [gold-of-pleasure]
ref|XP_008385530.1|  PREDICTED: subtilisin-like protease                171   9e-45    
ref|XP_002981921.1|  hypothetical protein SELMODRAFT_444992             171   9e-45    
ref|XP_010051223.1|  PREDICTED: subtilisin-like protease SDD1           170   1e-44    Eucalyptus grandis [rose gum]
ref|XP_011658647.1|  PREDICTED: subtilisin-like protease SBT5.3         171   1e-44    Cucumis sativus [cucumbers]
ref|XP_002985747.1|  hypothetical protein SELMODRAFT_424726             170   1e-44    
ref|XP_001777292.1|  predicted protein                                  170   1e-44    
emb|CDP10007.1|  unnamed protein product                                171   1e-44    
ref|XP_007132414.1|  hypothetical protein PHAVU_011G092600g             171   1e-44    
gb|KDO78650.1|  hypothetical protein CISIN_1g048642mg                   171   1e-44    
ref|XP_006468177.1|  PREDICTED: subtilisin-like protease-like           171   1e-44    
ref|XP_011038011.1|  PREDICTED: subtilisin-like protease SBT3.5         171   1e-44    
ref|XP_007051971.1|  Subtilase family protein                           171   1e-44    
ref|XP_002512984.1|  Xylem serine proteinase 1 precursor, putative      171   1e-44    
ref|XP_002981852.1|  hypothetical protein SELMODRAFT_154795             170   1e-44    
ref|XP_002320540.2|  subtilisin-like protease family protein            171   1e-44    
emb|CDX93808.1|  BnaA09g24080D                                          171   1e-44    
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                171   1e-44    
emb|CAN62337.1|  hypothetical protein VITISV_004299                     169   1e-44    
ref|XP_009136129.1|  PREDICTED: subtilisin-like protease SBT5.3         171   1e-44    
emb|CDY65487.1|  BnaA03g57660D                                          171   1e-44    
gb|KHN01461.1|  Subtilisin-like protease                                165   1e-44    
ref|XP_003634153.1|  PREDICTED: subtilisin-like protease SBT3.5         171   1e-44    
emb|CBI37888.3|  unnamed protein product                                171   1e-44    
gb|ERN13080.1|  hypothetical protein AMTR_s00040p00151440               170   1e-44    
ref|XP_011022895.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    170   1e-44    
ref|XP_004500162.1|  PREDICTED: subtilisin-like protease-like           171   1e-44    
emb|CBI23085.3|  unnamed protein product                                173   1e-44    
ref|XP_009760563.1|  PREDICTED: subtilisin-like protease                170   1e-44    
ref|XP_003606154.1|  Subtilisin-like protease                           170   1e-44    
gb|EYU39033.1|  hypothetical protein MIMGU_mgv1a001909mg                170   1e-44    
ref|NP_001142096.1|  uncharacterized protein LOC100274260               168   1e-44    
ref|XP_011022894.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    170   1e-44    
gb|KEH29867.1|  subtilisin-like serine endopeptidase family protein     170   1e-44    
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3         170   1e-44    
ref|XP_010437005.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    170   1e-44    
dbj|BAB08348.1|  serine protease-like protein                           170   1e-44    
gb|KFK31799.1|  hypothetical protein AALP_AA6G160400                    170   1e-44    
ref|XP_010657502.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    169   2e-44    
ref|XP_002509661.1|  Xylem serine proteinase 1 precursor, putative      170   2e-44    
gb|AIC80772.1|  subtilase                                               170   2e-44    
ref|XP_002974441.1|  hypothetical protein SELMODRAFT_414627             169   2e-44    
ref|XP_006297035.1|  hypothetical protein CARUB_v10013025mg             170   2e-44    
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       170   2e-44    
ref|XP_006469397.1|  PREDICTED: subtilisin-like protease-like iso...    170   2e-44    
ref|XP_006447869.1|  hypothetical protein CICLE_v10014351mg             170   2e-44    
gb|EYU29548.1|  hypothetical protein MIMGU_mgv1a0242761mg               164   2e-44    
ref|XP_002866352.1|  subtilase family protein                           170   2e-44    
ref|XP_006399712.1|  hypothetical protein EUTSA_v10012766mg             170   2e-44    
gb|KDO42093.1|  hypothetical protein CISIN_1g038881mg                   170   2e-44    
ref|NP_200789.2|  Subtilase 5.4                                         170   2e-44    
ref|XP_011458289.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    169   2e-44    
gb|EEC83669.1|  hypothetical protein OsI_29445                          169   2e-44    
emb|CBI23086.3|  unnamed protein product                                171   2e-44    
ref|XP_010109770.1|  hypothetical protein L484_008446                   170   2e-44    
ref|NP_565309.2|  subtilisin-like serine endopeptidase family pro...    170   2e-44    
emb|CDP06940.1|  unnamed protein product                                169   2e-44    
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease        170   2e-44    
ref|XP_003625338.1|  Subtilisin-like serine protease                    170   2e-44    
dbj|BAF95887.1|  subtilase                                              169   2e-44    
ref|XP_009344068.1|  PREDICTED: subtilisin-like protease SBT5.3         169   2e-44    
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    169   2e-44    
emb|CDY15084.1|  BnaC03g44450D                                          170   2e-44    
ref|XP_006418604.1|  hypothetical protein EUTSA_v10002408mg             170   2e-44    
ref|XP_011462200.1|  PREDICTED: subtilisin-like protease SBT3.5         170   2e-44    
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg             169   3e-44    
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3         170   3e-44    
ref|XP_011074702.1|  PREDICTED: CO(2)-response secreted protease-...    169   3e-44    
ref|XP_006447865.1|  hypothetical protein CICLE_v10018333mg             169   3e-44    
ref|XP_009396094.1|  PREDICTED: subtilisin-like protease SBT5.3         169   3e-44    
ref|XP_002463463.1|  hypothetical protein SORBIDRAFT_01g000350          170   3e-44    
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                     169   3e-44    
ref|XP_002266728.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    169   3e-44    
gb|KHN09746.1|  Subtilisin-like protease SDD1                           169   3e-44    
gb|AFW55829.1|  putative subtilase family protein                       168   3e-44    
ref|XP_011074701.1|  PREDICTED: CO(2)-response secreted protease-...    169   3e-44    
ref|XP_008650860.1|  PREDICTED: uncharacterized protein LOC100192...    170   3e-44    
gb|EMT03593.1|  Subtilisin-like protease                                164   3e-44    
ref|XP_011458288.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    169   4e-44    
ref|XP_010466978.1|  PREDICTED: subtilisin-like protease SBT5.3         169   4e-44    
ref|XP_003580939.1|  PREDICTED: subtilisin-like protease                169   4e-44    
ref|XP_011458287.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    169   4e-44    
dbj|BAJ90522.1|  predicted protein                                      164   4e-44    
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             169   4e-44    
ref|XP_009394691.1|  PREDICTED: subtilisin-like protease SBT5.3         169   4e-44    
ref|XP_002974442.1|  hypothetical protein SELMODRAFT_414628             168   4e-44    
ref|NP_001061952.1|  Os08g0452100                                       169   4e-44    
ref|XP_010109072.1|  Subtilisin-like protease                           169   4e-44    
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease                169   4e-44    
ref|XP_003549875.1|  PREDICTED: subtilisin-like protease SDD1-like      169   4e-44    
ref|XP_002964212.1|  hypothetical protein SELMODRAFT_81842              169   5e-44    
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     169   5e-44    
gb|ACN85315.1|  subtilisin-like protease precursor                      169   5e-44    
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     169   5e-44    
ref|XP_006397048.1|  hypothetical protein EUTSA_v10028454mg             169   5e-44    
gb|KHN09747.1|  Subtilisin-like protease SDD1                           168   5e-44    
ref|XP_002309930.2|  hypothetical protein POPTR_0007s04500g             169   5e-44    
gb|KHN17728.1|  Subtilisin-like protease                                160   5e-44    
emb|CDP06171.1|  unnamed protein product                                169   5e-44    
ref|XP_010647021.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    168   5e-44    
gb|ACN30792.1|  unknown                                                 169   5e-44    
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       170   5e-44    
ref|XP_006377976.1|  hypothetical protein POPTR_0011s16870g             169   6e-44    
ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like           169   6e-44    
ref|XP_007042043.1|  Subtilase family protein, putative isoform 2       168   6e-44    
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                169   6e-44    
ref|XP_003550884.1|  PREDICTED: subtilisin-like protease SDD1-like      168   6e-44    
ref|XP_002885743.1|  hypothetical protein ARALYDRAFT_899224             169   6e-44    
ref|XP_002988851.1|  hypothetical protein SELMODRAFT_128873             168   6e-44    
ref|XP_012086638.1|  PREDICTED: subtilisin-like protease SBT3.5         168   7e-44    
ref|XP_008218944.1|  PREDICTED: subtilisin-like protease                168   7e-44    
ref|XP_010647020.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    168   7e-44    
gb|KHN38643.1|  Subtilisin-like protease                                168   7e-44    
ref|XP_010455450.1|  PREDICTED: subtilisin-like protease SBT3.3         168   8e-44    
gb|EYU39035.1|  hypothetical protein MIMGU_mgv1a001882mg                168   8e-44    
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       168   8e-44    
ref|XP_008661010.1|  PREDICTED: subtilisin-like protease SBT5.3         168   8e-44    
ref|XP_004294696.1|  PREDICTED: subtilisin-like protease SBT5.3         168   8e-44    
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4         168   9e-44    
ref|XP_009128710.1|  PREDICTED: subtilisin-like protease SBT5.3         168   9e-44    
emb|CBI38460.3|  unnamed protein product                                168   9e-44    
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    168   9e-44    
gb|KDO36038.1|  hypothetical protein CISIN_1g047896mg                   166   9e-44    
ref|XP_010529409.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    168   9e-44    
gb|KJB79073.1|  hypothetical protein B456_013G033000                    168   9e-44    
gb|EMT26574.1|  Subtilisin-like protease                                167   9e-44    
ref|NP_567359.1|  Subtilase family protein                              168   9e-44    
gb|KJB79072.1|  hypothetical protein B456_013G033000                    167   1e-43    
ref|XP_002518937.1|  Cucumisin precursor, putative                      168   1e-43    
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3       168   1e-43    
ref|XP_010529408.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    168   1e-43    
dbj|BAF95753.1|  subtilase                                              168   1e-43    
ref|XP_006339267.1|  PREDICTED: subtilisin-like protease-like           167   1e-43    
gb|EEE58224.1|  hypothetical protein OsJ_09195                          160   1e-43    
ref|XP_002437266.1|  hypothetical protein SORBIDRAFT_10g023870          168   1e-43    
gb|KJB79074.1|  hypothetical protein B456_013G033000                    167   1e-43    
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5         168   1e-43    
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg             168   1e-43    
ref|XP_006580143.1|  PREDICTED: subtilisin-like protease SDD1-lik...    167   1e-43    
ref|XP_007039329.1|  Subtilase family protein                           166   1e-43    
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         168   1e-43    
gb|KJB79075.1|  hypothetical protein B456_013G033000                    167   1e-43    
ref|NP_174573.1|  Subtilisin-like serine endopeptidase family pro...    167   1e-43    
ref|XP_010421967.1|  PREDICTED: subtilisin-like protease SBT3.3         168   1e-43    
ref|XP_006580142.1|  PREDICTED: subtilisin-like protease SDD1-lik...    167   1e-43    
ref|XP_003538129.1|  PREDICTED: subtilisin-like protease-like           167   1e-43    
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            168   1e-43    
ref|XP_010542042.1|  PREDICTED: subtilisin-like protease SBT5.3         167   1e-43    
ref|XP_003533568.1|  PREDICTED: subtilisin-like protease-like           168   1e-43    
gb|KJB79071.1|  hypothetical protein B456_013G033000                    167   1e-43    
ref|XP_010483626.1|  PREDICTED: subtilisin-like protease SBT5.4         164   1e-43    
tpg|DAA42972.1|  TPA: putative subtilase family protein                 167   1e-43    
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                167   1e-43    
emb|CDP11276.1|  unnamed protein product                                167   1e-43    
ref|XP_010067699.1|  PREDICTED: subtilisin-like protease SBT5.3         169   1e-43    
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    170   2e-43    
gb|AAD03430.1|  similar to the subtilase family of serine proteas...    167   2e-43    
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                168   2e-43    
emb|CDP09843.1|  unnamed protein product                                158   2e-43    
ref|XP_004973598.1|  PREDICTED: subtilisin-like protease-like           168   2e-43    
ref|XP_009350314.1|  PREDICTED: subtilisin-like protease SBT5.3         167   2e-43    
ref|NP_001130788.1|  putative subtilase family protein precursor        167   2e-43    
gb|KJB79077.1|  hypothetical protein B456_013G033000                    167   2e-43    
ref|XP_002872522.1|  subtilase family protein                           167   2e-43    
ref|XP_008663777.1|  PREDICTED: subtilisin-like protease SBT5.3         167   2e-43    
ref|XP_006387513.1|  hypothetical protein POPTR_0909s00200g             160   2e-43    
gb|EEE53126.1|  hypothetical protein OsJ_35920                          167   2e-43    
ref|XP_002441813.1|  hypothetical protein SORBIDRAFT_08g002720          167   2e-43    
ref|XP_008236002.1|  PREDICTED: subtilisin-like protease                167   2e-43    
ref|XP_002313670.2|  hypothetical protein POPTR_0009s14680g             167   2e-43    
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...    167   2e-43    
gb|EEC69176.1|  hypothetical protein OsI_38146                          166   2e-43    
ref|XP_003624297.1|  Subtilisin-like protease                           166   2e-43    
gb|ABN05911.1|  Peptidase S8 and S53, subtilisin, kexin, sedolisin      166   2e-43    
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like           167   2e-43    
ref|XP_002275381.2|  PREDICTED: subtilisin-like protease SDD1           169   2e-43    
ref|XP_011081166.1|  PREDICTED: subtilisin-like protease SDD1           169   2e-43    
ref|XP_007207186.1|  hypothetical protein PRUPE_ppa017229mg             167   2e-43    
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...    167   2e-43    
ref|NP_567361.1|  Subtilase family protein                              167   2e-43    
gb|KHN11556.1|  Subtilisin-like protease                                167   2e-43    
ref|NP_001148151.1|  xylem serine proteinase 1 precursor                167   3e-43    
emb|CDY65695.1|  BnaA02g06820D                                          165   3e-43    
ref|XP_004985741.1|  PREDICTED: subtilisin-like protease SDD1-like      167   3e-43    
ref|XP_004962635.1|  PREDICTED: subtilisin-like protease SDD1-like      166   3e-43    
ref|XP_004506157.1|  PREDICTED: subtilisin-like protease-like           167   3e-43    
ref|XP_002984931.1|  hypothetical protein SELMODRAFT_424020             166   3e-43    
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           167   3e-43    
ref|NP_001066666.2|  Os12g0427600                                       166   3e-43    
ref|XP_009126659.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    166   3e-43    
ref|XP_008437181.1|  PREDICTED: subtilisin-like protease                166   3e-43    
ref|XP_007026418.1|  Subtilase family protein, putative                 167   3e-43    
ref|XP_010248425.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    169   3e-43    
ref|XP_007039203.1|  Subtilase family protein, putative                 167   3e-43    
ref|XP_008229443.1|  PREDICTED: cucumisin-like                          166   3e-43    
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                166   3e-43    
ref|XP_007206725.1|  hypothetical protein PRUPE_ppa024702mg             166   3e-43    
emb|CDY15145.1|  BnaC05g00240D                                          166   4e-43    
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                166   4e-43    
ref|XP_002518939.1|  Cucumisin precursor, putative                      166   4e-43    
ref|XP_011000330.1|  PREDICTED: subtilisin-like protease SBT5.4         166   4e-43    
ref|XP_006358146.1|  PREDICTED: subtilisin-like protease SDD1-like      166   4e-43    
ref|XP_010693559.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    168   4e-43    
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    166   4e-43    
ref|XP_002871506.1|  subtilase family protein                           166   4e-43    
gb|KDP25553.1|  hypothetical protein JCGZ_20709                         166   4e-43    
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                166   4e-43    
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                166   4e-43    
gb|ACL52505.1|  unknown                                                 163   4e-43    
ref|XP_002985983.1|  hypothetical protein SELMODRAFT_234928             166   4e-43    
ref|XP_009126658.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    166   4e-43    
ref|XP_002530614.1|  Cucumisin precursor, putative                      166   4e-43    
ref|XP_010273518.1|  PREDICTED: subtilisin-like protease SBT5.4         166   4e-43    
gb|AFW89785.1|  putative subtilase family protein                       166   5e-43    
ref|XP_010455547.1|  PREDICTED: subtilisin-like protease SBT5.4         166   5e-43    
gb|KEH32715.1|  subtilisin-like serine protease                         166   5e-43    
ref|XP_002972591.1|  hypothetical protein SELMODRAFT_97292              166   5e-43    
ref|XP_009759676.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    165   5e-43    
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease                166   5e-43    
ref|XP_003624300.1|  Subtilisin-like protease                           166   5e-43    
ref|XP_003624325.1|  Subtilisin-like serine protease                    166   5e-43    
ref|XP_009794911.1|  PREDICTED: subtilisin-like protease SBT5.3         161   5e-43    
ref|XP_010470496.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    165   5e-43    
ref|NP_567360.1|  Subtilase family protein                              166   5e-43    
ref|XP_006282063.1|  hypothetical protein CARUB_v10028308mg             166   6e-43    
ref|XP_004251819.1|  PREDICTED: subtilisin-like protease SBT5.3         166   6e-43    
gb|KDP25554.1|  hypothetical protein JCGZ_20710                         166   6e-43    
ref|XP_010318062.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    166   6e-43    



>ref|XP_006365013.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=758

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+VAL+KAVHPSWSPSAIKSAIMTTA + + HHKPI  DP+G+RAN FDFGSGFV
Sbjct  542  CPHISGVVALLKAVHPSWSPSAIKSAIMTTAKLSDMHHKPIIVDPEGKRANPFDFGSGFV  601

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +VLDPGL+YDAQPADY+AFLCSIGY+E+SLHLIT DN TCDQT  SP+ LNYPSITV
Sbjct  602  NPTKVLDPGLIYDAQPADYRAFLCSIGYDEKSLHLITRDNRTCDQTFASPNELNYPSITV  661

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L +K+SVTRTVTNVG+ RS+YKAV+F P+GINVTVVPRRL F  Y QK+NFT++FK+A
Sbjct  662  PDLRNKYSVTRTVTNVGKSRSNYKAVIFAPKGINVTVVPRRLAFTRYYQKMNFTVTFKVA  721

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGLPV  166
            APTQGYVFGS SWR+K+ WV SPLVVRVA S  G  V
Sbjct  722  APTQGYVFGSLSWRNKRTWVTSPLVVRVAHSNMGTMV  758



>ref|XP_009606152.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana tomentosiformis]
Length=760

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+TG+VAL+KAVHPSWSPSAIKSAIMTTA + +KHHKPI  DP+G+RAN FDFGSGFV
Sbjct  544  CPHITGVVALLKAVHPSWSPSAIKSAIMTTAKLSDKHHKPIIVDPEGKRANPFDFGSGFV  603

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +VLDPGL+YDAQPADYKAFLCSIGY+E+SLHLIT DNSTCDQT  SP+ LNYPSITV
Sbjct  604  NPIKVLDPGLIYDAQPADYKAFLCSIGYDEKSLHLITRDNSTCDQTFASPNGLNYPSITV  663

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   +SVTRTVTNVG+ RS YKAVVF P G+NVTVVPRRL F  Y QK+NFT++FK+A
Sbjct  664  PNLRSTYSVTRTVTNVGKARSIYKAVVFAPMGVNVTVVPRRLAFTKYYQKMNFTVNFKVA  723

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGLPV  166
            APT+GYVFGS +WR+K+ WV SPLVVRVA S  G+ V
Sbjct  724  APTEGYVFGSLTWRNKRTWVTSPLVVRVAHSNMGMMV  760



>emb|CDP01740.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   341 bits (875),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVL+KHHKPI+ADP+GR  NAFD+GSGF+
Sbjct  547  CPHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLDKHHKPITADPEGRIGNAFDYGSGFI  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP++VLDPGLVYDA+P DYKAFLCSIGY+ERSLHLIT DNSTC Q+  + S LNYPSI V
Sbjct  607  NPSKVLDPGLVYDAKPTDYKAFLCSIGYDERSLHLITRDNSTCAQSFATASDLNYPSIVV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSV RT+TNVG  RS YKAVVF P+G+NVTVVPRR+ F  YGQK+NFT++FK+A
Sbjct  667  PNLKQNFSVIRTLTNVGRQRSIYKAVVFAPKGVNVTVVPRRIVFDSYGQKINFTVNFKVA  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP  GYVFGS SWR++++W+ SPLV+R   S+ GL
Sbjct  727  APPTGYVFGSLSWRNRRSWITSPLVIRAMHSKMGL  761



>ref|XP_004233282.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Solanum 
lycopersicum]
Length=757

 Score =   340 bits (871),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+VAL+KAVHPSWSPSAIKSAIMTTA + + HHKPI  DP+G++AN FDFGSGFV
Sbjct  541  CPHISGVVALLKAVHPSWSPSAIKSAIMTTAKLSDMHHKPIIVDPEGKKANPFDFGSGFV  600

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +VL+PGL+YDAQP DY+AFLCSIGY+E+SLHLIT DN TCDQT  SP+ LNYPSITV
Sbjct  601  NPTKVLNPGLIYDAQPEDYRAFLCSIGYDEKSLHLITRDNRTCDQTFASPNELNYPSITV  660

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L + +SV+RTVTNVG+ RS+YKAV+F P+GINVTVVPRRL F  Y QK+NFT++FK+A
Sbjct  661  PNLRNNYSVSRTVTNVGKSRSTYKAVIFAPKGINVTVVPRRLAFTRYYQKMNFTVTFKVA  720

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGLPV  166
            APTQGYVFGS SWR+K+ WV SPLVVRVA S  G  V
Sbjct  721  APTQGYVFGSLSWRNKRTWVTSPLVVRVAHSNMGTVV  757



>ref|XP_010317055.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Solanum 
lycopersicum]
Length=761

 Score =   340 bits (871),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+VAL+KAVHPSWSPSAIKSAIMTTA + + HHKPI  DP+G++AN FDFGSGFV
Sbjct  545  CPHISGVVALLKAVHPSWSPSAIKSAIMTTAKLSDMHHKPIIVDPEGKKANPFDFGSGFV  604

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +VL+PGL+YDAQP DY+AFLCSIGY+E+SLHLIT DN TCDQT  SP+ LNYPSITV
Sbjct  605  NPTKVLNPGLIYDAQPEDYRAFLCSIGYDEKSLHLITRDNRTCDQTFASPNELNYPSITV  664

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L + +SV+RTVTNVG+ RS+YKAV+F P+GINVTVVPRRL F  Y QK+NFT++FK+A
Sbjct  665  PNLRNNYSVSRTVTNVGKSRSTYKAVIFAPKGINVTVVPRRLAFTRYYQKMNFTVTFKVA  724

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGLPV  166
            APTQGYVFGS SWR+K+ WV SPLVVRVA S  G  V
Sbjct  725  APTQGYVFGSLSWRNKRTWVTSPLVVRVAHSNMGTVV  761



>ref|XP_009782970.1| PREDICTED: subtilisin-like protease SBT5.4 [Nicotiana sylvestris]
Length=760

 Score =   338 bits (866),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+TG+VAL+KAVHPSWSPSAIKSAIMTTA + +KHHKPI  DP+G+RA  FDFGSGFV
Sbjct  544  CPHITGVVALLKAVHPSWSPSAIKSAIMTTAKLSDKHHKPIIVDPEGKRATPFDFGSGFV  603

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP  VLDPGL+YDAQPADY+AFLCSIGY+E+SLHLIT DNSTCDQT  SP+ LNYPSIT+
Sbjct  604  NPTNVLDPGLIYDAQPADYRAFLCSIGYDEKSLHLITRDNSTCDQTFASPNGLNYPSITI  663

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   +SVTRTVTNVG+ RS YKAVV+ P G+NVTVVPRRL F  Y QK+NFT++FK+A
Sbjct  664  PNLRSTYSVTRTVTNVGKARSIYKAVVYAPTGVNVTVVPRRLAFTRYYQKMNFTVNFKVA  723

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGLPV  166
            APTQGYVFGS +WR+K+  V SPLVVRVA S  G+ V
Sbjct  724  APTQGYVFGSLTWRNKRTSVTSPLVVRVAHSNMGMMV  760



>ref|XP_002300539.2| hypothetical protein POPTR_0001s460002g, partial [Populus trichocarpa]
 gb|EEE85344.2| hypothetical protein POPTR_0001s460002g, partial [Populus trichocarpa]
Length=400

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 175/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+TG+  LIKAVHPSWSPSAIKSAIMTTAT+L+K  KPI  DP+GR ANAFD+GSGFV
Sbjct  184  CPHITGVATLIKAVHPSWSPSAIKSAIMTTATILDKSGKPIRVDPEGRMANAFDYGSGFV  243

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P RVLDPGLVYDA P DYKAFLCSIGY+E+SLHL+T DNSTC+QT  + S+LNYPSITV
Sbjct  244  DPTRVLDPGLVYDAHPIDYKAFLCSIGYDEKSLHLVTRDNSTCNQTFTTASSLNYPSITV  303

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTRTVTNVG+ RS YKAVV  P GINVTVVP++L F  YGQK+ FT++FK+A
Sbjct  304  PNLKDSFSVTRTVTNVGKARSVYKAVVSNPAGINVTVVPKQLIFNSYGQKIKFTVNFKVA  363

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG  +WRS    V SPLVVR A S  GL
Sbjct  364  APSKGYAFGFLTWRSTDARVTSPLVVRAAPSPMGL  398



>gb|KHN45603.1| Subtilisin-like protease, partial [Glycine soja]
Length=366

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 177/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSAIMTTATVL+KHH+PI+ADP+ RRANAFD+GSGFV
Sbjct  150  CPHVTGIATLVKAVHPSWSPSAIKSAIMTTATVLDKHHRPITADPEQRRANAFDYGSGFV  209

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NPARVLDPGL+YD++PAD+ AFLCS+GY++RSLH +T DNSTCD+   + S LNYPSI V
Sbjct  210  NPARVLDPGLIYDSKPADFVAFLCSLGYDQRSLHQVTRDNSTCDRAFSTASDLNYPSIAV  269

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+ RS YKAVV  P G+ V+V+P RL F   GQK+NFT++FK++
Sbjct  270  PNLKDNFSVTRIVTNVGKARSVYKAVVSSPPGVRVSVIPNRLIFTRIGQKINFTVNFKLS  329

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG  SWR++ + V SPLVVRVA  + GL
Sbjct  330  APSKGYAFGFLSWRNRISQVTSPLVVRVAPGKNGL  364



>ref|XP_010649319.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Vitis 
vinifera]
Length=738

 Score =   323 bits (827),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 177/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGIVAL+KAVHPSWSPSAIKSAIMTTAT+L+K+ + I+ DP+GR+ NAFD+GSGFV
Sbjct  522  CPHVTGIVALVKAVHPSWSPSAIKSAIMTTATILDKNRRSITVDPEGRKGNAFDYGSGFV  581

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGL+YD +P DYKAFLCSIGY+E+ LHLIT DNSTCDQT  + SALNYPSITV
Sbjct  582  NPTRVLDPGLIYDTEPTDYKAFLCSIGYSEKLLHLITRDNSTCDQTFATASALNYPSITV  641

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    SV+RTVTNVG+PRS YKAVV  P GINVTVVP RL F HYGQK+NFT+  K+A
Sbjct  642  PNLKDNSSVSRTVTNVGKPRSIYKAVVSAPTGINVTVVPHRLIFSHYGQKINFTVHLKVA  701

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP+  YVFG  SWR+K   V SPLVVRVA +  GL
Sbjct  702  APSHSYVFGFLSWRNKYTRVTSPLVVRVAPTSLGL  736



>ref|XP_011098007.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=764

 Score =   323 bits (828),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 179/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGIVALIK+VH SWSPSAIKSAIMTTAT LNKH KPI+A PDGR+AN FDFGSGFV
Sbjct  548  CPHVTGIVALIKSVHVSWSPSAIKSAIMTTATTLNKHRKPITAGPDGRKANPFDFGSGFV  607

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP  VLDPGLVYD   ADY+AFLCS+GY++RSL LIT DNSTC+Q   + S+LNYPSITV
Sbjct  608  NPRAVLDPGLVYDTTSADYRAFLCSLGYSDRSLQLITRDNSTCNQAFTTASSLNYPSITV  667

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L + FSV+RTVTNVG PRS YKAVVF P G NVTVVP+RL F  YGQK+NFT++F++ 
Sbjct  668  PNLKNSFSVSRTVTNVGRPRSVYKAVVFSPTGFNVTVVPKRLVFNRYGQKINFTVTFEVT  727

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++ YVFGS SWR++++WV +PLVVR   S+ GL
Sbjct  728  APSKDYVFGSLSWRNRRSWVTTPLVVRAVHSKFGL  762



>ref|XP_010649320.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X3 [Vitis 
vinifera]
 ref|XP_010649321.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X3 [Vitis 
vinifera]
Length=726

 Score =   322 bits (825),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 177/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGIVAL+KAVHPSWSPSAIKSAIMTTAT+L+K+ + I+ DP+GR+ NAFD+GSGFV
Sbjct  510  CPHVTGIVALVKAVHPSWSPSAIKSAIMTTATILDKNRRSITVDPEGRKGNAFDYGSGFV  569

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGL+YD +P DYKAFLCSIGY+E+ LHLIT DNSTCDQT  + SALNYPSITV
Sbjct  570  NPTRVLDPGLIYDTEPTDYKAFLCSIGYSEKLLHLITRDNSTCDQTFATASALNYPSITV  629

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    SV+RTVTNVG+PRS YKAVV  P GINVTVVP RL F HYGQK+NFT+  K+A
Sbjct  630  PNLKDNSSVSRTVTNVGKPRSIYKAVVSAPTGINVTVVPHRLIFSHYGQKINFTVHLKVA  689

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP+  YVFG  SWR+K   V SPLVVRVA +  GL
Sbjct  690  APSHSYVFGFLSWRNKYTRVTSPLVVRVAPTSLGL  724



>ref|XP_002263237.2| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Vitis 
vinifera]
Length=763

 Score =   323 bits (827),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 177/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGIVAL+KAVHPSWSPSAIKSAIMTTAT+L+K+ + I+ DP+GR+ NAFD+GSGFV
Sbjct  547  CPHVTGIVALVKAVHPSWSPSAIKSAIMTTATILDKNRRSITVDPEGRKGNAFDYGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGL+YD +P DYKAFLCSIGY+E+ LHLIT DNSTCDQT  + SALNYPSITV
Sbjct  607  NPTRVLDPGLIYDTEPTDYKAFLCSIGYSEKLLHLITRDNSTCDQTFATASALNYPSITV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    SV+RTVTNVG+PRS YKAVV  P GINVTVVP RL F HYGQK+NFT+  K+A
Sbjct  667  PNLKDNSSVSRTVTNVGKPRSIYKAVVSAPTGINVTVVPHRLIFSHYGQKINFTVHLKVA  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP+  YVFG  SWR+K   V SPLVVRVA +  GL
Sbjct  727  APSHSYVFGFLSWRNKYTRVTSPLVVRVAPTSLGL  761



>gb|KDP24910.1| hypothetical protein JCGZ_24288 [Jatropha curcas]
Length=601

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHVTGI ALIKAV+PSWSPSAIKSAIMTTAT+L+K+ KPI+ DP G R +AFD+GSGFV+
Sbjct  386  PHVTGIAALIKAVNPSWSPSAIKSAIMTTATILDKNRKPITVDPSGSRGSAFDYGSGFVD  445

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            P RVLDPGL+YD QP DYKAFLCSIGY+E+SLHL+T DNSTC++T  + S+LNYPSITVP
Sbjct  446  PTRVLDPGLIYDTQPTDYKAFLCSIGYDEKSLHLVTRDNSTCNETFTTASSLNYPSITVP  505

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
             L   FSVTRTVTNVG+PRS YKAVV  P GINVTVVP+RL F  YGQK+ FT++FK+A+
Sbjct  506  GLKDSFSVTRTVTNVGKPRSIYKAVVSNPVGINVTVVPKRLIFNSYGQKIKFTVNFKVAS  565

Query  273  PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            P+ GY FG  +WR++   V SPLVV+VA S +GL
Sbjct  566  PSIGYTFGFLTWRNRNARVTSPLVVQVASSSSGL  599



>ref|XP_002528535.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF33847.1| Cucumisin precursor, putative [Ricinus communis]
Length=761

 Score =   321 bits (822),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAV+PSWSPSAIKSAIMTTAT+L+K+ KPI+ DP GRR NAFD+GSGFV
Sbjct  545  CPHVTGIAALIKAVNPSWSPSAIKSAIMTTATILDKNRKPITVDPRGRRGNAFDYGSGFV  604

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGL+YDA   DYK+FLCSIGY+++SLHL+T DNSTC+QT  + S+LNYPSIT+
Sbjct  605  NPTRVLDPGLIYDAYTTDYKSFLCSIGYDDKSLHLVTRDNSTCNQTFATASSLNYPSITI  664

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+PRS +KAVV  P GINVTVVP+RL F  YGQK+ FT++FK+ 
Sbjct  665  PNLKDYFSVTRIVTNVGKPRSIFKAVVSNPIGINVTVVPKRLVFDSYGQKITFTVNFKVT  724

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG  SWR++  WV SPLVVRVA S  GL
Sbjct  725  APSKGYAFGILSWRNRNTWVTSPLVVRVASSSMGL  759



>emb|CBI37484.3| unnamed protein product [Vitis vinifera]
Length=764

 Score =   321 bits (822),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGIVAL+KAVHPSWSPSAIKSAIMTTAT+L+K+ + I+ DP+GR+ NAFD+GSGFV
Sbjct  545  CPHVTGIVALVKAVHPSWSPSAIKSAIMTTATILDKNRRSITVDPEGRKGNAFDYGSGFV  604

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGL+YD +P DYKAFLCSIGY+E+ LHLIT DNSTCDQT  + SALNYPSITV
Sbjct  605  NPTRVLDPGLIYDTEPTDYKAFLCSIGYSEKLLHLITRDNSTCDQTFATASALNYPSITV  664

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    SV+RTVTNVG+PRS YKAVV  P GINVTVVP RL F HYGQK+NFT+  K+A
Sbjct  665  PNLKDNSSVSRTVTNVGKPRSIYKAVVSAPTGINVTVVPHRLIFSHYGQKINFTVHLKVA  724

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTG  175
            AP+  YVFG  SWR+K   V SPLVVRVA +  G
Sbjct  725  APSHSYVFGFLSWRNKYTRVTSPLVVRVAPTSLG  758



>gb|KHN28302.1| Subtilisin-like protease, partial [Glycine soja]
Length=732

 Score =   320 bits (820),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 177/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSAIMTTAT+L+KHH+PI ADPD RRANAFD+GSGFV
Sbjct  516  CPHVTGIATLVKAVHPSWSPSAIKSAIMTTATILDKHHQPIRADPDRRRANAFDYGSGFV  575

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP+RVLDPGLVYD+ P D+ AFLCS+GY+ERSLHL+TGDNSTCD+  ++PS LNYPSI V
Sbjct  576  NPSRVLDPGLVYDSNPEDFVAFLCSLGYDERSLHLVTGDNSTCDRAFKTPSDLNYPSIAV  635

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+ RS YKAVV  P G+NVTVVP RL F   GQK+ FT++FK+A
Sbjct  636  PNLEDNFSVTRVVTNVGKARSIYKAVVVSPTGVNVTVVPNRLVFTRIGQKIKFTVNFKVA  695

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG  SW++ +  V SPLVV+VA +  GL
Sbjct  696  APSKGYAFGFLSWKNGRTQVTSPLVVKVAPASHGL  730



>ref|XP_003516513.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=763

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 176/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSAIMTTAT+L+KHH+PI ADPD RRANAFD+GSGFV
Sbjct  547  CPHVTGIATLVKAVHPSWSPSAIKSAIMTTATILDKHHQPIRADPDRRRANAFDYGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP+RVLDPGLVYD+ P D+ AFLCS+GY+ERSLHL+T DNSTCD+  ++PS LNYPSI V
Sbjct  607  NPSRVLDPGLVYDSNPEDFVAFLCSLGYDERSLHLVTKDNSTCDRAFKTPSDLNYPSIAV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+ RS YKAVV  P G+NVTVVP RL F   GQK+ FT++FK+A
Sbjct  667  PNLEDNFSVTRVVTNVGKARSIYKAVVVSPTGVNVTVVPNRLVFTRIGQKIKFTVNFKVA  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG  SW++ +  V SPLVV+VA +  GL
Sbjct  727  APSKGYAFGFLSWKNGRTQVTSPLVVKVAPASHGL  761



>ref|XP_012087565.1| PREDICTED: subtilisin-like protease SBT3.5 [Jatropha curcas]
Length=772

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 179/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAV+PSWSPSAIKSAIMTTAT+L+K+ KPI+ DP G R +AFD+GSGFV
Sbjct  556  CPHVTGIAALIKAVNPSWSPSAIKSAIMTTATILDKNRKPITVDPSGSRGSAFDYGSGFV  615

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P RVLDPGL+YD QP DYKAFLCSIGY+E+SLHL+T DNSTC++T  + S+LNYPSITV
Sbjct  616  DPTRVLDPGLIYDTQPTDYKAFLCSIGYDEKSLHLVTRDNSTCNETFTTASSLNYPSITV  675

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTRTVTNVG+PRS YKAVV  P GINVTVVP+RL F  YGQK+ FT++FK+A
Sbjct  676  PGLKDSFSVTRTVTNVGKPRSIYKAVVSNPVGINVTVVPKRLIFNSYGQKIKFTVNFKVA  735

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            +P+ GY FG  +WR++   V SPLVV+VA S +GL
Sbjct  736  SPSIGYTFGFLTWRNRNARVTSPLVVQVASSSSGL  770



>gb|KHN41792.1| Subtilisin-like protease [Glycine soja]
Length=701

 Score =   313 bits (803),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 175/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+TGI  L+KAVHPSWSPSAIKSAIMTTAT+L+KHH+PI ADPD RRANAFD+GSGFV
Sbjct  485  CPHITGIATLVKAVHPSWSPSAIKSAIMTTATILDKHHQPIRADPDRRRANAFDYGSGFV  544

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP+RVLDPGLVYD+ P D+ AFLCS+GY+ERSLHL+TGDNSTCD+  ++PS LNYPSI V
Sbjct  545  NPSRVLDPGLVYDSHPEDFVAFLCSLGYDERSLHLVTGDNSTCDRAFKTPSDLNYPSIAV  604

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+ RS YKAVV  P G+NVTVVP RL F   G+K+ FT++FK+ 
Sbjct  605  PNLEDNFSVTRVVTNVGKARSIYKAVVVSPAGVNVTVVPNRLVFTRIGEKIKFTVNFKVV  664

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++ Y FG  SW++ +  V SPLV++VA +  GL
Sbjct  665  APSKDYAFGFLSWKNGRTQVTSPLVIKVAPASHGL  699



>ref|XP_003538919.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=762

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 175/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+TGI  L+KAVHPSWSPSAIKSAIMTTAT+L+KHH+PI ADPD RRANAFD+GSGFV
Sbjct  546  CPHITGIATLVKAVHPSWSPSAIKSAIMTTATILDKHHQPIRADPDRRRANAFDYGSGFV  605

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP+RVLDPGLVYD+ P D+ AFLCS+GY+ERSLHL+TGDNSTCD+  ++PS LNYPSI V
Sbjct  606  NPSRVLDPGLVYDSHPEDFVAFLCSLGYDERSLHLVTGDNSTCDRAFKTPSDLNYPSIAV  665

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+ RS YKAVV  P G+NVTVVP RL F   G+K+ FT++FK+ 
Sbjct  666  PNLEDNFSVTRVVTNVGKARSIYKAVVVSPAGVNVTVVPNRLVFTRIGEKIKFTVNFKVV  725

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++ Y FG  SW++ +  V SPLV++VA +  GL
Sbjct  726  APSKDYAFGFLSWKNGRTQVTSPLVIKVAPASHGL  760



>gb|AFK43318.1| unknown [Lotus japonicus]
Length=250

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 173/215 (80%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSAIMTTAT+L+KHH+ ISADP+ R ANAFD+GSGFV
Sbjct  34   CPHVTGIATLVKAVHPSWSPSAIKSAIMTTATILDKHHRHISADPEQRTANAFDYGSGFV  93

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NPARVLDPGL+YD++PAD+ AFLCS+GY++RSLHL+T D+STCD+   + S LNYPSI V
Sbjct  94   NPARVLDPGLIYDSEPADFVAFLCSLGYDQRSLHLVTRDDSTCDRAFNTASDLNYPSIAV  153

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+ +S YKAVV  P G+NVTVVP RL F   GQK+ FT++FK+ 
Sbjct  154  PKLKDSFSVTRVVTNVGKAQSVYKAVVSSPPGVNVTVVPNRLIFTLVGQKMKFTVNFKVT  213

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            +P++GY FG  SW +++  V SPLVV+V   + GL
Sbjct  214  SPSKGYAFGFLSWTNRRLRVTSPLVVKVVPGKHGL  248



>ref|XP_003534221.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=762

 Score =   313 bits (801),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHVTGI  L+KAVHPSWSPSAIKSAIMTTATVL+KHH+PI+ADP+ RRANAFD+GSGFVN
Sbjct  547  PHVTGIATLVKAVHPSWSPSAIKSAIMTTATVLDKHHRPITADPEQRRANAFDYGSGFVN  606

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PARVLDPGL+YD++PAD+ AFLCS+GY++RSLH +T DNSTCD+   + S LNYPSI VP
Sbjct  607  PARVLDPGLIYDSKPADFVAFLCSLGYDQRSLHQVTRDNSTCDRAFSTASDLNYPSIAVP  666

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
             L   FSVTR VTNVG+ RS YKAVV  P G+ V+V+P RL F   GQK+NFT++FK++A
Sbjct  667  NLKDNFSVTRIVTNVGKARSVYKAVVSSPPGVRVSVIPNRLIFTRIGQKINFTVNFKLSA  726

Query  273  PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            P++GY FG  SWR++ + V SPLVVRVA  + GL
Sbjct  727  PSKGYAFGFLSWRNRISQVTSPLVVRVAPGKNGL  760



>ref|XP_008379676.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=220

 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAV+PSWSP+AI+SAIMTTAT+L+K+ KPI  DP+GRR N FD+GSGFV
Sbjct  3    CPHVTGIAALIKAVYPSWSPAAIRSAIMTTATLLDKNSKPILVDPEGRRGNXFDYGSGFV  62

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGLVYDA  ADY  FLCS+GY+++++H IT DNSTC Q  ++ S LNYPSITV
Sbjct  63   NPKRVLDPGLVYDAHSADYVEFLCSVGYDKKAVHQITRDNSTCKQAFRTASDLNYPSITV  122

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P  +  FSVTRTVTNVG P+S Y+A V PP GINVT+VP RL F  +GQK+ FT++FK+A
Sbjct  123  PYXVXNFSVTRTVTNVGXPKSIYRAAVSPPIGINVTIVPNRLIFNRFGQKIKFTVNFKVA  182

Query  276  A-PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            A P +GY FG FSW   ++ V SPLVVRVA S +GL
Sbjct  183  APPAKGYAFGFFSWVRXRSRVTSPLVVRVAHSNSGL  218



>ref|XP_008242125.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 175/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAVHPSWSP+ I+SAIMTTAT+L+KH KPI  DP+GRR N FD+GSGFV
Sbjct  547  CPHVTGIAALIKAVHPSWSPATIRSAIMTTATLLDKHRKPIIVDPEGRRGNPFDYGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGLVYDAQPADY AFLCS+GY+E+++H IT DNS CD   ++ S LNYPSITV
Sbjct  607  NPKRVLDPGLVYDAQPADYVAFLCSVGYDEKTVHQITQDNSRCDHAFRTASDLNYPSITV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTRTVTNVG+P+S YKAVV  P GINVT++P +L F   G+K+NFT++FK+ 
Sbjct  667  PNLEDNFSVTRTVTNVGKPKSIYKAVVSSPIGINVTIIPDQLIFNSLGEKMNFTVNFKVT  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG FSW S ++ V SPLVVRVA S +GL
Sbjct  727  APSKGYAFGFFSWISGRSRVTSPLVVRVAHSNSGL  761



>ref|XP_002317030.2| hypothetical protein POPTR_0011s14930g [Populus trichocarpa]
 gb|EEE97642.2| hypothetical protein POPTR_0011s14930g [Populus trichocarpa]
Length=759

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+TGI  L+KAVHPSWSPSAIKSAIMTTAT+L+K+ +PI  DP+GRRAN+FD+GSGFV
Sbjct  543  CPHITGIATLVKAVHPSWSPSAIKSAIMTTATILDKNDEPIRVDPEGRRANSFDYGSGFV  602

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P+RVLDPGL+YDA P DYKAFLCSIGY+E+SL L+T DNSTCDQT  + S+LNYPSITV
Sbjct  603  DPSRVLDPGLIYDAHPIDYKAFLCSIGYDEKSLRLVTRDNSTCDQTFTTASSLNYPSITV  662

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTRTVTNVG+PRS YKAVV  P GINVTVVP++L F  YGQK+ FT++FK+A
Sbjct  663  PNLKDSFSVTRTVTNVGKPRSVYKAVVSNPVGINVTVVPKQLIFNRYGQKIKFTVNFKVA  722

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
            AP++GY FG  +W S    V SPLVV+ A
Sbjct  723  APSKGYAFGFLTWTSGDARVTSPLVVQAA  751



>ref|XP_007204641.1| hypothetical protein PRUPE_ppa001800mg [Prunus persica]
 gb|EMJ05840.1| hypothetical protein PRUPE_ppa001800mg [Prunus persica]
Length=763

 Score =   310 bits (795),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 175/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAVHPSWSP+ I+SAIMTTAT+L+KH KPI  DP+GRR N FD+GSGFV
Sbjct  547  CPHVTGIAALIKAVHPSWSPATIRSAIMTTATLLDKHRKPIIVDPEGRRGNPFDYGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGLVYDAQPADY AFLCS+GY+E+++H IT DNS CD   ++ S LNYPSITV
Sbjct  607  NPKRVLDPGLVYDAQPADYVAFLCSVGYDEKAVHQITQDNSRCDHAFRTASDLNYPSITV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTRTVTNVG+P+S YKAVV  P GINVT++P +L F   G+K+NFT++FK+ 
Sbjct  667  PNLEDNFSVTRTVTNVGKPKSIYKAVVSSPIGINVTIIPDQLIFNSLGEKINFTVNFKVT  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG FSW S ++ V SPLVVRVA S +GL
Sbjct  727  APSKGYAFGFFSWISGRSRVTSPLVVRVAHSNSGL  761



>ref|XP_006599275.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=726

 Score =   309 bits (792),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHVTGI  L+KAVHPSWSPSAIKSAI+TTAT+L+KHH+PI ADP+ RRANAFD+GSGFVN
Sbjct  511  PHVTGIATLVKAVHPSWSPSAIKSAILTTATILDKHHRPIIADPEQRRANAFDYGSGFVN  570

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PARVLDPGL+YD +PAD+ AFLCS+GY+ RSLH +T DNSTCD+   + S LNYPSI+VP
Sbjct  571  PARVLDPGLIYDLKPADFVAFLCSLGYDPRSLHQVTRDNSTCDRAFSTASDLNYPSISVP  630

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
             L   FSVTR VTNVG+ +S YKAVV PP G+ V+V+P RL F   GQK+NFT++FK+ A
Sbjct  631  NLKDNFSVTRIVTNVGKAKSVYKAVVSPPPGVRVSVIPNRLIFSRIGQKINFTVNFKVTA  690

Query  273  PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            P++GY FG  SWR++++ V SPLVVRVA  + GL
Sbjct  691  PSKGYAFGLLSWRNRRSQVTSPLVVRVAPGKNGL  724



>gb|KHN38839.1| Subtilisin-like protease [Glycine soja]
Length=762

 Score =   310 bits (794),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHVTGI  L+KAVHPSWSPSAIKSAI+TTAT+L+KHH+PI ADP+ RRANAFD+GSGFVN
Sbjct  547  PHVTGIATLVKAVHPSWSPSAIKSAILTTATILDKHHRPIIADPEQRRANAFDYGSGFVN  606

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PARVLDPGL+YD +PAD+ AFLCS+GY+ RSLH +T DNSTCD+   + S LNYPSI+VP
Sbjct  607  PARVLDPGLIYDLKPADFVAFLCSLGYDPRSLHQVTRDNSTCDRAFSTASDLNYPSISVP  666

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
             L   FSVTR VTNVG+ +S YKAVV PP G+ V+V+P RL F   GQK+NFT++FK+ A
Sbjct  667  NLKDNFSVTRIVTNVGKAKSVYKAVVSPPPGVRVSVIPNRLIFSRIGQKINFTVNFKVTA  726

Query  273  PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            P++GY FG  SWR++++ V SPLVVRVA  + GL
Sbjct  727  PSKGYAFGLLSWRNRRSQVTSPLVVRVAPGKNGL  760



>ref|XP_003547892.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=762

 Score =   310 bits (794),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHVTGI  L+KAVHPSWSPSAIKSAI+TTAT+L+KHH+PI ADP+ RRANAFD+GSGFVN
Sbjct  547  PHVTGIATLVKAVHPSWSPSAIKSAILTTATILDKHHRPIIADPEQRRANAFDYGSGFVN  606

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PARVLDPGL+YD +PAD+ AFLCS+GY+ RSLH +T DNSTCD+   + S LNYPSI+VP
Sbjct  607  PARVLDPGLIYDLKPADFVAFLCSLGYDPRSLHQVTRDNSTCDRAFSTASDLNYPSISVP  666

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
             L   FSVTR VTNVG+ +S YKAVV PP G+ V+V+P RL F   GQK+NFT++FK+ A
Sbjct  667  NLKDNFSVTRIVTNVGKAKSVYKAVVSPPPGVRVSVIPNRLIFSRIGQKINFTVNFKVTA  726

Query  273  PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            P++GY FG  SWR++++ V SPLVVRVA  + GL
Sbjct  727  PSKGYAFGLLSWRNRRSQVTSPLVVRVAPGKNGL  760



>ref|XP_011038086.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=761

 Score =   309 bits (792),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+TG+  LIKAVHPSWSPSAIKSAIMTTAT+L+K  KPI  DP+GR ANAFD+GSGFV
Sbjct  545  CPHITGVATLIKAVHPSWSPSAIKSAIMTTATILDKSGKPIRVDPEGRMANAFDYGSGFV  604

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P RVLDPGL+YDA P DYKAFLCSIGY E+SL L+T DNSTC+QT  + S+LNYPSITV
Sbjct  605  DPTRVLDPGLIYDAHPIDYKAFLCSIGYGEKSLRLVTRDNSTCNQTFTTASSLNYPSITV  664

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTRTVTNVG+ RS YKAVV  P GINVTVVP++L F  YGQK+ FT++FK+A
Sbjct  665  PNLKDSFSVTRTVTNVGKARSVYKAVVSNPAGINVTVVPKQLIFNSYGQKIKFTVNFKVA  724

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG  +WRS    V SPL VR A S  GL
Sbjct  725  APSKGYAFGFLTWRSTDARVTSPLAVRAAPSPMGL  759



>ref|XP_009359651.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=764

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 178/216 (82%), Gaps = 1/216 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAV+PSWSP+AI+SAIMTTAT+L+K+HKPI  DP+GRRANAFD+GSGFV
Sbjct  547  CPHVTGIAALIKAVYPSWSPAAIRSAIMTTATLLDKNHKPILVDPEGRRANAFDYGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGLVYD   ADY  FLCS+GY+E+++H IT DNSTC Q  ++ S LNYPSITV
Sbjct  607  NPKRVLDPGLVYDVHSADYVEFLCSVGYDEKAVHQITQDNSTCKQAFRTASDLNYPSITV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L+  FSVTRTVTNVG+P+S YKAVV  P GINVT+VP RL F  +GQK+ FT++FK+A
Sbjct  667  PYLVGNFSVTRTVTNVGKPKSIYKAVVSSPVGINVTIVPNRLIFNRFGQKIQFTVNFKVA  726

Query  276  A-PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            A P++GY FG FSW S ++ V SPLVVRVA S +GL
Sbjct  727  APPSKGYAFGFFSWVSGRSRVTSPLVVRVAYSNSGL  762



>ref|XP_010270603.1| PREDICTED: subtilisin-like protease SBT5.3 [Nelumbo nucifera]
Length=759

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 175/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI AL+KAV+PSWSPSAIKSAIMTTAT+L+K+ KPI  DP+GRR N+FD+GSGF+
Sbjct  543  CPHVTGIAALVKAVYPSWSPSAIKSAIMTTATILDKNGKPIMVDPEGRRGNSFDYGSGFI  602

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP  VL+PGLVYDA+P DY++FLCSIGY ERS+HLIT DNSTC+ TL + S LNYPSI V
Sbjct  603  NPTGVLNPGLVYDAKPVDYESFLCSIGYGERSVHLITSDNSTCNHTLVTASDLNYPSIIV  662

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   ++V RTVTNVGEPRS Y+AVV PP GINVTV P+ L F  YGQ +NFT++FK+ 
Sbjct  663  PNLKDSYTVIRTVTNVGEPRSIYRAVVSPPPGINVTVTPKFLVFNSYGQNINFTVNFKVV  722

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            +P++GYVFGS +W+ +K  V SPLV R+A S  GL
Sbjct  723  SPSKGYVFGSLTWKKRKQRVTSPLVARIASSDFGL  757



>gb|KCW53326.1| hypothetical protein EUGRSUZ_J02574 [Eucalyptus grandis]
Length=667

 Score =   305 bits (780),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 170/207 (82%), Gaps = 0/207 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV GI  LIKAVHP+WSPSAIKSAIMTTAT+L+K  KPI+ DP+GRR + FDFGSGFV
Sbjct  450  CPHVAGIATLIKAVHPTWSPSAIKSAIMTTATMLDKKRKPITVDPNGRRGSPFDFGSGFV  509

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P RVL PGLVYDAQP DYKAFLCSIGY+++ L L+T DNSTCD    S + LNYPSI V
Sbjct  510  SPTRVLSPGLVYDAQPDDYKAFLCSIGYDDKKLRLLTRDNSTCDPRPASATELNYPSIVV  569

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + SVTRTVTNVGEPRS+Y+A+V  PRGINVTVVPRRL F+ YGQK++FT+ FK+A
Sbjct  570  PRLKDEISVTRTVTNVGEPRSTYEAMVSHPRGINVTVVPRRLVFERYGQKISFTVKFKVA  629

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVR  196
            APT+GY FG  +WR+KK  V SPLVVR
Sbjct  630  APTEGYRFGFLAWRNKKLLVTSPLVVR  656



>ref|XP_006467138.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=726

 Score =   306 bits (784),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 170/215 (79%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  LIKAVHPSWSPSAIKSAIMTTAT L+K+HKPI+ DP+GRR NAFD+GSGF+
Sbjct  510  CPHVTGIATLIKAVHPSWSPSAIKSAIMTTATALDKNHKPITVDPEGRRGNAFDYGSGFL  569

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +VL PGL+YDAQP DY  FLCSIGY+E+SLHL+T DNS C Q L +P  LNYPSITV
Sbjct  570  NPRKVLSPGLIYDAQPIDYTVFLCSIGYDEKSLHLVTRDNSKCSQKLPAPYDLNYPSITV  629

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR+VTNVG+PRS YKAVV  P G+ VTV P RL F  YGQK+NFT+ FK+ 
Sbjct  630  PNLKGNFSVTRSVTNVGKPRSIYKAVVSSPVGVTVTVAPERLIFNSYGQKINFTVHFKLT  689

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            +P +GY FG  SW++ K  V SPLVV+VA S  GL
Sbjct  690  SPPKGYGFGYLSWKNGKLRVTSPLVVQVAPSDMGL  724



>gb|KCW53325.1| hypothetical protein EUGRSUZ_J02574 [Eucalyptus grandis]
Length=705

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 170/207 (82%), Gaps = 0/207 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV GI  LIKAVHP+WSPSAIKSAIMTTAT+L+K  KPI+ DP+GRR + FDFGSGFV
Sbjct  488  CPHVAGIATLIKAVHPTWSPSAIKSAIMTTATMLDKKRKPITVDPNGRRGSPFDFGSGFV  547

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P RVL PGLVYDAQP DYKAFLCSIGY+++ L L+T DNSTCD    S + LNYPSI V
Sbjct  548  SPTRVLSPGLVYDAQPDDYKAFLCSIGYDDKKLRLLTRDNSTCDPRPASATELNYPSIVV  607

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + SVTRTVTNVGEPRS+Y+A+V  PRGINVTVVPRRL F+ YGQK++FT+ FK+A
Sbjct  608  PRLKDEISVTRTVTNVGEPRSTYEAMVSHPRGINVTVVPRRLVFERYGQKISFTVKFKVA  667

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVR  196
            APT+GY FG  +WR+KK  V SPLVVR
Sbjct  668  APTEGYRFGFLAWRNKKLLVTSPLVVR  694



>ref|XP_006425216.1| hypothetical protein CICLE_v10024941mg [Citrus clementina]
 ref|XP_006467137.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 gb|ESR38456.1| hypothetical protein CICLE_v10024941mg [Citrus clementina]
Length=768

 Score =   306 bits (784),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 170/215 (79%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  LIKAVHPSWSPSAIKSAIMTTAT L+K+HKPI+ DP+GRR NAFD+GSGF+
Sbjct  552  CPHVTGIATLIKAVHPSWSPSAIKSAIMTTATALDKNHKPITVDPEGRRGNAFDYGSGFL  611

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +VL PGL+YDAQP DY  FLCSIGY+E+SLHL+T DNS C Q L +P  LNYPSITV
Sbjct  612  NPRKVLSPGLIYDAQPIDYTVFLCSIGYDEKSLHLVTRDNSKCSQKLPAPYDLNYPSITV  671

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR+VTNVG+PRS YKAVV  P G+ VTV P RL F  YGQK+NFT+ FK+ 
Sbjct  672  PNLKGNFSVTRSVTNVGKPRSIYKAVVSSPVGVTVTVAPERLIFNSYGQKINFTVHFKLT  731

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            +P +GY FG  SW++ K  V SPLVV+VA S  GL
Sbjct  732  SPPKGYGFGYLSWKNGKLRVTSPLVVQVAPSDMGL  766



>ref|XP_007158047.1| hypothetical protein PHAVU_002G119700g [Phaseolus vulgaris]
 gb|ESW30041.1| hypothetical protein PHAVU_002G119700g [Phaseolus vulgaris]
Length=763

 Score =   305 bits (781),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 173/215 (80%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHP+WSPSAIKSAIMTTATVL+K H+PI ADPD RRANAFD+GSGFV
Sbjct  547  CPHVTGIATLVKAVHPTWSPSAIKSAIMTTATVLDKRHQPIRADPDKRRANAFDYGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +VLDPGLVYD+ P D+ AFLCS+GY+ERSL L+T DNSTCD+  ++PS LNYPSI V
Sbjct  607  NPTKVLDPGLVYDSHPNDFVAFLCSLGYDERSLRLVTRDNSTCDRAFKTPSDLNYPSIAV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+ RS Y++VV  P G+NVTVVP RL F   GQK+ F ++FK+A
Sbjct  667  PNLEDIFSVTRVVTNVGKARSIYRSVVLSPAGVNVTVVPNRLVFTRVGQKIKFNVTFKVA  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG  SW+++ + V SPLVVRVA +  GL
Sbjct  727  APSKGYAFGFLSWKNRISQVTSPLVVRVAPASLGL  761



>ref|XP_010033628.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=764

 Score =   305 bits (781),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 170/207 (82%), Gaps = 0/207 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV GI  LIKAVHP+WSPSAIKSAIMTTAT+L+K  KPI+ DP+GRR + FDFGSGFV
Sbjct  547  CPHVAGIATLIKAVHPTWSPSAIKSAIMTTATMLDKKRKPITVDPNGRRGSPFDFGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P RVL PGLVYDAQP DYKAFLCSIGY+++ L L+T DNSTCD    S + LNYPSI V
Sbjct  607  SPTRVLSPGLVYDAQPDDYKAFLCSIGYDDKKLRLLTRDNSTCDPRPASATELNYPSIVV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + SVTRTVTNVGEPRS+Y+A+V  PRGINVTVVPRRL F+ YGQK++FT+ FK+A
Sbjct  667  PRLKDEISVTRTVTNVGEPRSTYEAMVSHPRGINVTVVPRRLVFERYGQKISFTVKFKVA  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVR  196
            APT+GY FG  +WR+KK  V SPLVVR
Sbjct  727  APTEGYRFGFLAWRNKKLLVTSPLVVR  753



>ref|XP_009369762.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=764

 Score =   305 bits (780),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 175/216 (81%), Gaps = 1/216 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAV+PSWSP+AI+SAIMTTAT+L+K+HKPI  DP+GRR NAFD+GSGFV
Sbjct  547  CPHVTGIAALIKAVYPSWSPAAIRSAIMTTATLLDKNHKPILVDPEGRRGNAFDYGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGLVYDA  ADY  FLCS+GY+++++H IT DNSTC Q  ++ S LNYPSITV
Sbjct  607  NPKRVLDPGLVYDAHSADYVEFLCSVGYDKKAVHQITRDNSTCKQAFRTASDLNYPSITV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L+  FSVTRTVTNVG P+S Y+A V PP GINVT+VP RL F  +GQK+ FT++FK+A
Sbjct  667  PYLVGNFSVTRTVTNVGRPKSIYRAAVSPPIGINVTIVPNRLIFNRFGQKIKFTVNFKVA  726

Query  276  A-PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            A P +GY FG FSW   ++ V SPLVVRVA S +GL
Sbjct  727  APPAKGYAFGFFSWVRGRSRVTSPLVVRVADSNSGL  762



>ref|XP_007156353.1| hypothetical protein PHAVU_003G279300g [Phaseolus vulgaris]
 gb|ESW28347.1| hypothetical protein PHAVU_003G279300g [Phaseolus vulgaris]
Length=757

 Score =   305 bits (780),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHVTGI  L+KAVHPSWSPSAIKSAIMTTAT+L+KHH+PI ADP+ RRANAFD+GSGFVN
Sbjct  546  PHVTGIATLVKAVHPSWSPSAIKSAIMTTATILDKHHRPIIADPEQRRANAFDYGSGFVN  605

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PARVLDPGL+YD++PADY AFLCS+GY++RSLH +T DNSTCD+   + S LNYPSI+VP
Sbjct  606  PARVLDPGLIYDSEPADYVAFLCSLGYDQRSLHQVTRDNSTCDRAFNTASDLNYPSISVP  665

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
             L   F VTR VTNVG+ RS YKAVV  P G+ V+V+P RL F   GQK+NFT+ FK+ A
Sbjct  666  NLKDNFFVTRIVTNVGKARSVYKAVVSSPPGVRVSVIPNRLIFTRIGQKMNFTVKFKITA  725

Query  273  PTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
            P++GY FG  SWR+ ++ V SPLVV++A
Sbjct  726  PSKGYAFGFLSWRNGRSQVTSPLVVQLA  753



>gb|KDO71607.1| hypothetical protein CISIN_1g004205mg [Citrus sinensis]
Length=768

 Score =   305 bits (780),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 169/215 (79%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  LIKAVHPSWSPSAIKSAIMTTAT L+K+HKPI+ DP GRR NAFD+GSGF+
Sbjct  552  CPHVTGIATLIKAVHPSWSPSAIKSAIMTTATALDKNHKPITVDPKGRRGNAFDYGSGFL  611

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +VL PGL+YDAQP DY  FLCSIGY+E+SLHL+T DNS C Q L +P  LNYPSITV
Sbjct  612  NPRKVLSPGLIYDAQPIDYTVFLCSIGYDEKSLHLVTRDNSKCSQKLPAPYDLNYPSITV  671

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR+VTNVG+PRS YKAVV  P G+ VTV P RL F  YGQK+NFT+ FK+ 
Sbjct  672  PNLKGNFSVTRSVTNVGKPRSIYKAVVSSPVGVTVTVAPERLIFNSYGQKINFTVHFKLT  731

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            +P +GY FG  SW++ K  V SPLVV+VA S  GL
Sbjct  732  SPPKGYGFGYLSWKNGKLRVTSPLVVQVAPSDMGL  766



>ref|XP_007046422.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOX90579.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=761

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 176/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSA+MTTAT+L+K  KPI+ DP+G RANAFD+GSGFV
Sbjct  545  CPHVTGIATLVKAVHPSWSPSAIKSALMTTATILDKKRKPITVDPEGGRANAFDYGSGFV  604

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +VLDPGL+YD QP +Y+AFLCSIGY+E+SLHLIT DNSTC +TL++ S LNYPSITV
Sbjct  605  NPRKVLDPGLIYDVQPKEYRAFLCSIGYDEKSLHLITRDNSTCKETLRTASDLNYPSITV  664

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              L  + SV RTVTNVG+P+S+YKAVV  P GIN+TVVP+RL F  YGQK++FT+ F++A
Sbjct  665  VNLRDRTSVIRTVTNVGKPKSTYKAVVSSPIGINITVVPKRLIFHSYGQKISFTVHFEVA  724

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
             P +GY FG  +WR++K  V SPLVV +A S  GL
Sbjct  725  GPRKGYAFGFLTWRNRKLRVTSPLVVGLAPSDMGL  759



>ref|XP_004287692.1| PREDICTED: subtilisin-like protease SBT3.5 [Fragaria vesca subsp. 
vesca]
Length=763

 Score =   302 bits (774),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 174/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAVHPSWSP+AI+SAIMT+AT+L+K HKPI  DP+G++ NAFD+GSGF+
Sbjct  547  CPHVTGIAALIKAVHPSWSPAAIRSAIMTSATLLDKKHKPIIVDPEGKKGNAFDYGSGFL  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP R LDPGLVYDAQPADY +FLCS+GY+E+SLH IT DNSTC Q  ++ + LNYPSITV
Sbjct  607  NPTRALDPGLVYDAQPADYVSFLCSVGYDEKSLHQITLDNSTCAQAFRTATDLNYPSITV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    SVTRTVTNVG+P + YKA V  P+GINVTV+P RL F   GQK++FT++FK+ 
Sbjct  667  PNLEGNISVTRTVTNVGKPENIYKAAVSSPKGINVTVIPNRLVFTSLGQKISFTVNFKVV  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GY FG  SW S ++ V SPLVV+VA S +GL
Sbjct  727  APSKGYTFGFLSWMSGRSRVTSPLVVQVAHSNSGL  761



>ref|XP_008344175.1| PREDICTED: subtilisin-like protease isoform X1 [Malus domestica]
Length=764

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 174/216 (81%), Gaps = 1/216 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAV+PSWSP+AI+SAIMTTAT+L+K+ KPI  DP+GRR NAFD+GSGFV
Sbjct  547  CPHVTGIAALIKAVYPSWSPAAIRSAIMTTATLLDKNSKPILVDPEGRRGNAFDYGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP RVLDPGLVYDA  ADY  FLCS+GY+++++H IT DNSTC Q  ++ S LNYPSITV
Sbjct  607  NPKRVLDPGLVYDAHSADYVEFLCSVGYDKKAVHQITRDNSTCKQAFRTASDLNYPSITV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L+  FSVTRTVTNVG P+S Y+A V PP GINVT+VP RL F  +GQK+ FT++FK+A
Sbjct  667  PYLVGNFSVTRTVTNVGRPKSIYRAAVSPPIGINVTIVPNRLIFNRFGQKIKFTVNFKVA  726

Query  276  A-PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            A P +GY FG FSW   ++ V SPLVVRVA S +GL
Sbjct  727  APPAKGYAFGFFSWVRGRSRVTSPLVVRVAHSNSGL  762



>gb|KCW53324.1| hypothetical protein EUGRSUZ_J02574 [Eucalyptus grandis]
Length=911

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 170/207 (82%), Gaps = 0/207 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV GI  LIKAVHP+WSPSAIKSAIMTTAT+L+K  KPI+ DP+GRR + FDFGSGFV
Sbjct  694  CPHVAGIATLIKAVHPTWSPSAIKSAIMTTATMLDKKRKPITVDPNGRRGSPFDFGSGFV  753

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P RVL PGLVYDAQP DYKAFLCSIGY+++ L L+T DNSTCD    S + LNYPSI V
Sbjct  754  SPTRVLSPGLVYDAQPDDYKAFLCSIGYDDKKLRLLTRDNSTCDPRPASATELNYPSIVV  813

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + SVTRTVTNVGEPRS+Y+A+V  PRGINVTVVPRRL F+ YGQK++FT+ FK+A
Sbjct  814  PRLKDEISVTRTVTNVGEPRSTYEAMVSHPRGINVTVVPRRLVFERYGQKISFTVKFKVA  873

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVR  196
            APT+GY FG  +WR+KK  V SPLVVR
Sbjct  874  APTEGYRFGFLAWRNKKLLVTSPLVVR  900



>ref|XP_004512299.1| PREDICTED: subtilisin-like protease-like isoform X3 [Cicer arietinum]
Length=727

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 169/215 (79%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  LIKA HPSWSPSAIKSAIMTTAT+L+K H+PI ADPD RRANAFD+GSGFV
Sbjct  511  CPHVTGIATLIKAAHPSWSPSAIKSAIMTTATILDKKHEPIRADPDRRRANAFDYGSGFV  570

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NPARVL+PGLVYD+QP D+ AFLCSIGY+E+SL L+TGDNSTCD   ++PS LNYPSI V
Sbjct  571  NPARVLEPGLVYDSQPEDFVAFLCSIGYDEKSLRLVTGDNSTCDGAFKTPSDLNYPSIAV  630

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FS TR VTNVG+ RS Y+A V  P G+NVTVVP RL F   GQK+ FT++FK+ 
Sbjct  631  PNLEGYFSATRVVTNVGKARSIYEAEVVSPDGVNVTVVPTRLVFTRTGQKIKFTVNFKVI  690

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP +GY FG  +WR+  + V SP+VV+VA    GL
Sbjct  691  APLKGYGFGFLTWRNGISQVTSPIVVQVATPSLGL  725



>ref|XP_011004403.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=759

 Score =   300 bits (768),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+TGI  L+KAVHPSWSPSAIKSAIMTTAT+L+K+ +PI   P+GRRAN+FD+GSGFV
Sbjct  543  CPHITGIATLVKAVHPSWSPSAIKSAIMTTATILDKNAEPIRVAPEGRRANSFDYGSGFV  602

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P RVLDPGL+YDA P DYKAFLCSIGY+E+SL L+T DNSTCDQT  + S+LNYPSITV
Sbjct  603  DPTRVLDPGLIYDAHPKDYKAFLCSIGYDEKSLRLVTRDNSTCDQTFTTASSLNYPSITV  662

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              +   FSVTRTVTNVG+P+S YKA V  P GINVTVVP++L F  YGQK+ FT++FK+A
Sbjct  663  TNVKDSFSVTRTVTNVGKPKSVYKAAVSNPMGINVTVVPKQLIFNRYGQKIKFTVNFKVA  722

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
            AP++GY FG  +W S    V SPLVV+ A
Sbjct  723  APSKGYAFGFLTWTSGDARVTSPLVVQAA  751



>ref|XP_010928976.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=763

 Score =   300 bits (768),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 174/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTG+VALIKAVHPSWSPSAIKSAIMTTAT+L+K+   I+ADP+G     FD+GSGF 
Sbjct  548  CPHVTGLVALIKAVHPSWSPSAIKSAIMTTATILDKNGNVITADPEGHAGTPFDYGSGFP  607

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P R LDPGL+Y+A+P DYKAFLCSIGY+++SL L+TGDNS C +   + S LNYPSIT+
Sbjct  608  DPKRALDPGLIYNAEPEDYKAFLCSIGYDDKSLQLVTGDNSVCTKPAPAASNLNYPSITI  667

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   +SVTRTVTNVGEPRS Y A++  P GINVTVVP+ L F+ YGQK+NFT+ F++A
Sbjct  668  PDLKGSYSVTRTVTNVGEPRSIYHAILSHPAGINVTVVPKVLVFERYGQKMNFTVKFRVA  727

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP++GYVFGS SW+++K  V SPLVVRV  S TGL
Sbjct  728  APSKGYVFGSLSWKAEKIQVTSPLVVRVQSSDTGL  762



>ref|XP_004512298.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=743

 Score =   300 bits (767),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 169/214 (79%), Gaps = 0/214 (0%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHVTGI  LIKA HPSWSPSAIKSAIMTTAT+L+K H+PI ADPD RRANAFD+GSGFVN
Sbjct  528  PHVTGIATLIKAAHPSWSPSAIKSAIMTTATILDKKHEPIRADPDRRRANAFDYGSGFVN  587

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PARVL+PGLVYD+QP D+ AFLCSIGY+E+SL L+TGDNSTCD   ++PS LNYPSI VP
Sbjct  588  PARVLEPGLVYDSQPEDFVAFLCSIGYDEKSLRLVTGDNSTCDGAFKTPSDLNYPSIAVP  647

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
             L   FS TR VTNVG+ RS Y+A V  P G+NVTVVP RL F   GQK+ FT++FK+ A
Sbjct  648  NLEGYFSATRVVTNVGKARSIYEAEVVSPDGVNVTVVPTRLVFTRTGQKIKFTVNFKVIA  707

Query  273  PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            P +GY FG  +WR+  + V SP+VV+VA    GL
Sbjct  708  PLKGYGFGFLTWRNGISQVTSPIVVQVATPSLGL  741



>gb|KEH27645.1| subtilisin-like serine protease [Medicago truncatula]
Length=728

 Score =   299 bits (766),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 170/214 (79%), Gaps = 0/214 (0%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHVTGI ALIKAVHPSWSPSAIKSAIMTTAT+++K ++PI ADPD RRA+AFD+GSGFVN
Sbjct  513  PHVTGIAALIKAVHPSWSPSAIKSAIMTTATIVDKKNEPIRADPDRRRADAFDYGSGFVN  572

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PA  LDPGLVYD+Q  D+ AFLCSIGY+ +SLHL+T DNSTCD   +SPS LNYPSITVP
Sbjct  573  PAGALDPGLVYDSQSEDFVAFLCSIGYDVKSLHLVTRDNSTCDGAFKSPSDLNYPSITVP  632

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
             L   FS TR VTNVG+ RS Y+A V  P G+NVTVVP RL F   GQK+ FT++FK+ A
Sbjct  633  NLEDSFSATRVVTNVGKARSVYEAEVLSPDGVNVTVVPNRLVFTRTGQKIKFTVNFKVIA  692

Query  273  PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            P +GY FG  +WRS+ + V SPLVV+VA +  GL
Sbjct  693  PLKGYGFGFLTWRSRMSQVTSPLVVKVATASLGL  726



>ref|XP_010101169.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB87530.1| Subtilisin-like protease [Morus notabilis]
Length=769

 Score =   300 bits (768),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSAIMTTA+ L+K   PI  DPDG+R NAFD+GSGF+
Sbjct  552  CPHVTGIATLVKAVHPSWSPSAIKSAIMTTASALDKKRSPILVDPDGKRGNAFDYGSGFM  611

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCD-QTLQSPSALNYPSIT  460
            NP +VLDPGLVYDA P+DY  FLCSIGY+E+SL  ITG N+TCD  +L + S LNYPSIT
Sbjct  612  NPTKVLDPGLVYDAHPSDYIGFLCSIGYDEKSLQQITGYNTTCDHHSLVTASDLNYPSIT  671

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            VP L  + SVTRTVTNVG+P+S Y+A V  PRGINVTVVP RL F  + QK+ FT++FK+
Sbjct  672  VPNLKDEMSVTRTVTNVGKPKSVYRARVSLPRGINVTVVPDRLVFTSFEQKMKFTVTFKV  731

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AAPT+GY FG  SWRS+++ V SPLVVRVA S +GL
Sbjct  732  AAPTKGYAFGFLSWRSRRSRVVSPLVVRVANSDSGL  767



>ref|XP_004512297.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
Length=763

 Score =   300 bits (767),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 169/215 (79%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  LIKA HPSWSPSAIKSAIMTTAT+L+K H+PI ADPD RRANAFD+GSGFV
Sbjct  547  CPHVTGIATLIKAAHPSWSPSAIKSAIMTTATILDKKHEPIRADPDRRRANAFDYGSGFV  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NPARVL+PGLVYD+QP D+ AFLCSIGY+E+SL L+TGDNSTCD   ++PS LNYPSI V
Sbjct  607  NPARVLEPGLVYDSQPEDFVAFLCSIGYDEKSLRLVTGDNSTCDGAFKTPSDLNYPSIAV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FS TR VTNVG+ RS Y+A V  P G+NVTVVP RL F   GQK+ FT++FK+ 
Sbjct  667  PNLEGYFSATRVVTNVGKARSIYEAEVVSPDGVNVTVVPTRLVFTRTGQKIKFTVNFKVI  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP +GY FG  +WR+  + V SP+VV+VA    GL
Sbjct  727  APLKGYGFGFLTWRNGISQVTSPIVVQVATPSLGL  761



>ref|XP_003612438.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES95396.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   299 bits (765),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 170/215 (79%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAVHPSWSPSAIKSAIMTTAT+++K ++PI ADPD RRA+AFD+GSGFV
Sbjct  544  CPHVTGIAALIKAVHPSWSPSAIKSAIMTTATIVDKKNEPIRADPDRRRADAFDYGSGFV  603

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NPA  LDPGLVYD+Q  D+ AFLCSIGY+ +SLHL+T DNSTCD   +SPS LNYPSITV
Sbjct  604  NPAGALDPGLVYDSQSEDFVAFLCSIGYDVKSLHLVTRDNSTCDGAFKSPSDLNYPSITV  663

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FS TR VTNVG+ RS Y+A V  P G+NVTVVP RL F   GQK+ FT++FK+ 
Sbjct  664  PNLEDSFSATRVVTNVGKARSVYEAEVLSPDGVNVTVVPNRLVFTRTGQKIKFTVNFKVI  723

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            AP +GY FG  +WRS+ + V SPLVV+VA +  GL
Sbjct  724  APLKGYGFGFLTWRSRMSQVTSPLVVKVATASLGL  758



>ref|XP_008796284.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=761

 Score =   298 bits (762),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 174/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTG+VALIKAVHP+WSPSAIKSAIMT+AT+L+++   I+ADPDGR AN FD+GSGF 
Sbjct  546  CPHVTGLVALIKAVHPAWSPSAIKSAIMTSATMLDRNGNVITADPDGRAANPFDYGSGFP  605

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P+ +LDPGL+YDAQ ADYKAFLCS+GY+++SL  ITGDNS C +     S LNYPSITV
Sbjct  606  DPSGLLDPGLIYDAQAADYKAFLCSVGYDDKSLQQITGDNSVCIRPSPIASNLNYPSITV  665

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   +S+TRTVTNVG+PRS Y+AVV PP GINVTV+P  L FK Y QK+NFT++F+  
Sbjct  666  PDLKSSYSITRTVTNVGQPRSVYRAVVSPPTGINVTVIPEVLIFKSYDQKINFTVNFRAV  725

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
             P++ YVFGS SW+SKK  V SPLVVRV+ S TGL
Sbjct  726  VPSKDYVFGSLSWKSKKFHVTSPLVVRVSSSNTGL  760



>ref|XP_010927443.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=605

 Score =   288 bits (737),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 169/215 (79%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTG+VALIKAVHP+WSPSAIKSAIMT+AT L+++   I+ADPDGR AN FD+GSGF 
Sbjct  390  CPHVTGLVALIKAVHPTWSPSAIKSAIMTSATTLDQNGNVITADPDGRAANPFDYGSGFP  449

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P+ +LDPGL+YDAQ ADYKAFLCS+GY++RSL  ITGD+S C +     S LNYPSITV
Sbjct  450  DPSGLLDPGLIYDAQAADYKAFLCSVGYDDRSLQQITGDHSVCIKPSPLASNLNYPSITV  509

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   +S+TRT TNVG+ RS Y+AVV PP GINVTV+P  L FK Y QKLNFT++F+  
Sbjct  510  PDLKGSYSITRTATNVGQTRSVYRAVVSPPAGINVTVIPEVLIFKSYAQKLNFTVNFRAV  569

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
              ++ YVFGS SW+SK   V SPLVVR + S+TGL
Sbjct  570  VASKDYVFGSLSWKSKNAHVTSPLVVRASSSKTGL  604



>ref|XP_004509478.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Cicer 
arietinum]
Length=726

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 168/216 (78%), Gaps = 1/216 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSAIMTTAT+L+KHH+PIS DP+ +RANAFD+GSGF+
Sbjct  509  CPHVTGIATLVKAVHPSWSPSAIKSAIMTTATILDKHHRPISIDPERKRANAFDYGSGFL  568

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NPARVL+PGL+YD++P D+  FLCS+GY++RS+HL+T DNSTC     + S LNYPSI V
Sbjct  569  NPARVLEPGLIYDSEPIDFITFLCSLGYDQRSIHLVTRDNSTCKSAFTTASNLNYPSIAV  628

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+P+S YKAVV  P G+NVTV P +L F   GQK+ FT++FK  
Sbjct  629  PNLKDHFSVTRVVTNVGKPQSIYKAVVSSPHGVNVTVTPNQLVFARIGQKIKFTVNFKAT  688

Query  276  A-PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            +   +GY FG  SW +K+  V SPLVV+VA  + GL
Sbjct  689  SFSKKGYKFGFLSWTNKRLQVTSPLVVKVAPGKHGL  724



>ref|XP_004509477.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Cicer 
arietinum]
Length=762

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 168/216 (78%), Gaps = 1/216 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSAIMTTAT+L+KHH+PIS DP+ +RANAFD+GSGF+
Sbjct  545  CPHVTGIATLVKAVHPSWSPSAIKSAIMTTATILDKHHRPISIDPERKRANAFDYGSGFL  604

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NPARVL+PGL+YD++P D+  FLCS+GY++RS+HL+T DNSTC     + S LNYPSI V
Sbjct  605  NPARVLEPGLIYDSEPIDFITFLCSLGYDQRSIHLVTRDNSTCKSAFTTASNLNYPSIAV  664

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+P+S YKAVV  P G+NVTV P +L F   GQK+ FT++FK  
Sbjct  665  PNLKDHFSVTRVVTNVGKPQSIYKAVVSSPHGVNVTVTPNQLVFARIGQKIKFTVNFKAT  724

Query  276  A-PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            +   +GY FG  SW +K+  V SPLVV+VA  + GL
Sbjct  725  SFSKKGYKFGFLSWTNKRLQVTSPLVVKVAPGKHGL  760



>gb|KEH20335.1| subtilisin-like serine protease [Medicago truncatula]
Length=713

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 164/209 (78%), Gaps = 0/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSAIMTTAT+L+K HKPIS DP+ +RANAFD+GSGF+
Sbjct  505  CPHVTGIATLVKAVHPSWSPSAIKSAIMTTATILDKRHKPISVDPEQKRANAFDYGSGFL  564

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NPARVLDPGL+YD++P D+  FLCS+GY++RSLHL+T DNSTC   + + S LNYPSI+V
Sbjct  565  NPARVLDPGLIYDSEPTDFITFLCSLGYDQRSLHLVTRDNSTCKSKITTASNLNYPSISV  624

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+    Y ++V  P G+NVTVVP RL F   GQK+ F+++FK+ 
Sbjct  625  PNLKDNFSVTRVVTNVGKATIIYNSIVSAPPGVNVTVVPNRLAFTRIGQKIKFSVNFKVT  684

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
            + ++GY FG  SW +++  V SPLVV+V 
Sbjct  685  SSSKGYKFGFLSWTNRRLQVTSPLVVKVG  713



>ref|XP_003629039.1| Serine protease-like protein [Medicago truncatula]
 gb|AET03515.1| subtilisin-like serine protease [Medicago truncatula]
Length=755

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 164/209 (78%), Gaps = 0/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI  L+KAVHPSWSPSAIKSAIMTTAT+L+K HKPIS DP+ +RANAFD+GSGF+
Sbjct  547  CPHVTGIATLVKAVHPSWSPSAIKSAIMTTATILDKRHKPISVDPEQKRANAFDYGSGFL  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NPARVLDPGL+YD++P D+  FLCS+GY++RSLHL+T DNSTC   + + S LNYPSI+V
Sbjct  607  NPARVLDPGLIYDSEPTDFITFLCSLGYDQRSLHLVTRDNSTCKSKITTASNLNYPSISV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   FSVTR VTNVG+    Y ++V  P G+NVTVVP RL F   GQK+ F+++FK+ 
Sbjct  667  PNLKDNFSVTRVVTNVGKATIIYNSIVSAPPGVNVTVVPNRLAFTRIGQKIKFSVNFKVT  726

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
            + ++GY FG  SW +++  V SPLVV+V 
Sbjct  727  SSSKGYKFGFLSWTNRRLQVTSPLVVKVG  755



>gb|EYU31525.1| hypothetical protein MIMGU_mgv1a001949mg [Erythranthe guttata]
Length=735

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTG VALIK++HPSWSPSAIKSAIMTTAT L+K+ K I+A PDGR+AN FDFGSGFV
Sbjct  517  CPHVTGTVALIKSMHPSWSPSAIKSAIMTTATTLDKNKKAITAGPDGRKANPFDFGSGFV  576

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSIT  460
            NP + LDPGL+Y+A   DYK FLCSIGY+  +L +ITGD STC ++T ++PS LNYPSIT
Sbjct  577  NPTQALDPGLIYEATTNDYKDFLCSIGYSNITLQMITGDKSTCNNRTFKTPSDLNYPSIT  636

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            VP L   FSV+R +TNVG     Y+AVV PP GI V+VVP RL F   GQ + FT+ F +
Sbjct  637  VPNLKKSFSVSRILTNVGVAEIVYEAVVVPPIGIKVSVVPLRLVFNRVGQNIKFTVKFDV  696

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTG  175
             AP++ YVFGS SWR+K   + +PLVVR   S++G
Sbjct  697  IAPSKDYVFGSLSWRNKGYSLTTPLVVRTGNSKSG  731



>ref|XP_009420549.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=763

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 164/215 (76%), Gaps = 0/215 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH TG+VALIKAV+P+W+PSAIKSAIMTTA+V +K+   I+ADP GR A+ FD+G+GF 
Sbjct  548  CPHATGLVALIKAVYPTWTPSAIKSAIMTTASVTDKNGGAITADPKGRPADPFDYGAGFP  607

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P+R+LDPGLVYDAQP DY+AFLCS+GY+++SL LITGD S C     + S LNYPSITV
Sbjct  608  DPSRLLDPGLVYDAQPPDYRAFLCSVGYDDKSLQLITGDGSVCSGPRPAASDLNYPSITV  667

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L     +TRTVTNVG+P + Y+  V PP GINVTVVP  LTF  YGQKLNFT++F+  
Sbjct  668  PDLKGSSHITRTVTNVGKPGAVYRVQVSPPTGINVTVVPNILTFTSYGQKLNFTVTFRAT  727

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
             P++ YVFG  SWR+ K  V SPL VR + S TGL
Sbjct  728  YPSKDYVFGYISWRTHKIRVTSPLAVRASSSDTGL  762



>gb|ERN11499.1| hypothetical protein AMTR_s00022p00110120 [Amborella trichopoda]
Length=673

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 166/209 (79%), Gaps = 1/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGIVALIKAVHP+WSPSAIKSA+MTTAT+ +K+   I+ +P+GR AN FDFG+GF+
Sbjct  458  CPHVTGIVALIKAVHPTWSPSAIKSALMTTATIFDKNGSVITVNPEGRPANPFDFGAGFM  517

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P RVL+PGL+YD++P D+K FLCSIGY+ +SL LITGDNS C ++  + S LNYPSITV
Sbjct  518  RPERVLNPGLIYDSRPNDFKDFLCSIGYDNKSLRLITGDNSICTKS-STDSTLNYPSITV  576

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    S+TRTVTNVG+P+S Y+A+V  P G+ VTVVP+ LTFK +G+++NFT++F++ 
Sbjct  577  PDLRDNCSITRTVTNVGKPKSIYRAMVSKPAGVEVTVVPKLLTFKSFGEEINFTVNFRVV  636

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
            AP +GY FGS +W+  K  V S LVVRV 
Sbjct  637  APYKGYSFGSLAWKRGKVRVTSALVVRVG  665



>ref|XP_006849918.2| PREDICTED: subtilisin-like protease SBT3.5 [Amborella trichopoda]
Length=741

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 166/209 (79%), Gaps = 1/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGIVALIKAVHP+WSPSAIKSA+MTTAT+ +K+   I+ +P+GR AN FDFG+GF+
Sbjct  526  CPHVTGIVALIKAVHPTWSPSAIKSALMTTATIFDKNGSVITVNPEGRPANPFDFGAGFM  585

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P RVL+PGL+YD++P D+K FLCSIGY+ +SL LITGDNS C ++  + S LNYPSITV
Sbjct  586  RPERVLNPGLIYDSRPNDFKDFLCSIGYDNKSLRLITGDNSICTKS-STDSTLNYPSITV  644

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    S+TRTVTNVG+P+S Y+A+V  P G+ VTVVP+ LTFK +G+++NFT++F++ 
Sbjct  645  PDLRDNCSITRTVTNVGKPKSIYRAMVSKPAGVEVTVVPKLLTFKSFGEEINFTVNFRVV  704

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
            AP +GY FGS +W+  K  V S LVVRV 
Sbjct  705  APYKGYSFGSLAWKRGKVRVTSALVVRVG  733



>ref|XP_008344176.1| PREDICTED: subtilisin-like protease isoform X2 [Malus domestica]
Length=751

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 162/216 (75%), Gaps = 14/216 (6%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI ALIKAV+PSWSP+AI+SAIMTTAT+L+K+ KPI  DP+GRR NAFD+G    
Sbjct  547  CPHVTGIAALIKAVYPSWSPAAIRSAIMTTATLLDKNSKPILVDPEGRRGNAFDYG----  602

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
                     LVYDA  ADY  FLCS+GY+++++H IT DNSTC Q  ++ S LNYPSITV
Sbjct  603  ---------LVYDAHSADYVEFLCSVGYDKKAVHQITRDNSTCKQAFRTASDLNYPSITV  653

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L+  FSVTRTVTNVG P+S Y+A V PP GINVT+VP RL F  +GQK+ FT++FK+A
Sbjct  654  PYLVGNFSVTRTVTNVGRPKSIYRAAVSPPIGINVTIVPNRLIFNRFGQKIKFTVNFKVA  713

Query  276  A-PTQGYVFGSFSWRSKKNWVRSPLVVRVAGSRTGL  172
            A P +GY FG FSW   ++ V SPLVVRVA S +GL
Sbjct  714  APPAKGYAFGFFSWVRGRSRVTSPLVVRVAHSNSGL  749



>ref|XP_004965849.1| PREDICTED: cucumisin-like [Setaria italica]
Length=767

 Score =   263 bits (671),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 163/214 (76%), Gaps = 3/214 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI AL+K+V+PSW+PSAIKSAIMTTATVL+K  + I+ DPDG+ A  FDFGSGF+
Sbjct  551  CPHVTGIAALVKSVYPSWNPSAIKSAIMTTATVLDKKRRTIATDPDGKAATPFDFGSGFM  610

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSIT  460
            +P + L+PG+++DAQP DY++FLC+I +++ SLHLITGDN TC  +T  S +ALNYPSIT
Sbjct  611  DPIKALNPGVIFDAQPEDYRSFLCAISHDDHSLHLITGDNGTCTHRTSSSATALNYPSIT  670

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L   +SVTRT+TNVG PRS Y+AVV  PRGINVTV P  L F++YG K  FT+SF +
Sbjct  671  IPHLKRSYSVTRTMTNVGNPRSIYRAVVSAPRGINVTVTPEVLNFENYGAKKTFTVSFHV  730

Query  279  AAPTQGYVFGSFSWR--SKKNWVRSPLVVRVAGS  184
              P +GYVFGS SW    +   +  PLVV+V  S
Sbjct  731  NVPPRGYVFGSLSWHGNGRGAHLTMPLVVKVQTS  764



>ref|XP_002437302.1| hypothetical protein SORBIDRAFT_10g024550 [Sorghum bicolor]
 gb|EER88669.1| hypothetical protein SORBIDRAFT_10g024550 [Sorghum bicolor]
Length=799

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 158/215 (73%), Gaps = 4/215 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGR-RANAFDFGSGF  640
             PHVTGI AL+K+V+PSWSPSAIKSAI+TTATVLN   K I+ DP+GR  A  FDFGSGF
Sbjct  582  CPHVTGIAALVKSVYPSWSPSAIKSAIVTTATVLNSKRKTIARDPNGRIAATPFDFGSGF  641

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCD-QTLQSPSALNYPSI  463
            V+P + L+PG+++DAQP DYK+FLC+  +++ SLHLITGDNS+C  +   S +ALNYPSI
Sbjct  642  VDPIKALNPGIIFDAQPEDYKSFLCATTHDDHSLHLITGDNSSCTHRASSSATALNYPSI  701

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            T+P L   +SV RT+TNVG PRS+Y AVV  PRGI+V V P  + F++YG+K  FT+S  
Sbjct  702  TIPYLKQSYSVMRTMTNVGNPRSTYHAVVSAPRGISVRVTPEVINFENYGEKRTFTVSLH  761

Query  282  MAAPTQGYVFGSFSWRSKKNWVR--SPLVVRVAGS  184
            +  P +GYVFGS SW       R   PLVV+V  S
Sbjct  762  VDVPPRGYVFGSLSWHGNGTEARLMMPLVVKVQTS  796



>gb|EEE66042.1| hypothetical protein OsJ_22024 [Oryza sativa Japonica Group]
Length=637

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 151/209 (72%), Gaps = 1/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI AL+K  +PSWSPSAIKSAIMTTATVL      I+ DP+GR A  FDFGSGF 
Sbjct  423  CPHVTGIAALVKGAYPSWSPSAIKSAIMTTATVLGNKRNAIATDPNGRTATPFDFGSGFA  482

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSIT  460
            +P + L+PG+++DA P DYK+FLCSIGY++ SLHLIT DNS+C D+   S +ALNYPSIT
Sbjct  483  DPIKALNPGIIFDAHPEDYKSFLCSIGYDDHSLHLITQDNSSCTDRAPSSAAALNYPSIT  542

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L   +SVTRT+TNVG   S+Y A V  P GINVTV P+ L F++YG K  FT++F +
Sbjct  543  IPNLKKSYSVTRTMTNVGFRGSAYHAFVSAPLGINVTVTPKVLVFENYGAKKTFTVNFHV  602

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVRV  193
              P + +VFGS  W  K   +  PLVV+V
Sbjct  603  DVPQRDHVFGSLLWHGKDARLMMPLVVKV  631



>gb|EAZ01729.1| hypothetical protein OsI_23755 [Oryza sativa Indica Group]
Length=800

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 150/209 (72%), Gaps = 1/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI AL+K  +PSWSPSAIKSAIMTTA VL      I+ DP+GR A  FDFGSGF 
Sbjct  586  CPHVTGIAALVKGAYPSWSPSAIKSAIMTTANVLGNKRNAIATDPNGRTATPFDFGSGFA  645

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSIT  460
            +P + L+PG+++DA P DYK+FLCSIGY++ SLHLIT DNS+C D+   S +ALNYPSIT
Sbjct  646  DPIKALNPGIIFDAHPEDYKSFLCSIGYDDHSLHLITQDNSSCTDRAPSSAAALNYPSIT  705

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L   +SVTRT+TNVG   S+Y A V  P GINVTV P+ L F++YG K  FT++F +
Sbjct  706  IPNLKKSYSVTRTMTNVGFRGSAYHAFVSAPLGINVTVTPKVLVFENYGAKKTFTVNFHV  765

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVRV  193
              P + +VFGS  W  K   +  PLVV+V
Sbjct  766  DVPQRDHVFGSLLWHGKDARLMMPLVVKV  794



>ref|NP_001174909.1| Os06g0624100 [Oryza sativa Japonica Group]
 dbj|BAH93637.1| Os06g0624100 [Oryza sativa Japonica Group]
Length=1009

 Score =   247 bits (630),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 151/209 (72%), Gaps = 1/209 (0%)
 Frame = -3

Query  816   APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
              PHVTGI AL+K  +PSWSPSAIKSAIMTTATVL      I+ DP+GR A  FDFGSGF 
Sbjct  795   CPHVTGIAALVKGAYPSWSPSAIKSAIMTTATVLGNKRNAIATDPNGRTATPFDFGSGFA  854

Query  636   NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSIT  460
             +P + L+PG+++DA P DYK+FLCSIGY++ SLHLIT DNS+C D+   S +ALNYPSIT
Sbjct  855   DPIKALNPGIIFDAHPEDYKSFLCSIGYDDHSLHLITQDNSSCTDRAPSSAAALNYPSIT  914

Query  459   VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
             +P L   +SVTRT+TNVG   S+Y A V  P GINVTV P+ L F++YG K  FT++F +
Sbjct  915   IPNLKKSYSVTRTMTNVGFRGSAYHAFVSAPLGINVTVTPKVLVFENYGAKKTFTVNFHV  974

Query  279   AAPTQGYVFGSFSWRSKKNWVRSPLVVRV  193
               P + +VFGS  W  K   +  PLVV+V
Sbjct  975   DVPQRDHVFGSLLWHGKDARLMMPLVVKV  1003



>ref|XP_008648121.1| PREDICTED: putative subtilase family protein isoform X1 [Zea 
mays]
Length=668

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 150/212 (71%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTGI AL+K+V+PSWSPS IKSAIMTTATVL+   K I+ DP+G  A  FDFGSGF+
Sbjct  451  CPHVTGIAALVKSVYPSWSPSGIKSAIMTTATVLDTKRKTIARDPNGGAATPFDFGSGFM  510

Query  636  NPARVLDPGLVYDAQPADYKAFLCS-IGYNERSLHLITGDNSTCD-QTLQSPSALNYPSI  463
            +P + L PG+++D  P DYK+FLC+ I  ++ S+HLITGDNS+C  +   S +ALNYPSI
Sbjct  511  DPVKALSPGIIFDTHPEDYKSFLCAIISRDDHSVHLITGDNSSCTHRASSSATALNYPSI  570

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            TVP L   +SVTRT+TNVG PRS+Y AVV  P G +V V P  + FK YG+K  F +S  
Sbjct  571  TVPYLKQSYSVTRTMTNVGNPRSTYHAVVSAPPGTSVRVTPEVINFKSYGEKRMFAVSLH  630

Query  282  MAAPTQGYVFGSFSWRSKKNWVR--SPLVVRV  193
            +  P +GYVFGS SW    +  R   PLVV++
Sbjct  631  VDVPPRGYVFGSLSWHGNGSDARVTMPLVVKL  662



>ref|NP_001169603.1| putative subtilase family protein precursor [Zea mays]
 gb|ACN34240.1| unknown [Zea mays]
 gb|AFW76265.1| putative subtilase family protein [Zea mays]
Length=767

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 151/214 (71%), Gaps = 4/214 (2%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHVTGI AL+K+V+PSWSPS IKSAIMTTATVL+   K I+ DP+G  A  FDFGSGF++
Sbjct  551  PHVTGIAALVKSVYPSWSPSGIKSAIMTTATVLDTKRKTIARDPNGGAATPFDFGSGFMD  610

Query  633  PARVLDPGLVYDAQPADYKAFLCS-IGYNERSLHLITGDNSTCD-QTLQSPSALNYPSIT  460
            P + L PG+++D  P DYK+FLC+ I  ++ S+HLITGDNS+C  +   S +ALNYPSIT
Sbjct  611  PVKALSPGIIFDTHPEDYKSFLCAIISRDDHSVHLITGDNSSCTHRASSSATALNYPSIT  670

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            VP L   +SVTRT+TNVG PRS+Y AVV  P G +V V P  + FK YG+K  F +S  +
Sbjct  671  VPYLKQSYSVTRTMTNVGNPRSTYHAVVSAPPGTSVRVTPEVINFKSYGEKRMFAVSLHV  730

Query  279  AAPTQGYVFGSFSWRSKKNWVR--SPLVVRVAGS  184
              P +GYVFGS SW    +  R   PLVV++  S
Sbjct  731  DVPPRGYVFGSLSWHGNGSDARVTMPLVVKLQTS  764



>ref|XP_004957446.1| PREDICTED: subtilisin-like protease SDD1-like [Setaria italica]
Length=768

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 137/213 (64%), Gaps = 2/213 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGFV  637
            PH++G+ AL+K++HP+WSP+A+KSA++TTA + + +  + +S      +AN FD+G G V
Sbjct  551  PHISGVAALLKSMHPNWSPAAVKSALVTTANIHDNYGFEIVSEAAPYNQANPFDYGGGHV  610

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP R   PGLVYD   +DY  FLCS+GYN  ++  +T  ++TC  T ++   LN PSIT+
Sbjct  611  NPNRAAHPGLVYDMGTSDYVRFLCSMGYNSSAISSMTQQHATCQHTPKTQLNLNLPSITI  670

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  K +V+RTVTNVG   S Y+A V PP G++V V P  LTF    ++L F ++F+  
Sbjct  671  PELRGKLTVSRTVTNVGSVMSKYRAHVEPPPGVDVAVSPSLLTFNSTVRRLTFKVTFQAK  730

Query  276  APTQG-YVFGSFSWRSKKNWVRSPLVVRVAGSR  181
               QG Y FGS +W    + VR PLVVR   S+
Sbjct  731  LKVQGRYTFGSLTWEDGAHTVRIPLVVRTMISK  763



>ref|XP_007217687.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
 gb|EMJ18886.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
Length=773

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 133/211 (63%), Gaps = 4/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K ++P WSP+AIKSAIMTTAT  +   +P+  +    RA  F +G+G V
Sbjct  565  CPHISGICGLLKTLYPHWSPAAIKSAIMTTATTQDNSREPV-LNASFYRATPFSYGAGHV  623

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP   +DPGLVYD    DY  FLCS GYN+R + +++ +   C +   S + LNYPSITV
Sbjct  624  NPNSAMDPGLVYDLSLNDYLNFLCSNGYNKRQIEMVSEETYKCPKPAISRTNLNYPSITV  683

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFT--LSFK  283
            P L     VTRTV NVG P  +YKA +  P GI+V+V P +L FK  G++ +F   L  K
Sbjct  684  PKLNGSLVVTRTVKNVGTP-GTYKARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVK  742

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             A   + YVFG   W   K++VRSP+VV+VA
Sbjct  743  DAKAAKNYVFGKLIWSDGKHYVRSPIVVKVA  773



>gb|ACN35690.1| unknown [Zea mays]
Length=279

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 136/214 (64%), Gaps = 2/214 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGF  640
             PH++G+VAL+K++HP+WSP+A+KSA++TTA+V + +  + +S      +AN FD+G G 
Sbjct  61   CPHISGVVALLKSMHPNWSPAAVKSALVTTASVHDTYGFEIVSEAAPYNQANPFDYGGGH  120

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P     PGLVYD   +DY  FLCS+GYN  ++  +   + TC  T ++   LN PSI+
Sbjct  121  VDPNSAAHPGLVYDMGTSDYVRFLCSMGYNVSAISSLAQQHETCQHTPKTQLNLNLPSIS  180

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  + +V+RTVTNVG   + Y+A V  P G++VTV P  LTF    +KL F ++F+ 
Sbjct  181  IPELRGRLTVSRTVTNVGSALTKYRARVEAPPGVDVTVSPSLLTFNSTVRKLTFKVTFQA  240

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRVAGSR  181
                QG Y FGS +W    + VR PLVVR   S+
Sbjct  241  KLKVQGRYYFGSLTWEDGVHAVRIPLVVRTMISK  274



>gb|EAZ09847.1| hypothetical protein OsI_32138 [Oryza sativa Indica Group]
Length=769

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 136/214 (64%), Gaps = 2/214 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGF  640
             PH++G+VAL+K++HP+WSP+A+KSA++TTA V + +  + +S       AN FD+G G 
Sbjct  551  CPHISGVVALLKSMHPNWSPAAVKSALVTTANVHDAYGFEMVSEAAPYNDANPFDYGGGH  610

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP R   PGLVYD   +DY  FLCS+GYN  ++  +T   +TC    +S   LN PSIT
Sbjct  611  VNPNRAAHPGLVYDMGVSDYMRFLCSMGYNTSAISSMTQQQTTCQHMPKSQLNLNVPSIT  670

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  K +V+RTVTNVG   S Y+A V  P G++VTV P  LTF    +KL F ++F+ 
Sbjct  671  IPELRGKLTVSRTVTNVGPALSKYRARVEAPPGVDVTVSPSLLTFNSTVRKLPFKVTFQA  730

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRVAGSR  181
                QG Y FGS +W    + VR PLVVR+  S+
Sbjct  731  KLKVQGRYTFGSLTWEDGTHTVRIPLVVRIIISK  764



>ref|XP_002306266.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
 gb|EEE93262.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
Length=759

 Score =   186 bits (471),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 131/214 (61%), Gaps = 5/214 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GI  L+KA+HP WSP+AIKSAIMTTAT ++   +PI A+     AN  ++G+G +
Sbjct  548  CPHVSGIAGLLKAIHPDWSPAAIKSAIMTTATTISNAREPI-ANASLIEANPLNYGAGHI  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCD-QTLQSPSALNYPSIT  460
             P+R ++PGLVYD    DY  FLCSIGYN   L L  G+   C  Q   S    NYPSIT
Sbjct  607  WPSRAMEPGLVYDLTTRDYVDFLCSIGYNSTQLSLFLGEPYICQSQNNSSVVDFNYPSIT  666

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTF--KHYGQKLNFTLSF  286
            VP L  K +++RT+ NVG P SSY+  +  PRGI+V V PR L F  KH  +    T+  
Sbjct  667  VPNLSGKITLSRTLKNVGTP-SSYRVHIKAPRGISVKVEPRSLRFDKKHEEKMFEMTVEA  725

Query  285  KMAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAGS  184
            K       YVFG  +W   K+ VRSP+V++ A S
Sbjct  726  KKGFKNDDYVFGGITWSDGKHHVRSPIVIKKAAS  759



>ref|XP_002965730.1| hypothetical protein SELMODRAFT_407350 [Selaginella moellendorffii]
 gb|EFJ33150.1| hypothetical protein SELMODRAFT_407350 [Selaginella moellendorffii]
Length=863

 Score =   186 bits (472),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 133/209 (64%), Gaps = 4/209 (2%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV G  AL++A++PSWSP+AIKSA+MTTA+++N   +PI  +  G  AN F+FG G +N
Sbjct  653  PHVAGTAALLRAIYPSWSPAAIKSALMTTASIVNNLQQPI-LNGSGATANPFNFGGGEMN  711

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGD-NSTCDQTLQSPSALNYPSITV  457
            P    DPGLVYD  P DY  FLCS+GYN  ++  +T   N TC  TL S S +NYPS+ V
Sbjct  712  PEAAADPGLVYDTSPRDYLLFLCSVGYNSSTIQNVTDTANFTCPNTLSSISDMNYPSVAV  771

Query  456  PALIHKFSVTRTVTNVGEPRSS-YKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
              L    ++ RTVTNVG   ++ Y A    P GI++ + P +LTF+  G+K +F ++   
Sbjct  772  ANLTAAKTIQRTVTNVGSQDTAVYIASFQAPDGIDIVITPNKLTFQSLGEKKSFNITLTP  831

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
               ++G YVFG++ W    + VRSP+ VR
Sbjct  832  TKRSKGDYVFGTYQWSDGMHVVRSPIAVR  860



>gb|EMT32146.1| Subtilisin-like protease [Aegilops tauschii]
Length=229

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 134/219 (61%), Gaps = 14/219 (6%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+G+ AL+KA HP+WSP+AIKSA+MTTA   +  +  ++ +  G+ A+ FDFG+G V+
Sbjct  4    PHVSGLAALLKAAHPTWSPAAIKSALMTTAYTRDNSNGTMTDESTGKVADVFDFGAGHVD  63

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA--LNYPSIT  460
            P R +DPGLVYD  P DY  FLC++ Y E+++  IT   + C    ++  A  LNYPS++
Sbjct  64   PMRAMDPGLVYDIAPLDYLNFLCNLNYTEQNIRAITRRQADCRGARRAGHAGNLNYPSLS  123

Query  459  VPALIH------KFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF  298
               +        +    RTVTNVG  RS+Y+A V  P G NVTV P RL F+  GQKL+F
Sbjct  124  ATFVADGAKARMRTHFIRTVTNVGGGRSAYRATVRAPEGCNVTVRPDRLAFRRDGQKLSF  183

Query  297  TLSFKMAA-----PTQGYV-FGSFSWRSKKNWVRSPLVV  199
            T+  + AA     P    V  G+ +W   ++ V SP+VV
Sbjct  184  TVHVEAAARAKMEPGSSLVRSGALTWSDGRHAVVSPIVV  222



>ref|XP_002971605.1| hypothetical protein SELMODRAFT_95668 [Selaginella moellendorffii]
 gb|EFJ27354.1| hypothetical protein SELMODRAFT_95668 [Selaginella moellendorffii]
Length=800

 Score =   185 bits (470),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 133/209 (64%), Gaps = 4/209 (2%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV G  AL++A++PSWSP+AIKSA+MTTA+++N   +PI  +  G  AN F+FG G +N
Sbjct  590  PHVAGTAALLRAIYPSWSPAAIKSALMTTASIVNNLQQPI-LNGSGATANPFNFGGGEMN  648

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGD-NSTCDQTLQSPSALNYPSITV  457
            P    DPGLVYD  P DY  FLCS+GYN  ++  +T   N TC  TL S + +NYPS+ V
Sbjct  649  PEAAADPGLVYDTSPRDYLLFLCSVGYNSSTIQNVTDTANFTCPNTLSSIADMNYPSVAV  708

Query  456  PALIHKFSVTRTVTNVGEPRSS-YKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
              L    ++ RTVTNVG   ++ Y A    P GI++ + P +LTF+  G+K +F ++   
Sbjct  709  ANLTAAKTIQRTVTNVGSQDTAVYIASFQAPDGIDIVITPNKLTFQSLGEKKSFNITLTP  768

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
               ++G YVFG++ W    + VRSP+ VR
Sbjct  769  TKRSKGDYVFGTYQWSDGMHVVRSPIAVR  797



>ref|XP_008357992.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=583

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 129/211 (61%), Gaps = 4/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K ++P WSP+AIKSAIMTTA   +    P+  +     A  F +G+G V
Sbjct  375  CPHISGICGLLKTLYPHWSPAAIKSAIMTTAITRDNSMXPL-LNASFYEATPFSYGAGHV  433

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P   +DPGLVYD    DY  FLC++GYNE  + + + D   C +   SP+ LNYPSITV
Sbjct  434  BPNSAMDPGLVYDLSXNDYLNFLCAMGYNETEMEMFSEDTYECPKPAISPTNLNYPSITV  493

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFT--LSFK  283
            P L     VTRTV NVG P  +YKA +  P G++++V P++L F   G++ +F   L  K
Sbjct  494  PKLSGSLEVTRTVKNVGSP-GTYKANIQSPDGVSISVEPKKLKFMKIGEEKSFKVLLQVK  552

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             A   + YVFG   W   K++VRSP+VV+ +
Sbjct  553  EANQAKNYVFGKLIWSDGKHYVRSPIVVKAS  583



>dbj|BAK05842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 137/214 (64%), Gaps = 2/214 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGF  640
             PH++G+ AL+K++HP+WSP+A+KSA++TTA V +++  + +S     ++AN FD+G G 
Sbjct  552  CPHISGMAALLKSMHPNWSPAAVKSAMVTTANVHDEYGFEMVSEAAPYKQANPFDYGGGH  611

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P R   PGLVYD +P+DY  FLCS+GYN  ++  +   ++ C  + +S   LN PSIT
Sbjct  612  VDPNRAAHPGLVYDMRPSDYVRFLCSMGYNNSAIASMVQQHTPCQHSPKSQLNLNVPSIT  671

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  K SV+RTVTNVG   S Y+A V  P G++VTV P  LTF     +L F + F+ 
Sbjct  672  IPELRGKLSVSRTVTNVGPVTSKYRARVEAPPGVDVTVSPSLLTFNSTVNRLTFKVMFQA  731

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRVAGSR  181
                QG Y FGS +W    + VR PLVVR   +R
Sbjct  732  KLKVQGRYTFGSLTWEDGTHTVRIPLVVRTMINR  765



>ref|XP_007153620.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 ref|XP_007153621.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25614.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25615.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
Length=778

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 134/215 (62%), Gaps = 6/215 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV GIVAL++A +PSWSP+AIKSAIMTTAT L+   +P+    DGR A  F +G+G V
Sbjct  564  CPHVAGIVALLRASYPSWSPAAIKSAIMTTATTLDNEVEPLLNATDGR-ATPFSYGAGHV  622

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLIT-GDNSTCDQTLQSPSALNYPSIT  460
             P   +DPGLVYD    DY  FLC++GYN   + + T G +  C +   S   LNYPSIT
Sbjct  623  QPNTAMDPGLVYDTTIGDYLNFLCALGYNGTKISVFTEGPSYVCRKKF-SLLNLNYPSIT  681

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            VP L    +VTRT+ NVG PR +Y A V  P+GI V+V P  L F   G++  F ++FK+
Sbjct  682  VPNLSGSVTVTRTLKNVGSPR-TYIAHVQNPKGITVSVKPSILNFTKVGEEKRFKVTFKI  740

Query  279  --AAPTQGYVFGSFSWRSKKNWVRSPLVVRVAGSR  181
                 T  YVFG   W   K++VRSP+VV+   SR
Sbjct  741  VKGKATNNYVFGKLIWSDGKHYVRSPIVVKALTSR  775



>ref|XP_009407970.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407971.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=769

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 136/211 (64%), Gaps = 3/211 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPD-GRRANAFDFGSGF  640
             PH++ I AL+K++HP+WSP+AIKSAI+TTA+ ++++   + A+    ++AN +DFG G 
Sbjct  550  CPHISAIAALLKSIHPNWSPAAIKSAIVTTASTIDEYSLGVVAEGAPHKQANPYDFGGGH  609

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P + +DPGLVYD + + Y  FLCS+GYN  ++  +T   + C    QS   LN PSIT
Sbjct  610  VDPNKAIDPGLVYDMRVSAYVHFLCSVGYNNSAVSSLTQHPTICHDIYQSHKDLNLPSIT  669

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L   F+VTRTVTNVG   S+Y A V  PRG++V V P  L F    QKL F ++F  
Sbjct  670  IPQLKESFTVTRTVTNVGPATSTYTAHVEAPRGVSVRVRPSILAFNSTVQKLKFKVTFGS  729

Query  279  AAPTQ-GYVFGSFSWRSK-KNWVRSPLVVRV  193
                Q GY+FGS +W+    + VR PL +R+
Sbjct  730  RLKVQSGYLFGSLTWKDGVHHLVRIPLAIRI  760



>ref|XP_007214967.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
 gb|EMJ16166.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
Length=773

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 131/211 (62%), Gaps = 4/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K ++P WSP+AIKSAIMTTAT  +   +P+  +    RA  F +G+G V
Sbjct  565  CPHISGICGLLKTLYPHWSPAAIKSAIMTTATTQDNSREPV-LNASFYRATPFSYGAGHV  623

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP  V+DPGLVYD    DY  FLCS GYN+  + +++ +   C +   S + LNYPSITV
Sbjct  624  NPNSVMDPGLVYDLSLNDYLNFLCSNGYNKTQIEMVSEETYKCPKPAISGTNLNYPSITV  683

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFT--LSFK  283
            P L     VTRTV NVG P  +YKA +  P GI V+V P +L FK  G++ +F   L  K
Sbjct  684  PKLDGSLVVTRTVKNVGTP-GTYKARIQNPDGILVSVEPNKLEFKKIGEEKSFKLLLQVK  742

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             A   + YVFG   W   K++VRSP+VV+ A
Sbjct  743  DAKAAKNYVFGKLIWSDGKHYVRSPIVVKAA  773



>gb|KJB52411.1| hypothetical protein B456_008G260500 [Gossypium raimondii]
Length=822

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 136/210 (65%), Gaps = 6/210 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            PHV+GIVAL+KA+HP WSP+AIKSA++TTA   +    P+ A+   ++ AN FDFG G V
Sbjct  604  PHVSGIVALLKAIHPDWSPAAIKSALVTTARTKDASGFPLFAEGSPKKLANPFDFGGGIV  663

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP    DPGLVYD   +DY  +LC++GYN  ++  +TG ++ C     S   +N PSIT+
Sbjct  664  NPNGAADPGLVYDMGLSDYIHYLCAMGYNNSAISRLTGQSTACPAEKPSFLDVNLPSITI  723

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
             +L    ++TRTVTNVG P S Y+A + PP G+ VTV P  L F    +K++F ++  + 
Sbjct  724  SSLRSSVTLTRTVTNVGSPNSIYRADIEPPTGMTVTVKPHILVFNSRTKKISFNVT--VC  781

Query  276  APTQ---GYVFGSFSWRSKKNWVRSPLVVR  196
            A  Q   GY FGS +WR+++N VR PL V+
Sbjct  782  ATKQVNTGYFFGSLTWRNEQNAVRIPLSVK  811



>ref|XP_002460565.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
 gb|EER97086.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
Length=765

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 136/213 (64%), Gaps = 2/213 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGFV  637
            PH++G+VAL+K++HP+WSP+A+KSA++TTA V + +  + +S      +AN FD+G G V
Sbjct  548  PHISGVVALLKSMHPNWSPAAVKSALVTTANVQDTYGFEIVSEAAPYNQANPFDYGGGHV  607

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P R   PGLVY+   +DY  FLCS+GYN  ++  +T  + TC  T ++   LN PSIT+
Sbjct  608  DPNRAAHPGLVYEMGTSDYVRFLCSMGYNTSAISSMTQQHETCQHTPKTQLNLNLPSITI  667

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + +V+RTVTNVG   S Y+A V  P G++VTV P  LTF    + L F ++F+  
Sbjct  668  PELRGRLTVSRTVTNVGSASSKYRARVEAPPGVDVTVSPSLLTFNSTMRSLTFKVTFQAK  727

Query  276  APTQG-YVFGSFSWRSKKNWVRSPLVVRVAGSR  181
               QG Y FGS +W    + VR PLVVR   S+
Sbjct  728  LKVQGRYNFGSLTWEDGVHTVRIPLVVRTMVSK  760



>ref|XP_003578494.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=770

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 136/214 (64%), Gaps = 2/214 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGF  640
             PH++G+ AL+K++HP+WSP+A+KSA++TTA V +++  + +S     ++AN FD+G G 
Sbjct  552  CPHISGVAALLKSMHPNWSPAAVKSAMVTTANVRDEYGFEMVSEAAPYKQANPFDYGGGH  611

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P R   PGLVYD +P+DY  FLCS+GYN  ++  +   ++ C  T +S   +N PSIT
Sbjct  612  VDPNRAAHPGLVYDMRPSDYVRFLCSMGYNNSAIGSMVQLHTPCQHTPKSQLNMNLPSIT  671

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  K  V RTVTNVG P S Y+A V  P G+ VTV P  L F     +L+F ++F+ 
Sbjct  672  IPELRGKLMVPRTVTNVGLPTSRYRARVEAPPGVGVTVNPSLLIFNSTTNRLSFRVTFQA  731

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRVAGSR  181
                QG Y FGS +W    + VR PLVVR   S+
Sbjct  732  KLKVQGRYTFGSLTWEDGAHTVRIPLVVRTMISK  765



>ref|XP_008778788.1| PREDICTED: subtilisin-like protease SBT5.4, partial [Phoenix 
dactylifera]
Length=411

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 133/209 (64%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++G+ AL+K+VHP+WSP+AIKSA++TTA+V +++   I A+    ++AN FD+G G 
Sbjct  193  CPHISGVAALLKSVHPNWSPAAIKSALITTASVNDEYGLGIVAEGAPHKQANLFDYGGGH  252

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP + +DPGL+YD + +DY  FLCS+GYN   +  +T  N+ C    +S   LN PSI+
Sbjct  253  VNPNKAMDPGLIYDMEISDYVRFLCSMGYNNSVISSMTQHNTICHNASKSQKDLNLPSIS  312

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    + +RTVTNVG   S+Y A V  P G++V V P  L F    +KL F ++F+ 
Sbjct  313  IPELKKTVTASRTVTNVGPVMSAYAAHVETPPGVSVHVKPSILLFDSTIKKLKFQVTFQP  372

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG Y FGS +W    + VR PL VR
Sbjct  373  RLKLQGRYSFGSLTWDDGIHLVRIPLAVR  401



>ref|XP_008229767.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=773

 Score =   182 bits (462),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 132/211 (63%), Gaps = 4/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K ++P WSP+AIKSAIMTTAT  +   +P+  +    RA  F +G+G V
Sbjct  565  CPHISGICGLLKTLYPHWSPAAIKSAIMTTATTQDNSREPL-LNASFYRATPFSYGAGHV  623

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP   +DPGLVYD    DY  FLCS GYN+  + +++ +   C +   S + LNYPSITV
Sbjct  624  NPNSAMDPGLVYDLSLNDYLNFLCSNGYNKTQIEMVSEEAYECPKPAVSLTNLNYPSITV  683

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM-  280
            P L     VTRTV NVG P  +YKA +  P GI+V+V P +L FK  G++ +F L  ++ 
Sbjct  684  PKLNGSLVVTRTVKNVGTP-GTYKARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVI  742

Query  279  -AAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             A   + YVFG   W   K++VRSP+VV+ A
Sbjct  743  DAKAAKNYVFGKLIWSDGKHYVRSPIVVKAA  773



>gb|ACP18876.1| subtilisin-like serine protease [Carica papaya]
Length=771

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 141/212 (67%), Gaps = 5/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L+K ++PSWSP+AI+SAIMT+AT ++  ++ I  +    +A  F +G+G V
Sbjct  562  CPHVSGIVGLLKTLYPSWSPAAIRSAIMTSATTMDNINESI-LNASNVKATPFSYGAGHV  620

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P + ++PGLVYD    DY  FLC++GY++  + + + D   C +T  S +  NYPSITV
Sbjct  621  QPNQAMNPGLVYDLNTKDYLKFLCALGYSKTLISIFSNDKFNCPRTNISLADFNYPSITV  680

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    +++R V NVG P ++Y+  V  P+GI+VTV P+ L FK  G++ +FT++ KM 
Sbjct  681  PELKGLITLSRKVKNVGSP-TTYRVTVQKPKGISVTVKPKILKFKKAGEEKSFTVTLKMK  739

Query  276  A--PTQGYVFGSFSWRSK-KNWVRSPLVVRVA  190
            A  PT+ YVFG   W  + +++VRSP+VV+ A
Sbjct  740  AKNPTKEYVFGELVWSDEDEHYVRSPIVVKAA  771



>ref|XP_007131764.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
 gb|ESW03758.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
Length=746

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 137/209 (66%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVALIK VHP+WSP+AIKSA++TTA++ N++H+ I A+    ++A+ FD+G G 
Sbjct  528  CPHISGIVALIKTVHPTWSPAAIKSALVTTASLKNEYHEYIWAEGAPHKQADPFDYGGGH  587

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P +V DPGLVYD + +DY  FLCS+ YN+ ++  +TG  + C ++ +    +N PSI 
Sbjct  588  VDPNKVTDPGLVYDMKNSDYIHFLCSMDYNDTAISFLTGVPTKCHKSHKYLLNMNLPSII  647

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    +V+RTVTNVG  +S Y A V  P G++VTVVP  LTF    +K+ F ++F  
Sbjct  648  IPELKQPLTVSRTVTNVGPIKSVYTARVEAPIGVSVTVVPPTLTFSPKRKKMKFKVTFSS  707

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG + FG   W    + VR PL VR
Sbjct  708  KLRIQGRFSFGYLFWEDGSHEVRMPLAVR  736



>ref|XP_008342263.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=777

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 130/211 (62%), Gaps = 4/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K ++P WSP+AIKSAIMTTA   +   +P+  +     A  F +G+G V
Sbjct  569  CPHISGICGLLKTLYPHWSPAAIKSAIMTTAVTRDNSMEPL-LNASFYEATPFSYGAGHV  627

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP   +DPGLVYD    DY  FLC+IGYNE  + + + +   C +   S ++LNYPSITV
Sbjct  628  NPNSAMDPGLVYDLSLNDYLNFLCAIGYNETQIEMFSEEMYMCSKPAISLTSLNYPSITV  687

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P +     VTRTV NVG P  +YKA +  P GI+V+V P+ L FK  G++ +F +  ++ 
Sbjct  688  PKISGSLEVTRTVKNVGSP-GTYKARIQNPBGISVSVEPKELKFKKIGEEKSFKVLLQVX  746

Query  276  APTQ--GYVFGSFSWRSKKNWVRSPLVVRVA  190
               Q   YVFG   W   K++VRSP+VV+ A
Sbjct  747  EAKQDKNYVFGKLIWSDGKHYVRSPIVVKAA  777



>ref|XP_009361505.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=777

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 129/211 (61%), Gaps = 4/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K ++P WSP+AIKSAIMTTA   +   +P+  +     A  F +G+G V
Sbjct  569  CPHISGICGLLKTLYPHWSPAAIKSAIMTTAVTQDNSMEPL-LNASFYEATPFSYGAGHV  627

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP   +DPGLVYD    DY  FLC+IGYNE  + + + +   C +   S + LNYPSITV
Sbjct  628  NPNSAMDPGLVYDLSLNDYLNFLCAIGYNETQIEMFSEEMYKCSKPAISLTNLNYPSITV  687

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFT--LSFK  283
            P +     VTRTV NVG P  +YKA +  P GI+V+V P+ L FK  G++ +F   L  +
Sbjct  688  PKISGSLEVTRTVKNVGSP-GTYKARIQNPDGISVSVEPKELKFKKIGEEKSFKVLLQVR  746

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             A   + YVFG   W   K++VRSP+VV+ A
Sbjct  747  EAKQDKNYVFGKLIWSDGKHYVRSPIVVKAA  777



>emb|CDP14562.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 131/216 (61%), Gaps = 16/216 (7%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+ G  AL++A+HP+WS +AI+SA++TTA +LN   KPI+ D  G+ AN F FGSG  
Sbjct  3    CPHIAGAAALLRAIHPTWSSAAIRSALVTTAGILNNMGKPIT-DASGKEANPFLFGSGHF  61

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P++  DPGLVYDA   DY   LCSIGYN ++L      N++C + L  P  LNYPS+ +
Sbjct  62   RPSKAADPGLVYDASYEDYLLHLCSIGYNLKNL----TRNNSCPKNLPPPHNLNYPSVAI  117

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L     V R VT+VG  RS Y + V PP GI+VT+ P  L F  YG+K +FT+  + A
Sbjct  118  PKLNGTVVVKRIVTHVGSSRSIYFSSVKPPVGISVTISPPILYFNQYGEKKSFTIRVQ-A  176

Query  276  APTQG--------YVFGSFSWRSKK--NWVRSPLVV  199
              T+G        Y FG + WR     + VRSP+ V
Sbjct  177  ESTEGVGENAKNKYRFGWYIWRDSNGTHSVRSPIAV  212



>ref|XP_009344070.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=699

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 129/208 (62%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            PHVTGIVALIK +HP+WSP+AIKSA++TTA        PI A+   ++ AN+FDFG G V
Sbjct  480  PHVTGIVALIKRMHPNWSPAAIKSALVTTAWRNGPSGLPIFAEGSPQKLANSFDFGGGLV  539

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP    DPGLVYD   ADY  +LC+ GYN  ++  +TG N+TC     S   +N PS+T+
Sbjct  540  NPNGAADPGLVYDMGAADYMEYLCARGYNNSAISRLTGKNTTCPVKKPSILDVNLPSVTI  599

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK-M  280
            P+L +  +V RTVTNVG P S YKA + PP G  V V P  L F    +KL FT++   +
Sbjct  600  PSLRNPITVKRTVTNVGAPESIYKATIEPPFGTIVYVNPTALVFNSTVEKLTFTITISAI  659

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                 GY FGS +W    + VR PL V+
Sbjct  660  HEMNTGYYFGSLTWVDGVHAVRIPLSVK  687



>gb|AGN12874.1| putative transcription factor DYSFUNCTIONAL TAPETUM 1 [Sisymbrium 
irio]
Length=775

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 130/209 (62%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
            AP VTGIVAL++++HP WSP+A+KSA+MTTA   + H  PI A+   R+ A+ FD+G+G 
Sbjct  564  APAVTGIVALLRSLHPDWSPAALKSAMMTTAWKTDPHGDPIFAEGSPRKLADPFDYGAGL  623

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VN  R  DPGLVYD    DY  FLC+  YNE ++ ++TG  + C   L S   +NYP+IT
Sbjct  624  VNAERAKDPGLVYDMNIDDYIHFLCASSYNETAISVLTGKPTKCSSPLPSILDVNYPAIT  683

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  + ++TRTVTNVG   S Y+AVV  P G+ + V P+ L F    +KL F +    
Sbjct  684  IPELKDEVNITRTVTNVGPVDSVYRAVVEAPEGVKIVVEPQTLVFSSSTKKLGFKVRVST  743

Query  279  AAPTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
            +  +  GY FGSF+W      V  PL VR
Sbjct  744  SHKSNTGYFFGSFTWTDGTRNVTIPLSVR  772



>ref|XP_002509667.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51054.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=753

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 127/208 (61%), Gaps = 3/208 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI AL+K+ HP WSP+AIKSAIMTTA V N   KPI+ D     A  FD G+G V
Sbjct  544  CPHLSGIAALLKSAHPDWSPAAIKSAIMTTANVFNLDGKPIT-DQQFVPATYFDIGAGHV  602

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA-LNYPSIT  460
            NP+R  +PGL+YD QP DY  +LC +GY+ + + +IT     C + L  P A LNYPS +
Sbjct  603  NPSRANEPGLIYDIQPDDYLPYLCGLGYSNKQVGVITQRRVNCSKNLSMPEAQLNYPSFS  662

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF-K  283
            V       +  RTVTNVG+P SSY    F PRG++V V P ++TF    QK  +T++F K
Sbjct  663  VKLGSSPQTCARTVTNVGKPNSSYILETFAPRGVDVKVTPNKITFTGLNQKATYTIAFSK  722

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVV  199
            M   +  +  G  +W +    VRSP+ V
Sbjct  723  MGNTSVSFAQGYLNWVADGYSVRSPITV  750



>gb|KJB42692.1| hypothetical protein B456_007G164000 [Gossypium raimondii]
Length=770

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 132/209 (63%), Gaps = 5/209 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L+K ++P+WSP+AIKSAIMT+AT L+  ++PI  +    +A  F +G+G V
Sbjct  563  CPHVSGIVGLLKTLYPNWSPAAIKSAIMTSATTLDNLNEPI-LNASNIKAGPFSYGAGHV  621

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   +DPGLVYD  P DY  FLC++GYNE  + L + +   C   +   +  NYPSIT+
Sbjct  622  QPNLAMDPGLVYDLTPTDYLNFLCTLGYNETLISLFSKNTYKCPNPINLAN-FNYPSITI  680

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSFK  283
            P L+   +VTRTV NVG P   Y+A V  P GI++ V P++L F+  G++  F  TL  K
Sbjct  681  PNLVGPITVTRTVKNVGSP-GIYRAKVMRPMGISIYVKPQKLKFEKAGEEKTFSVTLKVK  739

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
             A   + YVFG   W    ++VRSP+VV+
Sbjct  740  NAQAIKEYVFGELIWSDNVHYVRSPIVVK  768



>gb|ERM97026.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
Length=732

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 131/209 (63%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
             PHV GIVAL+ ++HP WSP+AIKSA++TTA+ ++K+ +P+ A+   R+ A+ FD+G G 
Sbjct  513  CPHVAGIVALLMSIHPDWSPAAIKSALVTTASTMDKNEEPMLAEGYPRKVADPFDYGGGH  572

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP +  DPGL+YD   +DY  F C++GYN  ++ L+T    +C +   S   +N PSI 
Sbjct  573  VNPNQAADPGLIYDMDISDYILFFCAMGYNNSAISLVTSKTISCPKDPPSIPNMNLPSIV  632

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    ++ R VTNVG+  S YKA+V  P G+ V V P+ L F      L F ++F +
Sbjct  633  IPELKTSVTIARKVTNVGKVHSVYKAMVESPTGVKVVVEPKVLYFNEATIVLPFKVTFTV  692

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG Y FGS  W   +++VRSP+ VR
Sbjct  693  VHQMQGDYTFGSLIWSDGEHFVRSPIAVR  721



>ref|XP_011629200.1| PREDICTED: subtilisin-like protease SBT3.5 [Amborella trichopoda]
Length=771

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 131/209 (63%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
             PHV GIVAL+ ++HP WSP+AIKSA++TTA+ ++K+ +P+ A+   R+ A+ FD+G G 
Sbjct  552  CPHVAGIVALLMSIHPDWSPAAIKSALVTTASTMDKNEEPMLAEGYPRKVADPFDYGGGH  611

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP +  DPGL+YD   +DY  F C++GYN  ++ L+T    +C +   S   +N PSI 
Sbjct  612  VNPNQAADPGLIYDMDISDYILFFCAMGYNNSAISLVTSKTISCPKDPPSIPNMNLPSIV  671

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    ++ R VTNVG+  S YKA+V  P G+ V V P+ L F      L F ++F +
Sbjct  672  IPELKTSVTIARKVTNVGKVHSVYKAMVESPTGVKVVVEPKVLYFNEATIVLPFKVTFTV  731

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG Y FGS  W   +++VRSP+ VR
Sbjct  732  VHQMQGDYTFGSLIWSDGEHFVRSPIAVR  760



>ref|XP_003537841.1| PREDICTED: cucumisin-like [Glycine max]
Length=782

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 136/211 (64%), Gaps = 2/211 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH+TGIVALIK +HP+WSP+AIKSA++TTA++ N++ + I A+    ++A+ FD+G G 
Sbjct  564  CPHITGIVALIKTIHPTWSPAAIKSALVTTASLKNEYKEYIWAEGAPHKQADPFDYGGGH  623

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P +V DPGLVYD + +DY  FLCS+GYN  ++ ++TG  + C ++ +    +N PSIT
Sbjct  624  VDPNKVTDPGLVYDMKNSDYIRFLCSMGYNNTAISILTGFPTKCHKSHKFLLNMNLPSIT  683

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    +V+RTVTNVG  +S+Y A V  P GI+V V P  L F    +K+ F ++F  
Sbjct  684  IPELKQPLTVSRTVTNVGPVKSNYTARVVAPIGISVIVEPSTLAFSSKRKKMKFKVTFSS  743

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRVA  190
                Q  + FG   W    + VR PL VR A
Sbjct  744  KLRVQSRFSFGYLLWEDGLHEVRIPLAVRSA  774



>ref|XP_002982080.1| hypothetical protein SELMODRAFT_233912 [Selaginella moellendorffii]
 gb|EFJ16748.1| hypothetical protein SELMODRAFT_233912 [Selaginella moellendorffii]
Length=752

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 131/217 (60%), Gaps = 14/217 (6%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+G+ AL++  HP WSP+AIKSA+MTTA++++     +S +  G  +  FDFGSG VN
Sbjct  532  PHVSGLAALLRGAHPDWSPAAIKSALMTTASLVDNTKNIMSDEATGNVSTPFDFGSGLVN  591

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            P   +DPGLVYD    DY  FLCS+ Y+ + L ++T   ++C +++   S LNYPS +  
Sbjct  592  PETAMDPGLVYDLGREDYIEFLCSLNYSSKDLRMVTRSKASCPKSVPKTSDLNYPSFS--  649

Query  453  ALIH-------KFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFT  295
            A+         K S  RTVTNVG P++ Y A V  P+GI  +VVP+RL F    QKL++T
Sbjct  650  AVFDQSVKGPMKMSFKRTVTNVGSPKAEYVASVLVPKGIEASVVPKRLLFSELNQKLSYT  709

Query  294  LSFKM--AAPTQG---YVFGSFSWRSKKNWVRSPLVV  199
            L+     AA   G    VFG  +W   +  VRSP+ +
Sbjct  710  LTISAPRAAVVPGDIETVFGLLTWSDSQRMVRSPIAI  746



>gb|KHN39834.1| Cucumisin, partial [Glycine soja]
Length=753

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 136/211 (64%), Gaps = 2/211 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH+TGIVALIK +HP+WSP+AIKSA++TTA++ N++ + I A+    ++A+ FD+G G 
Sbjct  535  CPHITGIVALIKTIHPTWSPAAIKSALVTTASLKNEYKEYIWAEGAPHKQADPFDYGGGH  594

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P +V DPGLVYD + +DY  FLCS+GYN  ++ ++TG  + C ++ +    +N PSIT
Sbjct  595  VDPNKVTDPGLVYDMKNSDYIRFLCSMGYNNTAISILTGFPTKCHKSHKFLLNMNLPSIT  654

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    +V+RTVTNVG  +S+Y A V  P GI+V V P  L F    +K+ F ++F  
Sbjct  655  IPELKQPLTVSRTVTNVGPVKSNYTARVVAPIGISVIVEPSTLAFSSKRKKMKFKVTFSS  714

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRVA  190
                Q  + FG   W    + VR PL VR A
Sbjct  715  KLRVQSRFSFGYLLWEDGLHEVRIPLAVRSA  745



>gb|KDP25551.1| hypothetical protein JCGZ_20707 [Jatropha curcas]
Length=757

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 127/215 (59%), Gaps = 14/215 (7%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI AL+K+ HP WSP+AIKSAIMTTA + N    PI  D   + A+ F  G+G V
Sbjct  547  CPHLSGIAALLKSSHPYWSPAAIKSAIMTTADIFNMEGSPI-VDEKHQPADLFTIGAGHV  605

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA-LNYPSIT  460
            NP+R  DPGL+YD QP DY  +LC +GY E  + +I      C + L  P   LNYPS +
Sbjct  606  NPSRANDPGLIYDIQPDDYIPYLCGLGYKEEQVSIIAHRRIKCSEKLSIPEGQLNYPSFS  665

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF--  286
            V  L    + TRTVTNVGE  S Y A + PP G+ VTV P RL F    QK+ ++++F  
Sbjct  666  V-TLGASQTFTRTVTNVGEANSVYAATIVPPPGVAVTVEPYRLYFSQVNQKVTYSVTFSP  724

Query  285  -----KMAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                 K +   QGY+     W S K+ VRSP+ VR
Sbjct  725  TGSSGKTSEFAQGYIL----WSSAKHLVRSPISVR  755



>ref|XP_002965691.1| hypothetical protein SELMODRAFT_407291 [Selaginella moellendorffii]
 gb|EFJ33111.1| hypothetical protein SELMODRAFT_407291 [Selaginella moellendorffii]
Length=729

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 128/207 (62%), Gaps = 3/207 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH TG  A +K++HP WSP+AIKSA+MTTA  ++   KP+  D DG  A  F FG+G ++
Sbjct  524  PHATGAAAYVKSIHPDWSPAAIKSALMTTAKSVDNEKKPLK-DFDGSDATPFAFGAGQIS  582

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            P    +PGLVYD    +Y   LC+ GYN   + +I+G    C ++  +P  LNYPS+T+P
Sbjct  583  PLDAANPGLVYDTSVEEYLLHLCASGYNATQIAVISGRTVRCPESPGAPK-LNYPSVTIP  641

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF-KMA  277
             L ++ SV RTVTNVG P+S Y+A+  PP GI + V P  L F   GQK+ +TL+F  + 
Sbjct  642  ELKNQTSVVRTVTNVGAPKSVYRAIGSPPLGIELIVSPGTLAFNATGQKIAYTLTFVPLQ  701

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVR  196
              ++ + FG   W S    VRSPL V+
Sbjct  702  NLSKKWAFGELIWTSDSISVRSPLAVK  728



>ref|XP_010099424.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB78386.1| Subtilisin-like protease [Morus notabilis]
Length=394

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 130/209 (62%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
            APHV+GIVAL+K++HP WSP+AIKSAI+TTA   +   + I A+ +  + A+ FDFG G 
Sbjct  179  APHVSGIVALLKSLHPDWSPAAIKSAIVTTAWNTDPSGELIFAEGEPMKLADPFDFGGGI  238

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VN  R  DPGLVYD    DY  +LC++GYN  ++  +    ++C     S   LN PSIT
Sbjct  239  VNFNRAADPGLVYDMGTEDYLHYLCAMGYNNSAISQLREHPTSCPTKRPSVLDLNLPSIT  298

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P+L     +TRTV NVG   SSYKAVV PP+GI ++V PR LTF      ++FT++   
Sbjct  299  IPSLTKPTKLTRTVRNVGHANSSYKAVVKPPQGIRISVRPRLLTFNATNNTISFTVAVSS  358

Query  279  A-APTQGYVFGSFSWRSKKNWVRSPLVVR  196
                T GY FGS +W    + V SP+ VR
Sbjct  359  THRVTTGYYFGSLTWTDGVHTVNSPISVR  387



>ref|XP_002971639.1| hypothetical protein SELMODRAFT_412127 [Selaginella moellendorffii]
 gb|EFJ27388.1| hypothetical protein SELMODRAFT_412127 [Selaginella moellendorffii]
Length=729

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 128/207 (62%), Gaps = 3/207 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH TG  A +K++HP WSP+AIKSA+MTTA  ++   KP+  D DG  A  F FG+G ++
Sbjct  524  PHATGAAAYVKSIHPDWSPAAIKSALMTTAKSVDNEKKPLK-DFDGSDATPFAFGAGQIS  582

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            P    +PGLVYD    +Y   LC+ GYN   + +I+G    C ++  +P  LNYPS+T+P
Sbjct  583  PLDAANPGLVYDTSVEEYLLHLCASGYNATQIAVISGRTVRCPESPGAPK-LNYPSVTIP  641

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF-KMA  277
             L ++ SV RTVTNVG P+S Y+A+  PP GI + V P  L F   GQK+ +TL+F  + 
Sbjct  642  ELKNQTSVVRTVTNVGAPKSVYRAIGSPPLGIELIVSPGTLAFNATGQKIAYTLTFVPLQ  701

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVR  196
              ++ + FG   W S    VRSPL V+
Sbjct  702  NLSKKWAFGELIWTSNSISVRSPLAVK  728



>ref|XP_009351289.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Pyrus 
x bretschneideri]
Length=769

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 138/210 (66%), Gaps = 2/210 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVAL+K++HP+WSP+AIKS+++TTA++ +++ + I A+    ++AN FD+G G 
Sbjct  551  CPHISGIVALLKSIHPTWSPAAIKSSLVTTASLEDEYGQSIVAEGAPHKQANPFDYGGGH  610

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P + + PGL+YD + +DY  FLCS+GYN  ++ L+ G   TC ++    + LN PSIT
Sbjct  611  VDPNKAIAPGLIYDIESSDYIRFLCSMGYNNTAISLVAGAKITCRKSTNFINNLNLPSIT  670

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +  L    +V+RTVTNVG   S+Y A V  P G++V V P  L+F    +KL F ++F+ 
Sbjct  671  IHELKQSTTVSRTVTNVGPVNSTYNARVITPAGVSVRVKPSILSFNSTVKKLEFKVTFRS  730

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
                QG + FG+  W    + VR PL+VR+
Sbjct  731  LLRIQGRFSFGNLFWEDGLHVVRIPLIVRI  760



>ref|XP_009351288.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Pyrus 
x bretschneideri]
Length=771

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 138/210 (66%), Gaps = 2/210 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVAL+K++HP+WSP+AIKS+++TTA++ +++ + I A+    ++AN FD+G G 
Sbjct  553  CPHISGIVALLKSIHPTWSPAAIKSSLVTTASLEDEYGQSIVAEGAPHKQANPFDYGGGH  612

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P + + PGL+YD + +DY  FLCS+GYN  ++ L+ G   TC ++    + LN PSIT
Sbjct  613  VDPNKAIAPGLIYDIESSDYIRFLCSMGYNNTAISLVAGAKITCRKSTNFINNLNLPSIT  672

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +  L    +V+RTVTNVG   S+Y A V  P G++V V P  L+F    +KL F ++F+ 
Sbjct  673  IHELKQSTTVSRTVTNVGPVNSTYNARVITPAGVSVRVKPSILSFNSTVKKLEFKVTFRS  732

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
                QG + FG+  W    + VR PL+VR+
Sbjct  733  LLRIQGRFSFGNLFWEDGLHVVRIPLIVRI  762



>ref|NP_001159267.1| uncharacterized protein LOC100304357 precursor [Zea mays]
 gb|ACN25629.1| unknown [Zea mays]
Length=768

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 136/213 (64%), Gaps = 2/213 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGFV  637
            PH++G+VAL+K++HP+WSP+A+KSA++TTA+V + +  + +S      +AN FD+G G V
Sbjct  551  PHISGVVALLKSMHPNWSPAAVKSALVTTASVHDTYGFEIVSEAAPYNQANPFDYGGGHV  610

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P     PGLVYD   +DY  FLCS+GYN  ++  +   + TC  T ++   LN PSI++
Sbjct  611  DPNSAAHPGLVYDMGTSDYVRFLCSMGYNVSAISSLAQQHETCQHTPKTQLNLNLPSISI  670

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + +V+RTVTNVG   + Y+A V  P G++VTV P  LTF    +KL F ++F+  
Sbjct  671  PELRGRLTVSRTVTNVGSALTKYRARVEAPPGVDVTVSPSLLTFNSTVRKLTFKVTFQAK  730

Query  276  APTQG-YVFGSFSWRSKKNWVRSPLVVRVAGSR  181
               QG Y FGS +W    + VR PLVVR   S+
Sbjct  731  LKVQGRYYFGSLTWEDGVHAVRIPLVVRTMISK  763



>gb|AAO61749.1|AF366558_1 subtilisin-like seed-specific protein [Arachis hypogaea]
Length=244

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 130/211 (62%), Gaps = 7/211 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GIV L+K ++PSWSP+AIKSAIMTTAT L+   +P+  +   R+A  F +G+G V
Sbjct  35   CPHISGIVGLLKTMYPSWSPAAIKSAIMTTATTLDNEAEPL-LNAANRKATPFSYGAGHV  93

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLIT-GDNSTCDQTLQSPSALNYPSIT  460
            +P   +DPGLVYD    DY  FLC++GY+E  L + T G +  C     S   LNYPSIT
Sbjct  94   DPNSAMDPGLVYDTTMDDYLNFLCALGYHETQLSMFTEGHHYKCATNF-SILNLNYPSIT  152

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK-  283
            VP      ++TRT+ NVG P ++Y A V  PRGI+V V P  L FK  G++ +F ++ K 
Sbjct  153  VPEFPGSLTLTRTLKNVGAP-ATYIAQVQNPRGISVFVKPNILEFKEVGEEKSFEVTLKG  211

Query  282  --MAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                A    + FG   W    ++V+SP+VV+
Sbjct  212  RQGEARNNHFKFGKLIWSDGNHYVKSPIVVK  242



>ref|XP_006660880.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=768

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 138/213 (65%), Gaps = 2/213 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGFV  637
            PH++GIVAL+KA+HP+WSP+A+KSA++TTA V + +  + +S     + AN FD G G V
Sbjct  551  PHISGIVALLKAMHPNWSPAAVKSALVTTANVRDAYGFEMVSEAAPYKEANPFDHGGGHV  610

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P R   PGLVYD   +DY  FLCS+GYN  ++  +T   +TC  T +S   LN PSIT+
Sbjct  611  DPNRAAHPGLVYDMGQSDYMHFLCSMGYNNSAISSMTQQQTTCQHTPKSQLNLNVPSITI  670

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  K +V+RTVTNVG   S+Y+A V  P G++VTV P  LTF    +KL F ++F+  
Sbjct  671  PELRGKLTVSRTVTNVGPALSNYRARVEAPPGVDVTVSPSLLTFNSTIRKLPFKVTFQAK  730

Query  276  APTQG-YVFGSFSWRSKKNWVRSPLVVRVAGSR  181
               QG Y FGS +W    + VR PLVVR+  SR
Sbjct  731  LKVQGRYTFGSLTWEDGTHTVRIPLVVRIIISR  763



>ref|XP_011470880.1| PREDICTED: subtilisin-like protease SBT3.3 [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 127/208 (61%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            PHV GIVALIKAVHP+WSP+AI+SA++TTA        PI A+   ++ AN FDFG G V
Sbjct  562  PHVAGIVALIKAVHPNWSPAAIRSALVTTAWSNGPSRLPIFAEGSPQKLANPFDFGGGIV  621

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP    +PGLVYD   ADY  +LC++ YN   +  +TG  +TC     S   +N PSIT+
Sbjct  622  NPNAASNPGLVYDMGAADYMHYLCAMDYNNSDITRLTGQATTCPMKRPSLLDINLPSITI  681

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P+L +  +VTRTVTNVG P+S Y+A + PP G  V+V P  L F    +KL F +     
Sbjct  682  PSLGNSITVTRTVTNVGAPKSVYEATIDPPLGTVVSVKPNLLVFNSTVKKLTFEIVISTT  741

Query  276  APTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
                 GY FGS +W  + + VR PL VR
Sbjct  742  HQMNTGYYFGSLTWTDRVHAVRIPLSVR  769



>ref|XP_009137186.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=746

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 132/214 (62%), Gaps = 7/214 (3%)
 Frame = -3

Query  822  WLAPHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGS  646
            + AP + GI+ L+K++HP WSP+A+KSAIMTTA   + +  PI ++   R+ A+ FD+G+
Sbjct  532  YSAPAIAGILILLKSLHPDWSPAALKSAIMTTAWKTDPYGGPIYSESMPRKLADPFDYGA  591

Query  645  GFVNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPS  466
            G VNP R  DPGLVYD    DY  F C+ GYN+ S+ L+TG ++ C   L S    NYP+
Sbjct  592  GLVNPQRAGDPGLVYDLNLDDYIHFFCASGYNDTSIALLTGKDAKCPSPLPSILDFNYPA  651

Query  465  ITVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTF----KHYGQKLNF  298
            IT+P +  + +V+RTVTNVG   S Y+AV+ PPRG+ + V P  L F    K  G K+  
Sbjct  652  ITIPEVKDEVTVSRTVTNVGPVDSVYRAVIEPPRGVKIAVEPETLVFNASTKILGFKVRV  711

Query  297  TLSFKMAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
            T S K   P   Y+FGSF+W      V  PL VR
Sbjct  712  TTSHKNNMPV--YLFGSFTWTDGTRNVTIPLSVR  743



>ref|XP_008392653.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=499

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 127/208 (61%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            PHVTGIVALIK +HP+WSP+AIKSA++TTA        PI A+   ++ AN+FDFG G V
Sbjct  278  PHVTGIVALIKRMHPNWSPAAIKSALVTTAWRNGPSGLPIFAEGSPQKLANSFDFGGGLV  337

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP    +PGLVYD   ADY  +LC+  YN  ++  +TG  +TC     S   +N PS+T+
Sbjct  338  NPNGAAEPGLVYDMGAADYMEYLCARAYNNSAISRLTGKKTTCPVKKPSILDVNLPSVTI  397

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK-M  280
            P+L +  +V RTVTNVG P S YKA + PP G  V V P  L F    +KL FT++   +
Sbjct  398  PSLRNPVTVKRTVTNVGAPESIYKATIEPPFGTIVYVNPTALVFNSTVEKLTFTITISAI  457

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                 GY FGS +W    + VR PL VR
Sbjct  458  HEMNTGYYFGSLTWVDGVHAVRIPLSVR  485



>ref|XP_002966443.1| hypothetical protein SELMODRAFT_143697 [Selaginella moellendorffii]
 gb|EFJ32470.1| hypothetical protein SELMODRAFT_143697 [Selaginella moellendorffii]
Length=752

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 130/217 (60%), Gaps = 14/217 (6%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+G+ AL++  HP WSP+AIKSA+MT+AT+++     +S +  G  +  FDFGSG VN
Sbjct  532  PHVSGLAALLRGAHPDWSPAAIKSALMTSATLVDNTKNIMSDEATGNVSTPFDFGSGLVN  591

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            P   +DPGLVYD    DY  FLCS+ Y+ + L ++T   ++C  ++   S LNYPS +  
Sbjct  592  PETAMDPGLVYDLGREDYIEFLCSLNYSSKDLRMVTRSKASCPTSVPKTSDLNYPSFS--  649

Query  453  ALIH-------KFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFT  295
            A+         K S  RTVTNVG P++ Y A V  P+GI  +VVP+RL F    QKL++T
Sbjct  650  AVFDQSVKGPMKMSFKRTVTNVGSPKAEYVASVLVPKGIEASVVPKRLLFSELNQKLSYT  709

Query  294  LSFKM--AAPTQG---YVFGSFSWRSKKNWVRSPLVV  199
            L+     AA   G    VFG  +W   +  VRSP+ +
Sbjct  710  LTISAPRAAVVPGDIETVFGLLTWSDSQRMVRSPIAI  746



>ref|XP_008794749.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=776

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 127/212 (60%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+V L+K++HP WSPSAIKSAIMTTA   +   +P+  +    +A  F +GSG V
Sbjct  564  CPHISGVVGLLKSLHPDWSPSAIKSAIMTTARTQDSMDEPV-LNSSYVKATPFSYGSGHV  622

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLC++GYN   + + + D+ +C         LNYPSIT+
Sbjct  623  QPNRAMDPGLVYDLTTNDYLNFLCALGYNSTQIAIFSNDSFSCPSKPPKLEDLNYPSITI  682

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSFK  283
            P L    +VTR + NVG P  +Y   V  PRGI+V+V P  LT+   G++  F  TL  K
Sbjct  683  PDLSGSITVTRAMKNVGSP-GTYIVRVREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVK  741

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAG  187
                +  YVFG   W   K++VR+P+VV  AG
Sbjct  742  KGHASTDYVFGGLIWSDGKHYVRTPIVVSAAG  773



>emb|CDY70485.1| BnaA03g58450D, partial [Brassica napus]
Length=734

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 132/214 (62%), Gaps = 7/214 (3%)
 Frame = -3

Query  822  WLAPHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGS  646
            + AP + GI+ L+K++HP WSP+A+KSAIMTTA   + +  PI ++   R+ A+ FD+G+
Sbjct  520  YSAPAIAGILILLKSLHPDWSPAALKSAIMTTAWKTDPYGGPIYSESMPRKLADPFDYGA  579

Query  645  GFVNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPS  466
            G VNP R  DPGLVYD    DY  F C+ GYN+ S+ L+TG ++ C   L S    NYP+
Sbjct  580  GLVNPQRAGDPGLVYDLNLDDYIHFFCASGYNDTSIALLTGKDAKCPSPLPSILDFNYPA  639

Query  465  ITVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTF----KHYGQKLNF  298
            IT+P +  + +V+RTVTNVG   S Y+AV+ PPRG+ + V P  L F    K  G K+  
Sbjct  640  ITIPEVKDEVTVSRTVTNVGPVDSVYRAVIEPPRGVKIAVEPETLVFNASTKILGFKVRV  699

Query  297  TLSFKMAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
            T S K   P   Y+FGSF+W      V  PL VR
Sbjct  700  TTSHKNNMPV--YLFGSFTWTDGTRNVTIPLSVR  731



>ref|XP_006829608.2| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Amborella trichopoda]
Length=754

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 134/209 (64%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
             PHV G+VAL+K+++P+WSP+AIKSA++TTA+ ++K+ +P+ A+   R+ A+ FD+G G 
Sbjct  535  CPHVAGLVALLKSIYPNWSPAAIKSALITTASTIDKNEEPMLAEGSPRKVADPFDYGGGH  594

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V P    DPGL+YD   +D+  FLC++GYN  ++  +  +  +C +   S   LN PSI 
Sbjct  595  VIPNLAADPGLIYDMDISDHIMFLCAMGYNNSAISFVASEKISCPKEPPSIPNLNLPSIV  654

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    ++TR VTNVGE +S Y+A+V  P G+ V V P  L F +  + L F ++F +
Sbjct  655  IPELKTSVTITRKVTNVGEVQSVYQAMVLSPTGVKVVVEPAVLYFNNATKVLPFKVTFTV  714

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG Y FGS  W   +++VRSP+ VR
Sbjct  715  VHQMQGDYTFGSLIWSDGEHFVRSPIAVR  743



>ref|XP_010445236.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=856

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 128/208 (62%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            P V+G+VAL+KA+HP WSP+A+KSAIMT+A   +    PI A+   R+ A+ FD+G+G V
Sbjct  643  PVVSGLVALLKALHPDWSPAALKSAIMTSAWKTDPSGDPIFAEGQPRKLADPFDYGAGLV  702

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            N  R  DPGLVYD    DY  F C+ GYNE ++ ++ G  + C   L S    NYP+IT+
Sbjct  703  NMERAKDPGLVYDMNVDDYIHFFCASGYNETAITILVGKPTRCSSPLPSILDFNYPAITI  762

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + ++TRTVTNVG   S Y+AVV PP+G+ + V P  L F+   +KL F +    +
Sbjct  763  PDLEEEVTITRTVTNVGPVDSVYRAVVEPPQGVKIVVEPETLVFEQNTKKLGFKVRVSSS  822

Query  276  APTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
              +  GY FGSF+W      V  PL VR
Sbjct  823  HKSNTGYFFGSFTWTDGTRNVTIPLSVR  850



>ref|NP_001267495.1| SUB1 homolog precursor [Glycine max]
 gb|AAQ23176.1| subtilisin-like protease [Glycine max]
 gb|AFV08660.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 132/214 (62%), Gaps = 5/214 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L++A++P+WS +AIKSAIMTTAT L+   +P+    DG +A  F +G+G V
Sbjct  562  CPHVSGIVGLLRALYPTWSTAAIKSAIMTTATTLDNEVEPLLNATDG-KATPFSYGAGHV  620

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLC++GYNE  + + T     C +   S   LNYPSITV
Sbjct  621  QPNRAMDPGLVYDITIDDYLNFLCALGYNETQISVFTEGPYKCRKKF-SLLNLNYPSITV  679

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK--  283
            P L    +VTRT+ NVG P  +Y A V  P GI V+V P  L FK+ G++ +F L+FK  
Sbjct  680  PKLSGSVTVTRTLKNVGSP-GTYIAHVQNPYGITVSVKPSILKFKNVGEEKSFKLTFKAM  738

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAGSR  181
                T  Y FG   W   K++V SP+VV+   +R
Sbjct  739  QGKATNNYAFGKLIWSDGKHYVTSPIVVKALLTR  772



>ref|XP_010942535.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X4 [Elaeis 
guineensis]
Length=775

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 126/212 (59%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+V L+K++HP W+PSAIKSAIMTTA   +   +P+  +    +A  F +GSG V
Sbjct  563  CPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPV-LNSSYVKATPFSYGSGHV  621

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLCS+GYN   +   + D+  C         LNYPSIT+
Sbjct  622  RPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSKPPRLEDLNYPSITI  681

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSFK  283
            P L    +VTRT+ NVG P  +Y   +  PRGI+V+V P  LT+   G++  F  TL  K
Sbjct  682  PYLFGSITVTRTLKNVGSP-GTYIIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVK  740

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAG  187
                +  YVFG   W   K++VR+PLVV  AG
Sbjct  741  KGHASMDYVFGGLIWSDGKHYVRTPLVVSAAG  772



>ref|XP_008794759.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 125/210 (60%), Gaps = 2/210 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+V L+K++HP WSPSAIKSAIMTTAT  +   +P+  +    +A  F +GSG V
Sbjct  569  CPHISGVVGLLKSLHPDWSPSAIKSAIMTTATTQDNMDEPV-LNSSYVKATPFSYGSGHV  627

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLC++GY    + LI+ D+  C         LNYPSIT+
Sbjct  628  QPNRAMDPGLVYDLTTNDYLNFLCALGYTSTQIALISNDSFLCPSKPPKLEDLNYPSITI  687

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    +VTR + NVG P  +Y   V  P GI+V+V P  LT+   G++  F ++ K  
Sbjct  688  PDLSGSITVTRAMKNVGSP-GTYIVRVREPIGISVSVNPTSLTYDKIGEEKKFEVTLKEG  746

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVAG  187
                 YVFG   W   K++V++PLVV  AG
Sbjct  747  HAPTDYVFGELIWSDGKHYVQTPLVVSAAG  776



>ref|XP_010942534.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X3 [Elaeis 
guineensis]
Length=782

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 126/212 (59%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+V L+K++HP W+PSAIKSAIMTTA   +   +P+  +    +A  F +GSG V
Sbjct  570  CPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPV-LNSSYVKATPFSYGSGHV  628

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLCS+GYN   +   + D+  C         LNYPSIT+
Sbjct  629  RPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSKPPRLEDLNYPSITI  688

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSFK  283
            P L    +VTRT+ NVG P  +Y   +  PRGI+V+V P  LT+   G++  F  TL  K
Sbjct  689  PYLFGSITVTRTLKNVGSP-GTYIIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVK  747

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAG  187
                +  YVFG   W   K++VR+PLVV  AG
Sbjct  748  KGHASMDYVFGGLIWSDGKHYVRTPLVVSAAG  779



>ref|XP_008342302.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 138/210 (66%), Gaps = 2/210 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVAL+K++HP+WSP+AIKSA++TTA++ +++ + I A+    ++A+ FD+G G 
Sbjct  554  CPHISGIVALLKSIHPTWSPAAIKSALVTTASLEDEYGQSIVAEGAPHKQADPFDYGGGH  613

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P + + PGL+YD + +DY  FLCS+GYN  ++ L+ G   TC ++    + LN PSIT
Sbjct  614  VDPNKAIAPGLIYDIESSDYIRFLCSMGYNNTAISLVAGAKITCRKSTNFINNLNLPSIT  673

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +  L  + +V+RTVTNVG   S Y A V  P G++V V P  L+F    +KL F ++F+ 
Sbjct  674  IHELKQRTTVSRTVTNVGPVNSIYNARVITPAGVSVRVKPSILSFNSTVKKLEFKVTFRS  733

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
                QG + FG+  W    + VR PL+VR+
Sbjct  734  LLRIQGRFSFGNLFWEDGLHVVRIPLIVRI  763



>ref|XP_009128706.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X3 [Brassica 
rapa]
Length=643

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 130/209 (62%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
            AP ++G+VAL+KA+HP WSP+AI+SAI+TTA   +   + I A+   R+ A+ FD+G G 
Sbjct  424  APVISGVVALLKALHPDWSPAAIRSAIVTTAWRTDPFGEQIDAEGSSRKLADPFDYGGGL  483

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP + + PGLVYD    DY  ++CS+GYN+ S+  + G+ +TC     S   LN PSIT
Sbjct  484  VNPEKAVKPGLVYDLDLEDYVLYMCSVGYNDSSISQLVGERTTCSNPRPSVLDLNLPSIT  543

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  + ++TRTVTNVG P S YK  V PP G+ VTV+P +L F    +KL++ +    
Sbjct  544  IPDLKEEVTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVST  603

Query  279  AAPTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
                  G+ FGS +W    + V  PL VR
Sbjct  604  RHKINTGFYFGSLTWSDSVHDVIIPLSVR  632



>ref|XP_010942533.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Elaeis 
guineensis]
Length=809

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 126/212 (59%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+V L+K++HP W+PSAIKSAIMTTA   +   +P+  +    +A  F +GSG V
Sbjct  597  CPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPV-LNSSYVKATPFSYGSGHV  655

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLCS+GYN   +   + D+  C         LNYPSIT+
Sbjct  656  RPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSKPPRLEDLNYPSITI  715

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSFK  283
            P L    +VTRT+ NVG P  +Y   +  PRGI+V+V P  LT+   G++  F  TL  K
Sbjct  716  PYLFGSITVTRTLKNVGSP-GTYIIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVK  774

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAG  187
                +  YVFG   W   K++VR+PLVV  AG
Sbjct  775  KGHASMDYVFGGLIWSDGKHYVRTPLVVSAAG  806



>ref|XP_010942532.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Elaeis 
guineensis]
Length=816

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 126/212 (59%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+V L+K++HP W+PSAIKSAIMTTA   +   +P+  +    +A  F +GSG V
Sbjct  604  CPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPV-LNSSYVKATPFSYGSGHV  662

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLCS+GYN   +   + D+  C         LNYPSIT+
Sbjct  663  RPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSKPPRLEDLNYPSITI  722

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSFK  283
            P L    +VTRT+ NVG P  +Y   +  PRGI+V+V P  LT+   G++  F  TL  K
Sbjct  723  PYLFGSITVTRTLKNVGSP-GTYIIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTLKVK  781

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAG  187
                +  YVFG   W   K++VR+PLVV  AG
Sbjct  782  KGHASMDYVFGGLIWSDGKHYVRTPLVVSAAG  813



>ref|XP_009128705.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128707.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128709.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=723

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 130/209 (62%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
            AP ++G+VAL+KA+HP WSP+AI+SAI+TTA   +   + I A+   R+ A+ FD+G G 
Sbjct  504  APVISGVVALLKALHPDWSPAAIRSAIVTTAWRTDPFGEQIDAEGSSRKLADPFDYGGGL  563

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP + + PGLVYD    DY  ++CS+GYN+ S+  + G+ +TC     S   LN PSIT
Sbjct  564  VNPEKAVKPGLVYDLDLEDYVLYMCSVGYNDSSISQLVGERTTCSNPRPSVLDLNLPSIT  623

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  + ++TRTVTNVG P S YK  V PP G+ VTV+P +L F    +KL++ +    
Sbjct  624  IPDLKEEVTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVST  683

Query  279  AAPTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
                  G+ FGS +W    + V  PL VR
Sbjct  684  RHKINTGFYFGSLTWSDSVHDVIIPLSVR  712



>dbj|BAC22315.1| putative subtilisin-like serine protease AIR3 [Oryza sativa Japonica 
Group]
Length=762

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 125/207 (60%), Gaps = 4/207 (2%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH++G++ L+KA  P WSP+A++SAIMTTA   +    P+  D DGR A AF FG+G ++
Sbjct  554  PHISGVIGLLKAARPEWSPAAMRSAIMTTARTQDNTGAPMR-DHDGREATAFAFGAGNIH  612

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            P R +DPGLVYD    DY  FLCS+G+N   L  ++  N TC + +     LNYPSI VP
Sbjct  613  PNRAVDPGLVYDLSKEDYFVFLCSMGFNSSDLAKLSAGNFTCPEKVPPMEDLNYPSIVVP  672

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
            AL H  +V R +  VG P ++Y+A    P G+N+TV P  L F   G+   F ++FK   
Sbjct  673  ALRHTSTVARRLKCVGRP-ATYRATWRAPYGVNMTVEPAALEFGKDGEVKEFKVTFKSEK  731

Query  273  PT--QGYVFGSFSWRSKKNWVRSPLVV  199
                +GYVFG   W    + VRSP+VV
Sbjct  732  DKLGKGYVFGRLVWSDGTHHVRSPVVV  758



>ref|XP_009128704.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
Length=779

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 130/209 (62%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
            AP ++G+VAL+KA+HP WSP+AI+SAI+TTA   +   + I A+   R+ A+ FD+G G 
Sbjct  560  APVISGVVALLKALHPDWSPAAIRSAIVTTAWRTDPFGEQIDAEGSSRKLADPFDYGGGL  619

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP + + PGLVYD    DY  ++CS+GYN+ S+  + G+ +TC     S   LN PSIT
Sbjct  620  VNPEKAVKPGLVYDLDLEDYVLYMCSVGYNDSSISQLVGERTTCSNPRPSVLDLNLPSIT  679

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  + ++TRTVTNVG P S YK  V PP G+ VTV+P +L F    +KL++ +    
Sbjct  680  IPDLKEEVTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVST  739

Query  279  AAPTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
                  G+ FGS +W    + V  PL VR
Sbjct  740  RHKINTGFYFGSLTWSDSVHDVIIPLSVR  768



>ref|XP_003524185.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   177 bits (448),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 132/214 (62%), Gaps = 5/214 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L++A++P+WSP+AIKSAIMTTAT L+   +P+    DG +A  F +G+G V
Sbjct  562  CPHVSGIVGLLRALYPTWSPAAIKSAIMTTATTLDNEVEPLLNATDG-KATPFSYGAGHV  620

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLC++GYN   + + T     C +   S   LNYPSITV
Sbjct  621  QPNRAMDPGLVYDTTIDDYLNFLCALGYNATQISVFTEGPYQCRKKF-SLLNLNYPSITV  679

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK--  283
            P L    +VTR + NVG P  +Y A V  P GI ++V P  L FK+ G++ +F ++FK  
Sbjct  680  PKLSGSVTVTRRLKNVGSP-GTYIAHVQNPHGITISVKPSILKFKNVGEEKSFKVTFKAM  738

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAGSR  181
                T  YVFG   W   K++V SP+VV+   +R
Sbjct  739  QGKATNNYVFGKLIWSDGKHYVTSPIVVKALLTR  772



>ref|XP_010488664.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Camelina 
sativa]
Length=772

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K  +PSWSP+AI+SAIMTTAT ++    PI  +    +A  F FG+G V
Sbjct  564  CPHISGIAGLLKTRYPSWSPAAIRSAIMTTATTMDDIPGPIQ-NATNMKATPFSFGAGHV  622

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   ++PGLVYD+   DY  FLCS+GYN   + + +G+N TC     S   LNYPSITV
Sbjct  623  QPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITV  682

Query  456  PALI-HKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSF  286
            P L   K +V+RTV NVG P SSY   V  PRG+ V V P  L F   G++  F  TL  
Sbjct  683  PNLTSSKVTVSRTVKNVGRP-SSYTVRVTKPRGVYVAVNPTSLNFTKVGEQKTFKVTLVK  741

Query  285  KMAAPTQGYVFGSFSWRSKKNWVRSPLVVRV  193
                  +GYVFG   W  KK+ VRSP+VV++
Sbjct  742  DKGNKAKGYVFGELVWSDKKHRVRSPIVVKL  772



>gb|AES70685.2| subtilisin-like serine protease [Medicago truncatula]
Length=755

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 125/210 (60%), Gaps = 6/210 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+ IVAL+K ++P+WSP+A KSAIMTT T+   +H+PI  D     A  F +G+G +
Sbjct  547  CPHVSAIVALLKTIYPNWSPAAFKSAIMTTTTIQGNNHRPIK-DQSKEDATPFGYGAGHI  605

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   +DPGLVYD    DY  FLC+ GYN+  + + +     C ++       NYPSITV
Sbjct  606  QPELAMDPGLVYDLNIVDYLNFLCAHGYNQTQMKMFSRKPYICPKSYNMLD-FNYPSITV  664

Query  456  PALIHKF--SVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            P L   F   VTRTVTNVG P  +Y+  V  P GI V + PR LTF   G+K  F + FK
Sbjct  665  PNLGKHFVQEVTRTVTNVGSP-GTYRVQVNEPHGIFVLIKPRSLTFNEVGEKKTFKIIFK  723

Query  282  MAAPT-QGYVFGSFSWRSKKNWVRSPLVVR  196
            +  PT  GYVFG   W   ++ V SPLVV+
Sbjct  724  VTKPTSSGYVFGHLLWSDGRHKVMSPLVVK  753



>ref|XP_008380083.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=593

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 127/211 (60%), Gaps = 4/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K ++P WSP+AIKSAIMTTA   +    P+  +     A  F +G+G V
Sbjct  385  CPHISGICGLLKTLYPHWSPAAIKSAIMTTAITRDNSMGPL-LNASFYEATPFSYGAGHV  443

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P   +DPGLVYD    DY  FLC++GYNE  + + + D   C +   SP+ LNYPSIT+
Sbjct  444  DPNSAMDPGLVYDLSLNDYLNFLCAMGYNETEMEMFSEDTYECPKPAISPTNLNYPSITI  503

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFT--LSFK  283
            P L     VTRTV NVG P  +YKA +  P G++V+V P++L FK  G++ +F   L  K
Sbjct  504  PKLSGSLEVTRTVKNVGSP-GTYKAYIQSPDGVSVSVEPKKLKFKKIGEEKSFKVLLQVK  562

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             A   + YV G       K+ VRSP+VV+ +
Sbjct  563  EAKQAKNYVXGKLIXSDGKHXVRSPIVVKAS  593



>ref|XP_003600434.1| Subtilisin-like protease [Medicago truncatula]
Length=754

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 125/210 (60%), Gaps = 6/210 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+ IVAL+K ++P+WSP+A KSAIMTT T+   +H+PI  D     A  F +G+G +
Sbjct  546  CPHVSAIVALLKTIYPNWSPAAFKSAIMTTTTIQGNNHRPIK-DQSKEDATPFGYGAGHI  604

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   +DPGLVYD    DY  FLC+ GYN+  + + +     C ++       NYPSITV
Sbjct  605  QPELAMDPGLVYDLNIVDYLNFLCAHGYNQTQMKMFSRKPYICPKSYNMLD-FNYPSITV  663

Query  456  PALIHKF--SVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            P L   F   VTRTVTNVG P  +Y+  V  P GI V + PR LTF   G+K  F + FK
Sbjct  664  PNLGKHFVQEVTRTVTNVGSP-GTYRVQVNEPHGIFVLIKPRSLTFNEVGEKKTFKIIFK  722

Query  282  MAAPT-QGYVFGSFSWRSKKNWVRSPLVVR  196
            +  PT  GYVFG   W   ++ V SPLVV+
Sbjct  723  VTKPTSSGYVFGHLLWSDGRHKVMSPLVVK  752



>ref|XP_010514315.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=772

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K  +PSWSP+AI+SAIMTTAT ++    PI  +    +A  F FG+G V
Sbjct  564  CPHISGIAGLLKTRYPSWSPAAIRSAIMTTATTMDDIPGPIQ-NATNMKATPFSFGAGHV  622

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   ++PGLVYD+   DY  FLCS+GYN   + + +G+N TC     S   LNYPSITV
Sbjct  623  QPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITV  682

Query  456  PALI-HKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSF  286
            P L   K +V+RTV NVG P S+Y   V  PRG+ V V P  L F   G+K  F  TL  
Sbjct  683  PNLTSSKVTVSRTVKNVGRP-STYTVRVTNPRGVYVAVNPTSLNFTKVGEKKTFKVTLVK  741

Query  285  KMAAPTQGYVFGSFSWRSKKNWVRSPLVVRV  193
                  +GYVFG   W  KK+ VRSP+VV++
Sbjct  742  DKGNKAKGYVFGELVWSDKKHRVRSPIVVKL  772



>ref|XP_011082896.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=769

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 130/210 (62%), Gaps = 6/210 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+G+V L+K +HP+WSP+AIKSAIMTTA   +   KP++ D    +A   ++G G V
Sbjct  561  CPHVSGVVGLLKTLHPNWSPAAIKSAIMTTARTRDNTLKPLT-DASYLKATPLNYGGGHV  619

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLC++GYN+  + L + +   C Q ++    LNYPSITV
Sbjct  620  QPNRAMDPGLVYDLGANDYLNFLCALGYNQTQIQLFSEEPYACPQPIRLID-LNYPSITV  678

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    +VTR V NVG P  +Y+A V  P GI+V V P  L F+  G++  F ++ ++ 
Sbjct  679  PGLTGSVTVTRKVKNVGSP-GTYRARVRSPHGISVHVEPDSLKFERAGEEKRFRVTLQVK  737

Query  276  AP---TQGYVFGSFSWRSKKNWVRSPLVVR  196
             P    + YVFG   W   +++VRSP+VV+
Sbjct  738  KPGGAVKDYVFGQLIWSDGRHYVRSPIVVK  767



>ref|XP_002517380.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF44922.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=742

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 129/214 (60%), Gaps = 7/214 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GI  L+KAVHP WSP+AIKSAIMTTA   +   KPI A+     AN F++G+G V
Sbjct  529  CPHVSGISGLLKAVHPDWSPAAIKSAIMTTARTRSNVRKPI-ANASLVAANPFNYGAGHV  587

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERS-LHLITGDNSTCDQTLQSPSALNYPSIT  460
             P R ++PGLVYD    DY  FLCSIGYN    L L       C      PS LNYPSIT
Sbjct  588  WPNRAVNPGLVYDLTVTDYLKFLCSIGYNSSGLLSLFVDVTYECQSREAGPSDLNYPSIT  647

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFK--HYGQKLNFTLSF  286
            VP+L  K +++RT+ NVG P S YK  V PP+GI+V V P  L F   H  +K   TL  
Sbjct  648  VPSLSGKVTLSRTLKNVGTP-SLYKVRVKPPKGISVKVEPETLKFNKLHEEKKFKVTLEA  706

Query  285  KMAAPT-QGYVFGSFSWRSKKNW-VRSPLVVRVA  190
            K  +    GYVFG  +W   K + V+SP+VV+ A
Sbjct  707  KGGSSADHGYVFGGLTWSDGKLYVVKSPIVVKKA  740



>ref|XP_009396709.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=770

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 124/210 (59%), Gaps = 6/210 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+V L+KA+HP WSP+AIKSAIMTTA V +    P+  +     A+ F++GSG V
Sbjct  561  CPHISGVVGLLKALHPGWSPAAIKSAIMTTARVWDNEKLPLLDEATFLDASPFNYGSGHV  620

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLC +GYN  S  L    + +C         LNYPSIT+
Sbjct  621  RPNRAMDPGLVYDLTTTDYLNFLCGLGYN--STQLAEFRSYSCPSKPPHIKDLNYPSITI  678

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L     VTR V NVG P  +Y   V  PRGI+VTV P  LTF   G++  F ++ K  
Sbjct  679  PDLSSSTKVTRVVKNVGSP-GTYAVRVIEPRGISVTVSPTNLTFDEVGEEKKFEVTLKKI  737

Query  276  APTQG---YVFGSFSWRSKKNWVRSPLVVR  196
               +    YVFG   W  +K++VR+PLVV+
Sbjct  738  KEGESSAEYVFGRLIWTDRKHYVRTPLVVK  767



>ref|XP_012087230.1| PREDICTED: subtilisin-like protease SBT1.2 [Jatropha curcas]
Length=1267

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 127/215 (59%), Gaps = 14/215 (7%)
 Frame = -3

Query  816   APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
              PH++GI AL+K+ HP WSP+AIKSAIMTTA + N    PI  D   + A+ F  G+G V
Sbjct  1057  CPHLSGIAALLKSSHPYWSPAAIKSAIMTTADIFNMEGSPI-VDEKHQPADLFTIGAGHV  1115

Query  636   NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA-LNYPSIT  460
             NP+R  DPGL+YD QP DY  +LC +GY E  + +I      C + L  P   LNYPS +
Sbjct  1116  NPSRANDPGLIYDIQPDDYIPYLCGLGYKEEQVSIIAHRRIKCSEKLSIPEGQLNYPSFS  1175

Query  459   VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF--  286
             V  L    + TRTVTNVGE  S Y A + PP G+ VTV P RL F    QK+ ++++F  
Sbjct  1176  V-TLGASQTFTRTVTNVGEANSVYAATIVPPPGVAVTVEPYRLYFSQVNQKVTYSVTFSP  1234

Query  285   -----KMAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                  K +   QGY+     W S K+ VRSP+ VR
Sbjct  1235  TGSSGKTSEFAQGYIL----WSSAKHLVRSPISVR  1265


 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 100/183 (55%), Gaps = 3/183 (2%)
 Frame = -3

Query  768  SWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVNPARVLDPGLVYDAQP  589
            +WSP+AIKSAIMTTA ++N   +PI  D     A+    G+G V P+R  DPGLVYD QP
Sbjct  348  TWSPAAIKSAIMTTADLINVGGQPI-VDERLLPADILALGAGHVAPSRASDPGLVYDIQP  406

Query  588  ADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSP-SALNYPSITVPALIHKFSVTRTVTN  412
             DY  +LC +GY++R +  I      C +    P + LNYPS +    +   + TRT+TN
Sbjct  407  DDYIPYLCGLGYSDREITYIVQKKVKCSEVQSIPDTQLNYPSFSFVFGLKTQTYTRTLTN  466

Query  411  VGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF-KMAAPTQGYVFGSFSWR  235
            VG   SSY   VFPP G+ + V P ++ F    Q   +T++F      T+    G   W 
Sbjct  467  VGPANSSYTLSVFPPPGVEIAVSPSKIVFSKVKQTATYTVTFTNTVGTTESLAQGYLKWV  526

Query  234  SKK  226
            S +
Sbjct  527  SDQ  529



>ref|XP_004957134.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=808

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 130/225 (58%), Gaps = 15/225 (7%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV G+  L+KA+HP WSP+AIKSAIMTTA V +   KP+S +    RA  F +G+G V 
Sbjct  576  PHVAGVAGLLKALHPDWSPAAIKSAIMTTARVQDNMRKPMS-NSSFLRATPFGYGAGHVQ  634

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLIT---GDNST---CDQTLQSPSALNY  472
            P R  DPGLVYDA   DY  FLC++GYN  ++   T   GD  T   C      P  LNY
Sbjct  635  PNRAADPGLVYDADATDYLGFLCALGYNSSAIAAFTAGDGDGHTHYSCPARAPRPEDLNY  694

Query  471  PSITVPALI---HKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLN  301
            PS+ VP L       +VTR V NVG   ++Y A V  PRG+ V V PRRL F   G++  
Sbjct  695  PSVAVPHLSPTGAAHTVTRRVRNVGAGAAAYDARVHEPRGVEVDVRPRRLEFAAAGEEKQ  754

Query  300  FTLSFKMAAPT---QGYVFGSFSWR--SKKNWVRSPLVVRVAGSR  181
            FT++F+    +     YVFG   W   +  + VRSPLVVRV  S+
Sbjct  755  FTVTFRAREGSFWPGEYVFGRLVWSDGAGGHRVRSPLVVRVVDSK  799



>ref|XP_006664000.1| PREDICTED: subtilisin-like protease SDD1-like [Oryza brachyantha]
Length=736

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 122/206 (59%), Gaps = 2/206 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH++GI ALI+A HP WSP+AIKSAIMTTA V++  +KPI  D     A  F  G+G VN
Sbjct  531  PHLSGIAALIRATHPDWSPAAIKSAIMTTAYVVDNQNKPI-LDEKFNTAGHFAIGAGHVN  589

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQ-TLQSPSALNYPSITV  457
            P   +DPGL+YD   A Y ++LC +GY +  + +IT    +C   T  + + LNYPS+ V
Sbjct  590  PFEAIDPGLIYDTDEAQYISYLCGLGYTDAQVEIITHQKDSCQNGTKITEAELNYPSVAV  649

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
             A   K  V RTVTNVGE  SSY   +  PR +  +V P +L F    +K  F+LS    
Sbjct  650  RASAGKLVVNRTVTNVGEANSSYTVEIDMPREVKASVSPTKLEFTKMNEKKIFSLSLSWD  709

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVV  199
                 +  GSF W S+K+ VRSP+ +
Sbjct  710  IEKTNHAEGSFKWVSEKHVVRSPIAI  735



>ref|XP_006662913.1| PREDICTED: cucumisin-like [Oryza brachyantha]
Length=760

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 132/212 (62%), Gaps = 13/212 (6%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPD-GRRANAFDFGSGF  640
             PHV+GIVAL+K+VHP WSP+A+KSAIMTTA + + +  P+ AD    + A+ FD+G+GF
Sbjct  548  CPHVSGIVALLKSVHPDWSPAALKSAIMTTAHITDNNGLPLIADGTPNKIADPFDYGAGF  607

Query  639  VNPARVLDPGLVYDAQPADYKA-FLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSI  463
            VNP +  DPGLVYD  P+DY+  F C IG N          NS+C    +S S LN PSI
Sbjct  608  VNPTQASDPGLVYDIDPSDYQMLFNCMIGSNA---------NSSCTTIERSLSDLNLPSI  658

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
             +P L    +++RTVTNVG+P + YKA + PP G+++ V P  L F    +  +F ++ K
Sbjct  659  AIPNLKTSQTLSRTVTNVGQPDAVYKAFLQPPAGVDMLVEPTMLVFDKATRSQSFKVTLK  718

Query  282  MAAPTQG-YVFGSFSWRS-KKNWVRSPLVVRV  193
                 QG Y FG+ +W     +WVR P+ VRV
Sbjct  719  AKRRFQGDYTFGNLAWHDGSSHWVRIPIAVRV  750



>ref|XP_006423460.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
 gb|ESR36700.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
Length=623

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 135/210 (64%), Gaps = 3/210 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVAL+KA+HP+WSP+AIKSAI+TTA++ +++ + I A+    ++A+ FD+G G 
Sbjct  404  CPHISGIVALLKAIHPTWSPAAIKSAIVTTASLKDEYAQSIVAEGAPHKQADPFDYGGGH  463

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSI  463
            V+P + +DPGLVYD + +DY  FLC++GYN  ++ L+   ++TC D++ +    LN PSI
Sbjct  464  VDPNKAMDPGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSI  523

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            T+P L    +V+R VTNV    S Y A V  P G  V V P  LTF    +KL F ++F 
Sbjct  524  TIPELKKSITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFY  583

Query  282  MAAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                 QG Y FG+  W    + VR PL+VR
Sbjct  584  SRLRVQGRYSFGNLFWEDGIHVVRIPLIVR  613



>gb|KDO40058.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40059.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40060.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40061.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40062.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40063.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
 gb|KDO40064.1| hypothetical protein CISIN_1g006582mg [Citrus sinensis]
Length=639

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 135/210 (64%), Gaps = 3/210 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVAL+KA+HP+WSP+AIKSAI+TTA++ +++ + I A+    ++A+ FD+G G 
Sbjct  420  CPHISGIVALLKAIHPTWSPAAIKSAIVTTASLKDEYAQSIVAEGAPHKQADPFDYGGGH  479

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSI  463
            V+P + +DPGLVYD + +DY  FLC++GYN  ++ L+   ++TC D++ +    LN PSI
Sbjct  480  VDPNKAMDPGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSI  539

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            T+P L    +V+R VTNV    S Y A V  P G  V V P  LTF    +KL F ++F 
Sbjct  540  TIPELKKSITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFY  599

Query  282  MAAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                 QG Y FG+  W    + VR PL+VR
Sbjct  600  SRLRVQGRYSFGNLFWEDGIHVVRIPLIVR  629



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 134/209 (64%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPD-GRRANAFDFGSGF  640
             PHV+GIVAL+K++HP+WSP+AIKSA++TTA+  +K+ +   A+    ++A+ FD+G G 
Sbjct  556  CPHVSGIVALLKSMHPNWSPAAIKSALVTTASTKDKYGQSAVAEGSPHKQADPFDYGGGH  615

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P +  DPGL+YD    D+  FLC +GYN+ S+ L+T   + C +T +S + LN PSI+
Sbjct  616  VDPNKAADPGLIYDMGITDHVRFLCLMGYNDSSVSLMTRHPTVCSKTSKSLADLNLPSIS  675

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    +V+RTVTNVG   S Y   V  P G+ V V P  L+F    ++L F ++F+ 
Sbjct  676  IPELKKSLAVSRTVTNVGPVNSVYSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTFQS  735

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG Y FGS SW    + VR PL+VR
Sbjct  736  QLSVQGRYSFGSLSWEDGIHVVRIPLIVR  764



>ref|XP_006413792.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
 gb|ESQ55245.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
Length=748

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 130/208 (63%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            P V+GIVAL++A+HP WSP+A+KSA+MTTA   + + +PI A+   R+ A+ FD+G+G V
Sbjct  537  PVVSGIVALLRALHPDWSPAALKSALMTTAWRSDPNGEPIFAEGFPRKLADPFDYGAGLV  596

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            N  R  DPGLVYD    DY  + C+ GYN+ ++ ++TG  + C   L S   LNYP+IT+
Sbjct  597  NAERARDPGLVYDMNLDDYIHYFCASGYNDTAISVLTGKPTKCSSPLPSILDLNYPAITI  656

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P +  + S++RTVTNVG   S Y+AVV PP GI + V P  L F    +KL F +    +
Sbjct  657  PDIKEEVSLSRTVTNVGPVDSVYRAVVEPPPGIKIVVEPETLVFNSSTKKLGFKVRVSTS  716

Query  276  APTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
              +  GY FGSF+W      V  PL VR
Sbjct  717  YKSNTGYFFGSFTWTDGTRNVTIPLSVR  744



>ref|XP_009394968.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 128/212 (60%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+ GI  L+KA+HP WS SAIKSAIMTTA   +   +P+  +    + + F +GSG V
Sbjct  563  CPHIAGIAGLLKALHPDWSHSAIKSAIMTTARTRDNMKEPM-FNSSFVKTSPFSYGSGHV  621

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLC++GYN   +   + +   C         LNYPSIT+
Sbjct  622  QPNRAMDPGLVYDLTTNDYLNFLCALGYNSTQIATFSTEPFVCPSKPLKIEDLNYPSITI  681

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF--K  283
            P L    ++TRT+ NVG P S+YK  V  P G++VTV PR+L FK  G++  FT++   K
Sbjct  682  PNLSGASTITRTIKNVGLP-STYKVRVEEPAGVSVTVKPRKLKFKKLGEEKKFTVALKDK  740

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAG  187
             +   + Y FG  +W   K++VRSP+VV+V G
Sbjct  741  RSNLAREYTFGGLTWSDGKHYVRSPIVVKVVG  772



>ref|XP_002981864.1| hypothetical protein SELMODRAFT_115574, partial [Selaginella 
moellendorffii]
 gb|EFJ16957.1| hypothetical protein SELMODRAFT_115574, partial [Selaginella 
moellendorffii]
Length=725

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 133/216 (62%), Gaps = 8/216 (4%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+G  AL+KAVHP WSP+AI+SA+MTTAT+L+  + PIS D +   +  FD G+G +
Sbjct  504  CPHVSGAAALLKAVHPDWSPAAIRSALMTTATILDNTNSPIS-DFNKSTSGPFDTGAGEI  562

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGD-NSTCD--QTLQSPSALNYPS  466
            NP + LDPGLVYD  P DY ++LC  GYN   + LI+GD N++C   ++  +   LNYPS
Sbjct  563  NPQKALDPGLVYDITPQDYISYLCESGYNTTQVRLISGDPNTSCKPPKSNATTPFLNYPS  622

Query  465  ITVPALIHKF--SVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTL  292
            I    L      S  R VTNVG P+S Y A +  P  I++ V P  L F   GQKL++T+
Sbjct  623  IGFMGLTTTSPQSTERIVTNVGAPKSVYTAEITAPSSISIVVEPSSLEFSSTGQKLSYTI  682

Query  291  --SFKMAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
              + K + P   + FGS +W +  + VRSP+ +  A
Sbjct  683  TATAKNSLPVSMWSFGSITWIASSHTVRSPIAITSA  718



>ref|XP_002305456.2| hypothetical protein POPTR_0004s16850g [Populus trichocarpa]
 gb|EEE85967.2| hypothetical protein POPTR_0004s16850g [Populus trichocarpa]
Length=775

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 131/209 (63%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGF  640
             PH++G+VAL+KA HP WSP+AIKSA++TTA++ +++  K ++     ++A+ FD+G G 
Sbjct  557  CPHISGVVALLKAAHPKWSPAAIKSALITTASIEDEYGQKTVAEGAPHKQADPFDYGGGH  616

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P R +DPGLV+D   +DY  FLC++GYN  ++ L+T   + C ++      LN PSIT
Sbjct  617  VDPDRAMDPGLVFDMGTSDYIRFLCALGYNNSAISLMTRTRTRCKKSTTFLVNLNLPSIT  676

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    +V+RTVTNVG   S Y A V  P G  VTV P  L+F    +K+ F ++F  
Sbjct  677  IPELKQNLTVSRTVTNVGPITSIYVARVLAPAGTRVTVEPSVLSFDSTRKKIKFKVTFCS  736

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG Y FG+  W    + VR PL+V+
Sbjct  737  MLRIQGRYSFGNLFWEDGFHVVRIPLIVK  765



>gb|AFV08661.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 131/214 (61%), Gaps = 5/214 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L++A++P+WS +AIKSAIMTTAT L+   +P+    DG +A  F +G+G V
Sbjct  562  CPHVSGIVGLLRALYPTWSTAAIKSAIMTTATTLDNEVEPLLNATDG-KATPFSYGAGHV  620

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLC++GYNE  + + T     C +   S   LNYP ITV
Sbjct  621  QPNRAMDPGLVYDITIDDYLNFLCALGYNETQISVFTEGPYKCRKKF-SLLNLNYPLITV  679

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK--  283
            P L    +VTRT+ NVG P  +Y A V  P GI V+V P  L FK+ G++ +F L+FK  
Sbjct  680  PKLSGSVTVTRTLKNVGSP-GTYIAHVQNPYGITVSVKPSILKFKNVGEEKSFKLTFKAM  738

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVAGSR  181
                T  Y FG   W   K++V SP+VV+   +R
Sbjct  739  QGKATNNYAFGKLIWSDGKHYVTSPIVVKALLTR  772



>gb|AAK74005.1| At2g04160/T16B23.1 [Arabidopsis thaliana]
 gb|AAL15409.1| At2g04160/T16B23.1 [Arabidopsis thaliana]
Length=421

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K  +PSWSP+AI+SAIMTTAT+++    PI  +    +A  F FG+G V
Sbjct  213  CPHISGIAGLLKTRYPSWSPAAIRSAIMTTATIMDDIPGPIQ-NATNMKATPFSFGAGHV  271

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   ++PGLVYD    DY  FLCS+GYN   + + +G+N TC     S   LNYPSITV
Sbjct  272  QPNLAVNPGLVYDLGIKDYLNFLCSLGYNASQISVFSGNNFTCSSPKISLVNLNYPSITV  331

Query  456  PALI-HKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSF  286
            P L   K +V+RTV NVG P S Y   V  P+G+ V V P  L F   G++  F   L  
Sbjct  332  PNLTSSKVTVSRTVKNVGRP-SMYTVKVNNPQGVYVAVKPTSLNFTKVGEQKTFKVILVK  390

Query  285  KMAAPTQGYVFGSFSWRSKKNWVRSPLVVRV  193
                  +GYVFG   W  KK+ VRSP+VV++
Sbjct  391  SKGNVAKGYVFGELVWSDKKHRVRSPIVVKL  421



>gb|KHN34449.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=689

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 125/209 (60%), Gaps = 6/209 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH++GI AL+K+ HP WSP+AIKSAIMT+A ++N  HK I  D     A+ F  GSG VN
Sbjct  480  PHLSGIAALLKSSHPHWSPAAIKSAIMTSADIINFEHKLI-VDETLYPADVFATGSGHVN  538

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA-LNYPSITV  457
            P+R  DPGLVYD QP DY  +LC +GY +  + +I     TC +T   P   LNYPS +V
Sbjct  539  PSRANDPGLVYDIQPDDYIPYLCGLGYGDTEVGIIAHKTITCSETSSIPEGELNYPSFSV  598

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF---  286
              L    + TRTVTNVGE  SSY  +V  P G+ V V P  LTF    QK  +++SF   
Sbjct  599  -VLGSPQTFTRTVTNVGEANSSYVVMVMAPEGVEVKVRPNNLTFSEANQKETYSVSFSRI  657

Query  285  KMAAPTQGYVFGSFSWRSKKNWVRSPLVV  199
            +    T  Y  G   W S K+ VRSP++V
Sbjct  658  ESGNETAEYAQGFLQWVSAKHTVRSPILV  686



>ref|XP_010271498.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 136/211 (64%), Gaps = 6/211 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDG---RRANAFDFGS  646
             PHV+GIVAL+K++HP+WSP+AIKSA++TTA+  +K+ +  SA  +G   ++A+ FD+G 
Sbjct  559  CPHVSGIVALLKSMHPNWSPAAIKSALVTTASTKDKYGQ--SAVAEGSPHKQADPFDYGG  616

Query  645  GFVNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPS  466
            G V+P +  DPGL+YD    D+  FLC +GYN+ S+ L+T   + C +T +S + LN PS
Sbjct  617  GHVDPNKAADPGLIYDMGITDHVRFLCLMGYNDSSVSLMTRHPTVCSKTSKSLADLNLPS  676

Query  465  ITVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF  286
            I++P L    +V+RTVTNVG   S Y   V  P G+ V V P  L+F    ++L F ++F
Sbjct  677  ISIPELKKSLAVSRTVTNVGPVNSVYSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTF  736

Query  285  KMAAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
            +     QG Y FGS SW    + VR PL+VR
Sbjct  737  QSQLSVQGRYSFGSLSWEDGIHVVRIPLIVR  767



>emb|CBI23066.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 127/208 (61%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPD-GRRANAFDFGSGFV  637
            PH+ GIVAL+K++HP WSP+AIKSAI+TT    +   +PI A+ D  + A+ FDFG G V
Sbjct  481  PHIAGIVALLKSLHPHWSPAAIKSAIVTTGWTTDPSGEPIFAEGDPTKLADPFDFGGGIV  540

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP R  DPGLVYD   ADY  +LC++GYN  ++   T  +  C     S   LN PSIT+
Sbjct  541  NPNRAADPGLVYDMGTADYIHYLCTLGYNNSAIFQFTEQSIRCPTGEHSILDLNLPSITI  600

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF-KM  280
            P+L +  S+TR VTNVG   S+YKA +  P GI +TV P  L F    + + F+++   +
Sbjct  601  PSLQNSTSLTRNVTNVGAVNSTYKASIISPAGITITVKPDTLIFDSTIKTVTFSVTVSSI  660

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                 GY FGS +W    + VRSP+ VR
Sbjct  661  HQVNTGYSFGSLTWIDGVHAVRSPISVR  688



>ref|XP_006660048.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=747

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 125/207 (60%), Gaps = 4/207 (2%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+G++ L+KA  P WSP+A++SAIMTTA   +    P+  D DG  A AF FG+G V+
Sbjct  539  PHVSGVIGLLKAARPGWSPAAMRSAIMTTARTQDNTGAPMR-DHDGTEATAFAFGAGNVH  597

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            P R +DPGLVYD    DY  FLC++G++   L  ++     C   +     LNYPSI VP
Sbjct  598  PNRAVDPGLVYDLSNDDYFTFLCAMGFSTEDLAKLSAGKFACPAKVPPVQDLNYPSIVVP  657

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
            AL H  +VTR + NVG P ++Y+A    P GIN+TV P  L FK+ G++  F ++ K   
Sbjct  658  ALRHSATVTRRLKNVGRP-ATYRATWRAPTGINMTVEPAALEFKNAGEQKEFKVTLKSDK  716

Query  273  PT--QGYVFGSFSWRSKKNWVRSPLVV  199
                +GYVFG   W    + VRSP+VV
Sbjct  717  DKIGKGYVFGRLDWSDGTHHVRSPVVV  743



>ref|XP_010436465.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=629

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 126/208 (61%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            P V+G+V L+KA+HP WSP+A+KSAIMT+A   +    PI A+   R+ A+ FD+G+G V
Sbjct  416  PVVSGLVVLLKALHPDWSPAALKSAIMTSAWKTDPSGDPIFAEGQPRKLADPFDYGAGLV  475

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            N  R  DPGLVYD    DY  F C+ GYNE ++ ++ G  + C   L S    NYP+IT+
Sbjct  476  NMERAKDPGLVYDMNVDDYIHFFCASGYNETAITILVGKPTRCSSPLPSILDFNYPAITI  535

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + ++TRTVTNVG   S Y+AVV PP+G+ + V P  L F    +KL F +    +
Sbjct  536  PDLEEEVTLTRTVTNVGPVDSVYRAVVEPPQGVKIVVEPETLVFSSNTKKLGFKVRVSSS  595

Query  276  APTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
              +  GY FGSF+W      V  PL VR
Sbjct  596  HKSNTGYFFGSFTWTDGTRNVTIPLSVR  623



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 136/213 (64%), Gaps = 8/213 (4%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIVA++KA +PSWSPSAIKSAIMTTA   +    PI+ +  G  A  +D G+G  
Sbjct  554  CPHVSGIVAIVKAQNPSWSPSAIKSAIMTTAIQTSNLKAPITTN-SGSIATPYDIGAGEA  612

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITG---DNSTC--DQTLQSPSALNY  472
            +P+  ++PGLVY+   ADY  FLCSIGY+   + LI+    D+ +C  + + +S S +NY
Sbjct  613  SPSGAINPGLVYETYAADYLQFLCSIGYDTLKIKLISKTVPDDFSCPTNSSSESISKMNY  672

Query  471  PSITVPALIHKFS--VTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF  298
            PSI V  +    +  VTR +TNV E  ++Y A++  P G+ V V+P +L F +  +KLN+
Sbjct  673  PSIAVSNIKENETKKVTRMITNVAEEEATYTAIIKAPTGLEVQVIPNKLVFTNNSKKLNY  732

Query  297  TLSFKMAAPTQGYVFGSFSWRSKKNWVRSPLVV  199
             +SFK ++   G +FGS +W + K  VRSP VV
Sbjct  733  EVSFKSSSKPVGDLFGSITWTNGKYKVRSPFVV  765



>ref|XP_010488663.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Camelina 
sativa]
Length=772

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K  +PSWSP+AI+SAIMTTAT ++    PI  +    +A  F FG+G V
Sbjct  564  CPHISGIAGLLKTRYPSWSPAAIRSAIMTTATTMDDIPGPIQ-NATNMKATPFSFGAGHV  622

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   ++PGLVYD+   DY  FLCS+GYN   + + +G+N TC     S   LNYPSITV
Sbjct  623  QPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQIAVFSGNNFTCSSPKTSLVNLNYPSITV  682

Query  456  PALI-HKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSF  286
            P L   K +V+RTV NVG P SSY   V  PRG+ V V P  L F   G++  F  TL  
Sbjct  683  PNLTSSKVTVSRTVKNVGRP-SSYTVRVTKPRGVYVAVNPTSLNFTKVGEQKTFKVTLVK  741

Query  285  KMAAPTQGYVFGSFSWRSKKNWVRSPLVVRV  193
                  +GYVFG   W  KK+ VRSP+V ++
Sbjct  742  DKGNKAKGYVFGELVWSDKKHRVRSPIVAKL  772



>ref|XP_006423459.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
 gb|ESR36699.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
Length=780

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 135/210 (64%), Gaps = 3/210 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVAL+KA+HP+WSP+AIKSAI+TTA++ +++ + I A+    ++A+ FD+G G 
Sbjct  561  CPHISGIVALLKAIHPTWSPAAIKSAIVTTASLKDEYAQSIVAEGAPHKQADPFDYGGGH  620

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSI  463
            V+P + +DPGLVYD + +DY  FLC++GYN  ++ L+   ++TC D++ +    LN PSI
Sbjct  621  VDPNKAMDPGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSI  680

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            T+P L    +V+R VTNV    S Y A V  P G  V V P  LTF    +KL F ++F 
Sbjct  681  TIPELKKSITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFY  740

Query  282  MAAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                 QG Y FG+  W    + VR PL+VR
Sbjct  741  SRLRVQGRYSFGNLFWEDGIHVVRIPLIVR  770



>ref|XP_002273195.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 127/208 (61%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPD-GRRANAFDFGSGFV  637
            PH+ GIVAL+K++HP WSP+AIKSAI+TT    +   +PI A+ D  + A+ FDFG G V
Sbjct  558  PHIAGIVALLKSLHPHWSPAAIKSAIVTTGWTTDPSGEPIFAEGDPTKLADPFDFGGGIV  617

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP R  DPGLVYD   ADY  +LC++GYN  ++   T  +  C     S   LN PSIT+
Sbjct  618  NPNRAADPGLVYDMGTADYIHYLCTLGYNNSAIFQFTEQSIRCPTGEHSILDLNLPSITI  677

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF-KM  280
            P+L +  S+TR VTNVG   S+YKA +  P GI +TV P  L F    + + F+++   +
Sbjct  678  PSLQNSTSLTRNVTNVGAVNSTYKASIISPAGITITVKPDTLIFDSTIKTVTFSVTVSSI  737

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                 GY FGS +W    + VRSP+ VR
Sbjct  738  HQVNTGYSFGSLTWIDGVHAVRSPISVR  765



>ref|XP_006487361.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Citrus 
sinensis]
Length=780

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 135/210 (64%), Gaps = 3/210 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVAL+KA+HP+WSP+AIKSAI+TTA++ +++ + I A+    ++A+ FD+G G 
Sbjct  561  CPHISGIVALLKAIHPTWSPAAIKSAIVTTASLKDEYAQSIVAEGAPHKQADPFDYGGGH  620

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSI  463
            V+P + +DPGLVYD + +DY  FLC++GYN  ++ L+   ++TC D++ +    LN PSI
Sbjct  621  VDPNKAMDPGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSI  680

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            T+P L    +V+R VTNV    S Y A V  P G  V V P  LTF    +KL F ++F 
Sbjct  681  TIPELKKSITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFY  740

Query  282  MAAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                 QG Y FG+  W    + VR PL+VR
Sbjct  741  SRLRVQGRYSFGNLFWEDGIHVVRIPLIVR  770



>ref|XP_002960359.1| hypothetical protein SELMODRAFT_437460 [Selaginella moellendorffii]
 gb|EFJ37898.1| hypothetical protein SELMODRAFT_437460 [Selaginella moellendorffii]
Length=756

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 127/209 (61%), Gaps = 3/209 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV G++AL+KA HP WSP+AI+SA+ TTATV++     I  +    RA  F FGSG V+
Sbjct  548  PHVAGMIALLKAYHPEWSPAAIRSALSTTATVVDNKKNHILTNAL-ERATPFHFGSGHVD  606

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNS-TCDQTLQSPSALNYPSITV  457
            P     PGL+YD   +DY AFLC + Y+  ++ LITG     C    Q  SALN PSIT+
Sbjct  607  PNAAAHPGLIYDVSESDYIAFLCDL-YDSVAVALITGKRGIDCSTVAQPASALNLPSITL  665

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              L    +VTR VTNVG+  S+Y   +  P G++V+V P  L F   GQ L F ++F   
Sbjct  666  SNLTGVKTVTRFVTNVGDCVSTYWPKIEAPEGVSVSVEPSELAFTQAGQTLAFNVTFNAT  725

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             P + YVFGS +W+S K+ VR PL V+ A
Sbjct  726  MPRKDYVFGSLTWKSYKHKVRIPLTVKAA  754



>ref|XP_006487362.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Citrus 
sinensis]
Length=719

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 135/210 (64%), Gaps = 3/210 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVAL+KA+HP+WSP+AIKSAI+TTA++ +++ + I A+    ++A+ FD+G G 
Sbjct  500  CPHISGIVALLKAIHPTWSPAAIKSAIVTTASLKDEYAQSIVAEGAPHKQADPFDYGGGH  559

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQSPSALNYPSI  463
            V+P + +DPGLVYD + +DY  FLC++GYN  ++ L+   ++TC D++ +    LN PSI
Sbjct  560  VDPNKAMDPGLVYDMEVSDYVRFLCAMGYNNSAISLMNRASTTCNDKSTKFLVNLNLPSI  619

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            T+P L    +V+R VTNV    S Y A V  P G  V V P  LTF    +KL F ++F 
Sbjct  620  TIPELKKSITVSRQVTNVSPMNSVYTARVQAPAGTTVRVEPSTLTFNSTRKKLKFKVTFY  679

Query  282  MAAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                 QG Y FG+  W    + VR PL+VR
Sbjct  680  SRLRVQGRYSFGNLFWEDGIHVVRIPLIVR  709



>ref|XP_002298975.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
 gb|EEE83780.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
Length=786

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 130/209 (62%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
             PHV+GIVALIK++HP+WSP+AI+SA++TTA+        I  +   R+ A+ FD G G 
Sbjct  571  CPHVSGIVALIKSLHPNWSPAAIRSALVTTASQTGTDGMKIFEEGSTRKEADPFDMGGGH  630

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP +   PGLVYD    +Y  +LCSIGY+  S+  +T     C +   +   LN PSIT
Sbjct  631  VNPEKAAYPGLVYDTTTEEYIQYLCSIGYSSSSITRLTNTKINCVKKTNTRLNLNLPSIT  690

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  K +VTR VTNVG   S YKA+V  P GI++ V P+ L+F    + L+F ++F  
Sbjct  691  IPNLKKKVTVTRKVTNVGNVNSVYKAIVQAPIGISMAVEPKTLSFNRINKILSFRVTFLS  750

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
            +   QG Y FGS +W   +++VRSP+ VR
Sbjct  751  SQKVQGEYRFGSLTWTDGEHFVRSPISVR  779



>ref|XP_006391365.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
 gb|ESQ28651.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
Length=791

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 130/209 (62%), Gaps = 3/209 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            P V+GIVAL++  HP WSP+AI+SA++TTA   +   +PI+A+   R+ A+ FD+G G V
Sbjct  575  PVVSGIVALVRKKHPDWSPAAIRSALVTTAFQSDPSGEPIAAEGSPRKLADPFDYGGGLV  634

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +V DPGLVYD    +Y  +LCS GY++RS+  + G N TC     S   +N PSIT+
Sbjct  635  NPGKVADPGLVYDMGYNEYVHYLCSAGYDDRSISKLLGKNYTCPSPTPSMLDVNLPSITI  694

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + ++TRTVTNVG   S YKA++ PP+GINV V P  L F    +K+ F +     
Sbjct  695  PYLSEEITITRTVTNVGPVGSVYKALIEPPQGINVQVTPETLEFGSNAKKITFKVKVSTT  754

Query  276  APTQ-GYVFGSFSWRSK-KNWVRSPLVVR  196
              T   Y+FGS +W     + VR PL VR
Sbjct  755  HRTNTDYLFGSLTWTDNGAHNVRIPLSVR  783



>ref|XP_012086639.1| PREDICTED: subtilisin-like protease SBT3.5 [Jatropha curcas]
Length=781

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 127/209 (61%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
             PHV GIVALIK++HP+WSP+AI+SA++TTA+        I  +   R+ A+ FD G G 
Sbjct  565  CPHVAGIVALIKSIHPNWSPAAIRSALVTTASQTGTDGMNIYEEGPTRKPADPFDIGGGQ  624

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP + +DPGLVYD    DY  FLCS+GY+  S+  +T     C Q       LN PSIT
Sbjct  625  VNPEKAVDPGLVYDISTEDYVQFLCSMGYSSSSISSLTKAAINCKQNYHIKLNLNLPSIT  684

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  K +V+R VTNVG   S YKA+   P GI +T+ P+ L+F    +  +F ++F  
Sbjct  685  IPNLNRKLTVSRKVTNVGTINSVYKAIAQAPFGIRMTIEPQILSFNSTTKSASFEITFFS  744

Query  279  AAPTQGYV-FGSFSWRSKKNWVRSPLVVR  196
                QGY  FGS +W   K++VRSP+ VR
Sbjct  745  TQKVQGYYKFGSLTWTDGKHFVRSPIAVR  773



>dbj|BAJ34472.1| unnamed protein product [Thellungiella halophila]
Length=421

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K  +PSWSP+AI+SAIMTTAT ++    PI  +    +A  F FG+G V
Sbjct  213  CPHISGIAGLLKTRYPSWSPAAIRSAIMTTATTMDDIPGPIQ-NSTNMKATPFSFGAGHV  271

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   ++PGLVYD+   DY  FLCS+GYN   + + +G N  C     S   LNYPSITV
Sbjct  272  RPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQISVFSGKNFACKSRKTSLYNLNYPSITV  331

Query  456  PAL-IHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSF  286
            P L   K +V+RTV NVG P S+Y      P G+ V V P  L F   G++  F  TL  
Sbjct  332  PNLSSRKVTVSRTVKNVGRP-STYTVQANNPHGVYVAVKPTSLNFTKVGEQKTFKVTLVK  390

Query  285  KMAAPTQGYVFGSFSWRSKKNWVRSPLVVRV  193
            +     +GYVFG   W  KK+ VRSP+VV++
Sbjct  391  RKGKVAKGYVFGELVWSDKKHRVRSPIVVKL  421



>gb|EYU39037.1| hypothetical protein MIMGU_mgv1a021904mg [Erythranthe guttata]
Length=724

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH+ GI AL+K+ HP WSP+AIKSAIMTTA  L+    PI  D     A+ F  G+G VN
Sbjct  516  PHLGGIAALLKSAHPDWSPAAIKSAIMTTAGQLDLEGGPIE-DERHLPADIFALGAGHVN  574

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA-LNYPSITV  457
            P+   DPGLVYD QP DY  +LC +GY ++ + +I G + +C  T   P A LNYPS +V
Sbjct  575  PSSANDPGLVYDLQPEDYIPYLCGLGYTDQEIQVIVGQHVSCSNTTSIPEAQLNYPSFSV  634

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF-KM  280
                   + TRTVTNVGE  S+Y AV    +G++V V P  L+F    QK+ + +SF K 
Sbjct  635  ELGPATKTYTRTVTNVGEANSTY-AVEIKTQGVHVEVTPTTLSFTEVNQKMTYQISFSKS  693

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
              P  G Y  G+  WRS K+ VRSP+  ++
Sbjct  694  TTPVNGSYAQGAIVWRSAKHAVRSPISAKL  723



>gb|EEC83379.1| hypothetical protein OsI_28793 [Oryza sativa Indica Group]
Length=1269

 Score =   177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 125/208 (60%), Gaps = 4/208 (2%)
 Frame = -3

Query  816   APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
              PH++G++ L+KA  P WSP+A++SAIMTTA   +    P+  D DGR A AF FG+G +
Sbjct  1060  CPHISGVIGLLKAARPEWSPAAMRSAIMTTARTQDNTGAPMR-DHDGREATAFAFGAGNI  1118

Query  636   NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             +P R +DPGLVYD    DY  FLCS+G+N   L  ++  N TC + +     LNYPSI V
Sbjct  1119  HPNRAVDPGLVYDLSKEDYFVFLCSMGFNSSDLAKLSAGNFTCPEKVPPMEDLNYPSIVV  1178

Query  456   PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
             PAL H  +V R +  VG P ++Y+A    P G+N+TV P  L F   G+   F ++FK  
Sbjct  1179  PALRHTSTVARRLKCVGRP-ATYRATWRAPYGVNMTVEPAALEFGKDGEVKEFKVTFKSE  1237

Query  276   APT--QGYVFGSFSWRSKKNWVRSPLVV  199
                  +GYVFG   W    + VRSP+VV
Sbjct  1238  KDKLGKGYVFGRLVWSDGTHHVRSPVVV  1265



>emb|CDX94033.1| BnaC07g36670D [Brassica napus]
Length=799

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 126/209 (60%), Gaps = 7/209 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
            AP V GIV L+K++HP WSP+A+KSAIMTTA   +    PI ++   R+ A+ FD+G G 
Sbjct  525  APAVAGIVLLLKSLHPDWSPAALKSAIMTTAWKTDPFGDPIYSESMPRKLADPFDYGGGL  584

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP R  DPGLVYD    DY  F C+ GYN+ S+ L+TG ++ C   L      NYP+IT
Sbjct  585  VNPQRARDPGLVYDLNLDDYIHFFCASGYNDTSIALLTGKDAKCPSPLPYILDFNYPAIT  644

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTF----KHYGQKLNFTL  292
            +P L  + +V+RTVTNVG   S Y+AV+ PPRG+ + V P  L F    K  G K+  T 
Sbjct  645  IPELKDEVTVSRTVTNVGPVDSVYRAVIEPPRGVKIAVEPETLVFNSSSKILGFKVRVTT  704

Query  291  SFKMAAPTQGYVFGSFSWRSKKNWVRSPL  205
            S K   P   Y+FGSF+W      V  PL
Sbjct  705  SHKSNMPV--YLFGSFTWTDGTRNVTIPL  731



>gb|EAZ42320.1| hypothetical protein OsJ_26892 [Oryza sativa Japonica Group]
Length=1297

 Score =   177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 125/208 (60%), Gaps = 4/208 (2%)
 Frame = -3

Query  816   APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
              PH++G++ L+KA  P WSP+A++SAIMTTA   +    P+  D DGR A AF FG+G +
Sbjct  1058  CPHISGVIGLLKAARPEWSPAAMRSAIMTTARTQDNTGAPMR-DHDGREATAFAFGAGNI  1116

Query  636   NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             +P R +DPGLVYD    DY  FLCS+G+N   L  ++  N TC + +     LNYPSI V
Sbjct  1117  HPNRAVDPGLVYDLSKEDYFVFLCSMGFNSSDLAKLSAGNFTCPEKVPPMEDLNYPSIVV  1176

Query  456   PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
             PAL H  +V R +  VG P ++Y+A    P G+N+TV P  L F   G+   F ++FK  
Sbjct  1177  PALRHTSTVARRLKCVGRP-ATYRATWRAPYGVNMTVEPAALEFGKDGEVKEFKVTFKSE  1235

Query  276   APT--QGYVFGSFSWRSKKNWVRSPLVV  199
                  +GYVFG   W    + VRSP+VV
Sbjct  1236  KDKLGKGYVFGRLVWSDGTHHVRSPVVV  1263



>emb|CAN77487.1| hypothetical protein VITISV_020248 [Vitis vinifera]
Length=681

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 129/212 (61%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTG+VALIK+ HP WSP+AIKSAIMTTA   +  H  I A    + A+ FD G+G +
Sbjct  456  CPHVTGVVALIKSAHPDWSPAAIKSAIMTTAYNRDSTHDSILAGGSRKVADPFDIGAGHL  515

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLIT--GDNSTCDQTLQSPSALNYPSI  463
            NP + +DPGLVYD Q +DY A+LC IGY    +  I   G + +C +  QS S LNYPSI
Sbjct  516  NPLKAMDPGLVYDMQASDYIAYLCDIGYTREQIKAIVLPGTHVSCSKEDQSISNLNYPSI  575

Query  462  TVPALIHKFSVTRTVTNVGEPRSS-YKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF  286
            TV  L    ++ RTV NVG  +++ Y   +  P G+ V++ PR L F  + ++  + ++ 
Sbjct  576  TVSNLQSTVTIKRTVRNVGPKKTAVYFVSIVNPCGVKVSIWPRILFFSCFKEEHTYYVTL  635

Query  285  KMAAPTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
            K    +QG Y FG   W    ++VRSPLVV V
Sbjct  636  KPQKKSQGRYDFGEIVWTDGFHYVRSPLVVSV  667



>ref|XP_011037192.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=775

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 131/209 (63%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGF  640
             PH++G+VAL+KA HP WSP+AIKSA++TTA++ +++  K ++     ++A+ FD+G G 
Sbjct  557  CPHISGVVALLKAAHPKWSPAAIKSALITTASIEDEYGQKTVAEGAPHKQADPFDYGGGH  616

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P R + PGLV+D   +DY  FLC++GYN  ++ L+T   + C ++      LN PSIT
Sbjct  617  VDPERAMHPGLVFDMGTSDYIRFLCALGYNNSAISLMTRTRTRCKKSTTFLVNLNLPSIT  676

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L    +V+RTVTNVG   S Y A V  P G +VTV P  L+F    +K+ F ++F  
Sbjct  677  IPELKQNLTVSRTVTNVGPITSIYVARVLAPAGTHVTVEPSVLSFDSIRKKIKFKVTFCS  736

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG Y FG+  W    + VR PL+VR
Sbjct  737  MLRIQGRYSFGNLFWEDGFHVVRIPLIVR  765



>emb|CBI16560.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 129/212 (61%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTG+VALIK+ HP WSP+AIKSAIMTTA   +  H  I A    + A+ FD G+G +
Sbjct  547  CPHVTGVVALIKSAHPDWSPAAIKSAIMTTAYNRDSTHDSILAGGSRKVADPFDIGAGHL  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLIT--GDNSTCDQTLQSPSALNYPSI  463
            NP + +DPGLVYD Q +DY A+LC IGY    +  I   G + +C +  QS S LNYPSI
Sbjct  607  NPLKAMDPGLVYDMQASDYIAYLCDIGYTREQIKAIVLPGTHVSCSKEDQSISNLNYPSI  666

Query  462  TVPALIHKFSVTRTVTNVGEPRSS-YKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF  286
            TV  L    ++ RTV NVG  +++ Y   +  P G+ V++ PR L F  + ++  + ++ 
Sbjct  667  TVSNLQSTVTIKRTVRNVGPKKTAVYFVSIVNPCGVKVSIWPRILFFSCFKEEHTYYVTL  726

Query  285  KMAAPTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
            K    +QG Y FG   W    ++VRSPLVV V
Sbjct  727  KPQKKSQGRYDFGEIVWTDGFHYVRSPLVVSV  758



>ref|XP_010651399.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=780

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 129/212 (61%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHVTG+VALIK+ HP WSP+AIKSAIMTTA   +  H  I A    + A+ FD G+G +
Sbjct  555  CPHVTGVVALIKSAHPDWSPAAIKSAIMTTAYNRDSTHDSILAGGSRKVADPFDIGAGHL  614

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLIT--GDNSTCDQTLQSPSALNYPSI  463
            NP + +DPGLVYD Q +DY A+LC IGY    +  I   G + +C +  QS S LNYPSI
Sbjct  615  NPLKAMDPGLVYDMQASDYIAYLCDIGYTREQIKAIVLPGTHVSCSKEDQSISNLNYPSI  674

Query  462  TVPALIHKFSVTRTVTNVGEPRSS-YKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF  286
            TV  L    ++ RTV NVG  +++ Y   +  P G+ V++ PR L F  + ++  + ++ 
Sbjct  675  TVSNLQSTVTIKRTVRNVGPKKTAVYFVSIVNPCGVKVSIWPRILFFSCFKEEHTYYVTL  734

Query  285  KMAAPTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
            K    +QG Y FG   W    ++VRSPLVV V
Sbjct  735  KPQKKSQGRYDFGEIVWTDGFHYVRSPLVVSV  766



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 137/212 (65%), Gaps = 8/212 (4%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+GIVA++KA +PSWSPSAIKSAIMTTA   N    PI+ +  G  A  +D G+G  +
Sbjct  555  PHVSGIVAIVKAQNPSWSPSAIKSAIMTTAIQTNNLKAPITTN-SGSVATPYDIGAGEAS  613

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITG---DNSTC--DQTLQSPSALNYP  469
            P+  ++PGLVY+   ADY  FLCSIGY+   + LI+    D+ +C  + + +S S +NYP
Sbjct  614  PSGAINPGLVYETYAADYLQFLCSIGYDPIKIKLISKTVPDDFSCPTNSSSESISKMNYP  673

Query  468  SITVPALIHKFS--VTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFT  295
            SI V  +    +  VTR +TNV E  ++Y A++  P G+ V V+P +L F +  +KL++ 
Sbjct  674  SIAVSNIKENETKKVTRMITNVAEEEATYTAIIKAPAGLEVQVIPNKLVFTNNSKKLSYE  733

Query  294  LSFKMAAPTQGYVFGSFSWRSKKNWVRSPLVV  199
            +SF+ ++  +G +FGS +W + K  VRSP VV
Sbjct  734  VSFRTSSKPKGDLFGSITWINGKYKVRSPFVV  765



>ref|XP_002524587.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37795.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=771

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 126/209 (60%), Gaps = 3/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L+K +HP+WSP+AIKSAIMTTA   + + +PI  +    +AN F +G+G +
Sbjct  562  CPHVSGIVGLLKILHPTWSPAAIKSAIMTTAMTRDNNREPI-LNATYSKANPFSYGAGHI  620

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P + ++PGLVYD    DY  FLC++GYNE  +   +     C   L + +  NYPSITV
Sbjct  621  RPNQAMEPGLVYDLTANDYLNFLCALGYNETQILSFSQAPYKCPNKLVNLANFNYPSITV  680

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSFK  283
            P      +VTR V NVG P S+YK  +  P GI+V+V P  L F+  G++  F  TL  K
Sbjct  681  PKFKGSITVTRRVKNVGSPSSTYKVSIRKPTGISVSVEPEILNFREIGEEKTFKVTLKGK  740

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                 + YVFG  +W    + VRSP+VV+
Sbjct  741  KFKARKEYVFGELTWSDSIHRVRSPIVVK  769



>ref|XP_003525747.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=749

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 125/210 (60%), Gaps = 6/210 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+ AL+K+ HP WSP+AIKSAIMT+A ++N  HK I  D     A+ F  GSG V
Sbjct  539  CPHLSGVAALLKSSHPHWSPAAIKSAIMTSADIINFEHKLI-VDETLYPADVFATGSGHV  597

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA-LNYPSIT  460
            NP+R  DPGLVYD QP DY  +LC +GY +  + +I     TC +T   P   LNYPS +
Sbjct  598  NPSRANDPGLVYDIQPDDYIPYLCGLGYGDTEVGIIAHKTITCSETSSIPEGELNYPSFS  657

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF--  286
            V  L    + TRTVTNVGE  SSY  +V  P G+ V V P  LTF    QK  +++SF  
Sbjct  658  V-VLGSPQTFTRTVTNVGEANSSYVVMVMAPEGVEVKVRPNNLTFSEANQKETYSVSFSR  716

Query  285  -KMAAPTQGYVFGSFSWRSKKNWVRSPLVV  199
             +    T  Y  G   W S K+ VRSP++V
Sbjct  717  IESGNETAEYAQGFLQWVSAKHTVRSPILV  746



>ref|NP_001131603.1| uncharacterized protein LOC100192953 [Zea mays]
 gb|ACF80089.1| unknown [Zea mays]
Length=351

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 130/226 (58%), Gaps = 18/226 (8%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV GI  L+KAVHP WSP+AIKSAIMTTA V +   KP+S +    RA  F +G+G V 
Sbjct  122  PHVAGIAGLLKAVHPDWSPAAIKSAIMTTARVQDNMRKPMS-NSSFLRATPFGYGAGHVQ  180

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLI---TGDN---STCDQTLQSPSALNY  472
            P R  DPGLVYDA   DY +FLC++GYN   +       GD      C   L+ P  LNY
Sbjct  181  PNRAADPGLVYDANTTDYLSFLCALGYNSSVIATFMAGAGDGHEVHACPARLR-PEDLNY  239

Query  471  PSITVPALI---HKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLN  301
            PS+ VP L       +VTR V NVG   ++Y A V  PRG+ V V PRRL F   G++  
Sbjct  240  PSVAVPHLSPTGGAHTVTRRVRNVGPGGATYDAKVHEPRGVAVDVRPRRLEFAAAGEEKQ  299

Query  300  FTLSFKMAA----PTQGYVFGSFSWRS--KKNWVRSPLVVRVAGSR  181
            FT++F+       P + YVFG   W     ++ VRSPLV RV  ++
Sbjct  300  FTVTFRAREGFFLPGE-YVFGRLVWSDGRGRHRVRSPLVARVVNTK  344



>ref|XP_006602868.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=802

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 131/210 (62%), Gaps = 4/210 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV GI  LIK +HP+WSP+AIKSAIMTTAT  +  ++PI    D + A+AF +GSG V
Sbjct  592  CPHVVGIAGLIKTLHPNWSPAAIKSAIMTTATTRDNTNRPIKDAFDNKVADAFAYGSGHV  651

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   +DPGLVYD   ADY  FLC+ GY+++ +  +  + +   +   S + LNYPSIT+
Sbjct  652  QPDLAIDPGLVYDLSLADYLNFLCASGYDQQLISALNFNGTFICKGSHSVTDLNYPSITL  711

Query  456  PAL-IHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            P L +   ++TRTVTNVG P ++Y A V  P G  + VVPR LTF   G+K  F +  + 
Sbjct  712  PNLGLKPVTITRTVTNVGPP-ATYTANVHSPAGYTIVVVPRSLTFTKIGEKKKFQVIVQA  770

Query  279  AAPT--QGYVFGSFSWRSKKNWVRSPLVVR  196
            ++ T  + Y FG   W   K+ VRSP+ V+
Sbjct  771  SSVTTRRKYQFGDLRWTDGKHIVRSPITVK  800



>emb|CDX94251.1| BnaC02g29110D [Brassica napus]
Length=761

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 133/213 (62%), Gaps = 10/213 (5%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
            AP ++G+VAL+KA+HP WSP+AI+SAI+TTA   +   + I A+   R+ A+ FD+G G 
Sbjct  542  APVISGVVALLKALHPDWSPAAIRSAIVTTAWRTDPFGEQIDAEGSSRKLADPFDYGGGL  601

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP + + PGLVYD    DY  ++C++GYN+ S+  + G+ +TC     S   LN PSIT
Sbjct  602  VNPEKAVKPGLVYDLGLQDYVLYMCAVGYNDSSISQLVGERTTCSNPRPSVLDLNLPSIT  661

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  + ++TRTVTNVG   S YK  V PP GI VTVVP++L F    +    TLS+++
Sbjct  662  IPDLKEEVTLTRTVTNVGPLNSVYKVKVEPPLGIQVTVVPKKLVFNSKTK----TLSYQV  717

Query  279  AAPTQ-----GYVFGSFSWRSKKNWVRSPLVVR  196
               T+     G+ FGS +W    + V  PL VR
Sbjct  718  RVSTRHKINTGFYFGSLTWSDSVHNVIIPLSVR  750



>emb|CDP06146.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 133/211 (63%), Gaps = 5/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L+K +HP WSP+AI+SAIMT+A   +   +PI  +    +A+ F +G+G +
Sbjct  561  CPHVSGIVGLLKTLHPDWSPAAIRSAIMTSARSRDNAFEPI-INASYVKASPFSYGAGHI  619

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R  DPGLVYD    DY  FLCS+GYNE  + L T     C + + S   LNYPSITV
Sbjct  620  WPNRAADPGLVYDLTANDYLTFLCSLGYNESQIALFTQVPKKCPKPI-SLLDLNYPSITV  678

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    +VTRT+ NVG P ++Y A +  P G++V + P+ LTF   G++ +F L+ ++ 
Sbjct  679  PKLRGSITVTRTLKNVGAP-ATYTAKIVSPPGVSVDIQPKSLTFARIGEEKSFKLTLQLK  737

Query  276  AP--TQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             P   + YVFG  +W   K++VRSP+VV+ +
Sbjct  738  KPGAARDYVFGRLAWSDGKHFVRSPIVVKAS  768



>ref|XP_010644656.1| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=768

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 129/209 (62%), Gaps = 5/209 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GIV L+K +HP WSP+AIKSAIMT+A   + + +P+  +    +A  F +G+G V
Sbjct  562  CPHISGIVGLLKTLHPDWSPAAIKSAIMTSARTRDDNMEPM-LNSSNLKATPFSYGAGHV  620

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD+   DY  FLC+IGYNE  L + +     C ++  S +  NYPSIT 
Sbjct  621  RPNRAMDPGLVYDSTVNDYLNFLCAIGYNETQLQIFSQKPYKCPKSF-SLTGFNYPSITA  679

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    +++RTV NVG P  +Y A V  P GI+V V P +L F+ YG++ +F L+ K  
Sbjct  680  PNLSGSVTISRTVKNVGTP-GTYTASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAK  738

Query  276  AP--TQGYVFGSFSWRSKKNWVRSPLVVR  196
                 + YVFG   W   +++VRS +VV+
Sbjct  739  GRRVAEDYVFGRLIWSDGQHYVRSSIVVK  767



>gb|EAZ25541.1| hypothetical protein OsJ_09366 [Oryza sativa Japonica Group]
Length=757

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 130/214 (61%), Gaps = 10/214 (5%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+GI ALI++ HPSWSP+ ++SAIMTTA V ++  KPI  D +G +A+A+  G+G VN
Sbjct  540  PHVSGIAALIRSAHPSWSPAMVRSAIMTTADVTDRQGKPI-MDGNGGKADAYAMGAGHVN  598

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPS--ALNYPSIT  460
            PAR +DPGLVYD  PADY   LC++GY    +  IT     C   L+  +  +LNYPSI+
Sbjct  599  PARAVDPGLVYDIDPADYVTHLCNLGYTHMEIFKITHAGVNCTAVLERNAGFSLNYPSIS  658

Query  459  VPALIHKFS--VTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF  286
            V    +  S  + RTVTNVG P S+Y A V  P G+ V V P  LTF  +G+K +F ++ 
Sbjct  659  VAFKTNTTSAVLQRTVTNVGTPNSTYTAQVAAPHGVRVRVSPATLTFSEFGEKKSFRVAV  718

Query  285  KMAAP-----TQGYVFGSFSWRSKKNWVRSPLVV  199
               +P      +GY+    S    K  VRSP+ V
Sbjct  719  AAPSPAPHDNAEGYLVWKQSGEQGKRRVRSPIAV  752



>ref|XP_010943376.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SDD1 
[Elaeis guineensis]
Length=762

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 131/211 (62%), Gaps = 6/211 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADP-DGRRANAFDFGSGFV  637
            PHV+GI A++K  HP WSP+AIKSAIMTTA V+++  KPI+ +  D + A+ F  G+G V
Sbjct  550  PHVSGIAAMLKKNHPDWSPAAIKSAIMTTAHVVDRDGKPITDESTDHKPASLFATGAGHV  609

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQ-SPSALNYPSIT  460
            NP+   DPGLVYD QP DY  ++C +G+ +  +  IT     C      +P  LNYPSI 
Sbjct  610  NPSAANDPGLVYDLQPEDYIPYICGLGFKDHVVQAITRAAVRCATVGSITPEELNYPSIA  669

Query  459  VP--ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF  286
            V   +   + ++TRTVTNVGEP   YKA +  P+G+ V V P RL F   GQKL F++ F
Sbjct  670  VSLNSTTPERNITRTVTNVGEPDEVYKAEIQEPQGVKVNVSPNRLQFSGPGQKLRFSVDF  729

Query  285  KMAAPTQ-GYV-FGSFSWRSKKNWVRSPLVV  199
             +A  +Q G V  G  SW S  + VRSP+ V
Sbjct  730  SIAGKSQKGKVSEGRLSWVSDNHTVRSPISV  760



>gb|AES80526.2| subtilisin-like serine protease [Medicago truncatula]
Length=801

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 132/211 (63%), Gaps = 7/211 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV G   LIK +HP+WSP+AIKSAIMTTAT  +  ++PI    +   ANAF +GSG +
Sbjct  577  CPHVVGTAGLIKTLHPNWSPAAIKSAIMTTATTRDNTNEPIEDAFENTTANAFAYGSGHI  636

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSL-HLITGDNSTCDQTLQSPSALNYPSIT  460
             P   +DPGLVYD    DY  FLC+ GYN++ +  LI     TC  T QS + LNYPSIT
Sbjct  637  QPNSAIDPGLVYDLGIKDYLNFLCAAGYNQKLISSLIFNMTFTCYGT-QSINDLNYPSIT  695

Query  459  VPAL-IHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            +P L ++  SVTRTVTNVG PRS+Y A    P G  + VVP  L FK  G+K  F ++ +
Sbjct  696  LPNLGLNAVSVTRTVTNVG-PRSTYTAKAQLP-GYKIVVVPSSLKFKKIGEKKTFKVTVQ  753

Query  282  MAAPT-QG-YVFGSFSWRSKKNWVRSPLVVR  196
              + T QG Y FG   W + K+ VRSP+ +R
Sbjct  754  ATSVTPQGKYEFGELQWSNGKHIVRSPITLR  784



>gb|KHN40540.1| Subtilisin-like protease [Glycine soja]
Length=796

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 132/210 (63%), Gaps = 4/210 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV GI  LIK +HP+WSP+AIKSAIMTTAT L+  ++PI    D + A+AF +GSG V
Sbjct  586  CPHVAGIAGLIKTLHPNWSPAAIKSAIMTTATTLDNTNRPIQDAFDDKLADAFAYGSGHV  645

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   +DPGLVYD    DY  FLC+ GY+++ +  +  + +   +   S + LNYPSIT+
Sbjct  646  QPELAIDPGLVYDLCLDDYLNFLCASGYDQQLISALNFNVTFICKGCDSVTDLNYPSITL  705

Query  456  PAL-IHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            P L +   ++TRTVTNVG P ++Y A V  P G  + VVPR LTF   G+K  F +  + 
Sbjct  706  PNLGLKPLTITRTVTNVGPP-ATYTANVNSPAGYTIVVVPRSLTFTKIGEKKKFQVIVQA  764

Query  279  AA-PTQG-YVFGSFSWRSKKNWVRSPLVVR  196
            ++  T+G Y FG   W   K+ VRSP+ V+
Sbjct  765  SSVTTRGKYEFGDLRWTDGKHIVRSPITVK  794



>ref|XP_010449086.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010449087.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=755

 Score =   174 bits (441),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 125/208 (60%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            P V+G+V L+KA+HP WSP+A+KSAIMT+A   +    PI A+   R+ A+ FD+G+G V
Sbjct  542  PVVSGLVVLLKALHPDWSPAALKSAIMTSAWKTDPSGDPIFAEGQPRKLADPFDYGAGLV  601

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            N  R  DPGLVYD    DY  F C+ GYNE ++ ++ G  + C   L S    NYP+IT+
Sbjct  602  NMERAKDPGLVYDMNVDDYIHFFCASGYNETAITILVGKPTRCSSPLPSILDFNYPAITI  661

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + ++TRTVTNVG   S Y+AVV PP G+ + V P  L F    +KL F +    +
Sbjct  662  PDLKEEVTITRTVTNVGPVDSVYRAVVEPPEGVKIVVEPEALVFDWNTKKLGFKVRVSSS  721

Query  276  APTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
              +  GY FGSF+W      V  PL VR
Sbjct  722  HKSNTGYFFGSFTWTDGTRNVTIPLSVR  749



>ref|XP_002967356.1| hypothetical protein SELMODRAFT_408319 [Selaginella moellendorffii]
 gb|EFJ31955.1| hypothetical protein SELMODRAFT_408319 [Selaginella moellendorffii]
Length=756

 Score =   174 bits (441),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 127/209 (61%), Gaps = 3/209 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV G++AL+KA HP WSP+AI+SA+ TTATV++     I  +    RA  F FGSG V+
Sbjct  548  PHVAGMIALLKAYHPEWSPAAIRSALSTTATVVDNKKNHILTNAL-ERATPFHFGSGHVD  606

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNS-TCDQTLQSPSALNYPSITV  457
            P     PGL+YD   +DY AFLC + Y+  ++ LITG     C    Q  SALN PSIT+
Sbjct  607  PNAAAHPGLIYDVSESDYIAFLCDM-YDSVAVALITGKQGIDCSTVAQPASALNLPSITL  665

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              L    +VTR VTNVG+  S+Y   +  P G++V+V P  L F   GQ L F ++F   
Sbjct  666  SNLTGVKTVTRFVTNVGDCVSTYWPKIEAPEGVSVSVEPSELAFTQAGQTLAFNVTFNAT  725

Query  276  APTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             P + YVFGS +W++ K+ VR PL V+ A
Sbjct  726  MPRKDYVFGSLTWKNYKHKVRIPLTVKAA  754



>gb|ACF80197.1| unknown [Zea mays]
Length=315

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 131/212 (62%), Gaps = 14/212 (7%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            PHV+GIVAL+K++HP WSP+A+KSA+MTTA   + +  PI AD +  + A+AFD+G+GFV
Sbjct  103  PHVSGIVALLKSLHPDWSPAALKSALMTTALTTDNNGIPIQADGNPVKIADAFDYGAGFV  162

Query  636  NPARVLDPGLVYDAQPADYKAFL-CSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            NP +  DPGL+YD QP+DY  F  C+ G          G N  C     S   LN PSI 
Sbjct  163  NPTKADDPGLIYDIQPSDYLRFFDCTGGL---------GTNDNCTAPRASVVDLNLPSIA  213

Query  459  VPALIHKFSVTRTVTNVG-EPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            +P+L    +VTRTVTNVG +  + Y+AV+ PP G+ ++V P  L F    +  +F ++FK
Sbjct  214  IPSLKAPQTVTRTVTNVGRQTNAVYRAVLQPPPGVEMSVEPSVLVFDAKRKAQSFKVAFK  273

Query  282  MAAPTQG-YVFGSFSWRS-KKNWVRSPLVVRV  193
                 QG Y FGS +W     +WVR P+ VR+
Sbjct  274  ATRRFQGDYTFGSLAWHDGGSHWVRIPVAVRI  305



>ref|NP_001063751.1| Os09g0530800 [Oryza sativa Japonica Group]
 dbj|BAF25665.1| Os09g0530800 [Oryza sativa Japonica Group]
 gb|EAZ45452.1| hypothetical protein OsJ_30103 [Oryza sativa Japonica Group]
Length=769

 Score =   174 bits (441),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 137/213 (64%), Gaps = 2/213 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKH-HKPISADPDGRRANAFDFGSGFV  637
            PH++G+VAL+K++HP+WSP+A+KSA++TTA V + +  + +S       AN FD+G G V
Sbjct  552  PHISGVVALLKSMHPNWSPAAVKSALVTTANVHDAYGFEMVSEAAPYNDANPFDYGGGHV  611

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP R   PGLVYD   +DY  FLCS+GYN  ++  +T   +TC  T +S   LN PSIT+
Sbjct  612  NPNRAAHPGLVYDMGVSDYMRFLCSMGYNTSAISSMTQQQTTCQHTPKSQLNLNVPSITI  671

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  K +V+RTVTNVG   S Y+A V  P G++VTV P  LTF    +KL F ++F+  
Sbjct  672  PELRGKLTVSRTVTNVGPALSKYRARVEAPPGVDVTVSPSLLTFNSTVRKLPFKVTFQAK  731

Query  276  APTQG-YVFGSFSWRSKKNWVRSPLVVRVAGSR  181
               +G Y FGS +W    + VR PLVVR+  S+
Sbjct  732  LKVKGRYTFGSLTWEDGTHTVRIPLVVRIIISK  764



>ref|XP_002298974.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
 gb|EEE83779.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
Length=749

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 129/209 (62%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
            APHV GI AL+KA+HP WSP+AIKSA++TTA   +    PI ++   ++ AN FDFG G 
Sbjct  530  APHVAGIGALLKAIHPDWSPAAIKSALVTTAWTNHPSGFPIFSEGSPQKLANPFDFGGGI  589

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
             NP    DPGLVYD   ADY  +LC++ YN  ++  +TG  + C     S   +N PSIT
Sbjct  590  ANPNGAADPGLVYDMGTADYINYLCAMDYNITAISRLTGLPTVCPYEELSILDVNLPSIT  649

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L +  ++TRTVTNVG   S Y+AV+ PP G +V+V P  L F H  +K+ FT++   
Sbjct  650  IPNLRNSTTLTRTVTNVGTSNSIYRAVIEPPFGTSVSVKPNVLAFNHKTKKITFTVTVTT  709

Query  279  AAPTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
            A     GY FGS +W    + VRSPL VR
Sbjct  710  AHQVNTGYFFGSITWTDGVHTVRSPLSVR  738



>ref|XP_006602865.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=805

 Score =   174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 132/210 (63%), Gaps = 4/210 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV GI  LIK +HP+WSP+AIKSAIMTTAT L+  ++PI    D + A+AF +GSG V
Sbjct  595  CPHVAGIAGLIKTLHPNWSPAAIKSAIMTTATTLDNTNRPIQDAFDDKVADAFAYGSGHV  654

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   +DPGLVYD    DY  FLC+ GY+++ +  +  + +   +   S + LNYPSIT+
Sbjct  655  QPELAIDPGLVYDLCLDDYLNFLCASGYDQQLISALNFNVTFICKGCDSVTDLNYPSITL  714

Query  456  PAL-IHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            P L +   ++TRTVTNVG P ++Y A V  P G  + VVPR LTF   G+K  F +  + 
Sbjct  715  PNLGLKPLTITRTVTNVGPP-ATYTANVNSPAGYTIVVVPRSLTFTKIGEKKKFQVIVQA  773

Query  279  AA-PTQG-YVFGSFSWRSKKNWVRSPLVVR  196
            ++  T+G Y FG   W   K+ VRSP+ V+
Sbjct  774  SSVTTRGKYEFGDLRWTDGKHIVRSPITVK  803



>gb|ABF93923.1| subtilase family protein, putative [Oryza sativa Japonica Group]
Length=783

 Score =   174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 130/214 (61%), Gaps = 10/214 (5%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+GI ALI++ HPSWSP+ ++SAIMTTA V ++  KPI  D +G +A+A+  G+G VN
Sbjct  566  PHVSGIAALIRSAHPSWSPAMVRSAIMTTADVTDRQGKPI-MDGNGGKADAYAMGAGHVN  624

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPS--ALNYPSIT  460
            PAR +DPGLVYD  PADY   LC++GY    +  IT     C   L+  +  +LNYPSI+
Sbjct  625  PARAVDPGLVYDIDPADYVTHLCNLGYTHMEIFKITHAGVNCTAVLERNAGFSLNYPSIS  684

Query  459  VPALIHKFS--VTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF  286
            V    +  S  + RTVTNVG P S+Y A V  P G+ V V P  LTF  +G+K +F ++ 
Sbjct  685  VAFKTNTTSAVLQRTVTNVGTPNSTYTAQVAAPHGVRVRVSPATLTFSEFGEKKSFRVAV  744

Query  285  KMAAP-----TQGYVFGSFSWRSKKNWVRSPLVV  199
               +P      +GY+    S    K  VRSP+ V
Sbjct  745  AAPSPAPHDNAEGYLVWKQSGEQGKRRVRSPIAV  778



>ref|XP_002509658.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51045.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=738

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 125/208 (60%), Gaps = 3/208 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH+TGI AL+K+ HP WSP+AIKSAIMTTA++ N   KPIS D D   A  FD G+G V
Sbjct  529  CPHLTGIAALLKSAHPDWSPAAIKSAIMTTASLDNLGGKPIS-DQDYVPATVFDMGAGHV  587

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA-LNYPSIT  460
            NP+R  DPGLVYD QP DY  +LC +GY+++ + +I      C      P A LNYPS +
Sbjct  588  NPSRANDPGLVYDIQPDDYIPYLCGLGYSDKHVRVIVQRKVKCTNVATIPEAQLNYPSFS  647

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +       + TRTVTN G+P S+Y   +F P+G++V V P+++TF    QK  ++ +F  
Sbjct  648  IKLGSSPQTYTRTVTNFGQPNSAYYLEIFAPKGVDVMVTPQKITFNGVNQKATYSATFSK  707

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVV  199
                 G +  G   W ++   V SP+ V
Sbjct  708  NGNANGLFAQGYLKWVAEGYSVGSPIAV  735



>emb|CBI39824.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 129/209 (62%), Gaps = 5/209 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GIV L+K +HP WSP+AIKSAIMT+A   + + +P+  +    +A  F +G+G V
Sbjct  597  CPHISGIVGLLKTLHPDWSPAAIKSAIMTSARTRDDNMEPM-LNSSNLKATPFSYGAGHV  655

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD+   DY  FLC+IGYNE  L + +     C ++  S +  NYPSIT 
Sbjct  656  RPNRAMDPGLVYDSTVNDYLNFLCAIGYNETQLQIFSQKPYKCPKSF-SLTGFNYPSITA  714

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    +++RTV NVG P  +Y A V  P GI+V V P +L F+ YG++ +F L+ K  
Sbjct  715  PNLSGSVTISRTVKNVGTP-GTYTASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAK  773

Query  276  AP--TQGYVFGSFSWRSKKNWVRSPLVVR  196
                 + YVFG   W   +++VRS +VV+
Sbjct  774  GRRVAEDYVFGRLIWSDGQHYVRSSIVVK  802



>ref|XP_003624308.1| Subtilisin-like serine protease [Medicago truncatula]
Length=816

 Score =   174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 132/211 (63%), Gaps = 7/211 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV G   LIK +HP+WSP+AIKSAIMTTAT  +  ++PI    +   ANAF +GSG +
Sbjct  592  CPHVVGTAGLIKTLHPNWSPAAIKSAIMTTATTRDNTNEPIEDAFENTTANAFAYGSGHI  651

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSL-HLITGDNSTCDQTLQSPSALNYPSIT  460
             P   +DPGLVYD    DY  FLC+ GYN++ +  LI     TC  T QS + LNYPSIT
Sbjct  652  QPNSAIDPGLVYDLGIKDYLNFLCAAGYNQKLISSLIFNMTFTCYGT-QSINDLNYPSIT  710

Query  459  VPAL-IHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            +P L ++  SVTRTVTNVG PRS+Y A    P G  + VVP  L FK  G+K  F ++ +
Sbjct  711  LPNLGLNAVSVTRTVTNVG-PRSTYTAKAQLP-GYKIVVVPSSLKFKKIGEKKTFKVTVQ  768

Query  282  MAAPT-QG-YVFGSFSWRSKKNWVRSPLVVR  196
              + T QG Y FG   W + K+ VRSP+ +R
Sbjct  769  ATSVTPQGKYEFGELQWSNGKHIVRSPITLR  799



>ref|XP_004964095.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=725

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 124/207 (60%), Gaps = 2/207 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
            APH++GI A+IK+ HP WSP+AIKSAIMTTA VL+ + KPI  D     A  F  G+G V
Sbjct  519  APHLSGIAAIIKSAHPDWSPAAIKSAIMTTAYVLDDNKKPI-LDEKLNPAGHFIIGAGHV  577

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQ-SPSALNYPSIT  460
            N ++ ++PGL+YD +   Y  +LC +GY E  + +IT     C +  + S + LNYPSI 
Sbjct  578  NSSQAINPGLIYDTEEEQYIPYLCGLGYTESEVEIITNHKGACGEGRKISEAELNYPSIA  637

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            V A   K  V RTVTNVG+  SSY   +  P+ +  +V PR+L F    +K  FT+S   
Sbjct  638  VAASTGKLVVNRTVTNVGDEISSYSVDIEMPKEVTASVSPRKLEFTKANEKKTFTVSLTW  697

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVV  199
             A    +  GS  W S K+ VRSP+V+
Sbjct  698  DATGTKHAEGSLRWVSDKHVVRSPIVI  724



>gb|KHN40543.1| Subtilisin-like protease [Glycine soja]
Length=721

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 132/209 (63%), Gaps = 4/209 (2%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV GI  LIK +HP+WSP+AIKSAIMTTAT  +  ++PI    D + A+AF +GSG V 
Sbjct  512  PHVVGIAGLIKTLHPNWSPAAIKSAIMTTATTRDNTNRPIKDAFDNKLADAFAYGSGHVQ  571

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            P   +DPGLVYD   ADY  FLC+ GY+++ +  +  + +   +   S + LNYPSIT+P
Sbjct  572  PDLAIDPGLVYDLSVADYLNFLCASGYDQQLISALNFNGTFICKGSHSVTDLNYPSITLP  631

Query  453  AL-IHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
             L +   ++TRTVTNVG P ++Y A +  P G  + VVPR LTF   G+K  F +  + +
Sbjct  632  NLGLKPVTITRTVTNVGPP-ATYTANIHSPAGYTIVVVPRSLTFTKIGEKKKFQVIVQAS  690

Query  276  A-PTQG-YVFGSFSWRSKKNWVRSPLVVR  196
            +  T+G Y FG   W   K+ VRSP+ V+
Sbjct  691  SVTTRGKYEFGDLRWTDGKHIVRSPITVK  719



>ref|XP_004515784.1| PREDICTED: subtilisin-like protease SDD1-like [Cicer arietinum]
Length=753

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 130/212 (61%), Gaps = 6/212 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH++GI AL+K+ HP WSP+AIKSAIMT+A  LN  +KPI  D   + AN    GSG VN
Sbjct  544  PHLSGIAALLKSSHPHWSPAAIKSAIMTSADTLNLRNKPI-VDEKLQPANLLATGSGHVN  602

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQ-SPSALNYPSITV  457
            P++  DPGLVYD QP DY  +LC +GY++  + +I      C +T   +   LNYPS +V
Sbjct  603  PSKANDPGLVYDIQPDDYIPYLCGLGYSDVEVGIIAHKTIKCSETSSIAEGELNYPSFSV  662

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK--  283
              L    + TRTVTNVGE  S+Y   V  P+G++V V P++L F    QK  ++++F   
Sbjct  663  -VLGSSQTFTRTVTNVGEAHSTYGVTVSAPKGVDVKVQPKKLIFSKANQKETYSVTFNRI  721

Query  282  -MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             +   T+ Y  G   W S K+ VRSP++V+ A
Sbjct  722  GLGNKTEEYAQGFLKWASAKHSVRSPILVKFA  753



>ref|XP_004967192.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=788

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 124/216 (57%), Gaps = 7/216 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+GI  LIK +HP WSP+AIKSAIMT+AT L+   KPI  +     A  F +G+G V 
Sbjct  575  PHVSGIAGLIKTLHPEWSPAAIKSAIMTSATDLDAERKPI-LNSSHVAATPFSYGAGHVF  633

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            P+R LDPGLVYD    DY  FLC++GYN  ++ +    +  C     S   LNYPSIT  
Sbjct  634  PSRALDPGLVYDMTIVDYLDFLCALGYNATAMEVFNKGSFVCPNAAMSLQDLNYPSITAH  693

Query  453  ALIHKFSVT---RTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
             L H  + T   R V NVG P +   AVV  P G+ V+V P  L F+  G++  F +SF 
Sbjct  694  GL-HAGTTTMVRRRVKNVGLPGTYTAAVVKEPEGVQVSVTPAMLVFREAGEEKEFDVSFT  752

Query  282  MAAP--TQGYVFGSFSWRSKKNWVRSPLVVRVAGSR  181
            +  P    GY FG+  W    + VRSPLVV++ G  
Sbjct  753  VRDPVTVTGYTFGAMVWSDGSHQVRSPLVVKIMGDE  788



>ref|XP_010647520.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=698

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 124/208 (60%), Gaps = 4/208 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+G V L+K +HP+WSPSAI+SAIMT AT  +   +PI+ D      N F++G+G +
Sbjct  486  CPHVSGAVGLLKKIHPNWSPSAIRSAIMTLATTRSNLRQPIANDTLAE-GNPFNYGAGHL  544

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P R +DPGLVYD    DY  FLCSIGYN   L         C      P  LNYPSITV
Sbjct  545  SPNRAMDPGLVYDLTITDYLNFLCSIGYNATQLSTFVDKKYECPSKPTRPWDLNYPSITV  604

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P+L  K +VTRT+ NVG P S+Y   +  P GI+V V P+RL F+   ++  F ++ +  
Sbjct  605  PSLSGKVTVTRTLKNVGTP-STYTVRIKAPSGISVKVEPKRLRFEKKNEEKMFKVTIEAK  663

Query  276  APTQG--YVFGSFSWRSKKNWVRSPLVV  199
                G  YVFG   W   K++V SP+VV
Sbjct  664  RDDGGGEYVFGRLIWSDGKHFVGSPIVV  691



>ref|XP_003571633.1| PREDICTED: subtilisin-like protease SBT5.3 [Brachypodium distachyon]
Length=775

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 128/212 (60%), Gaps = 4/212 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+G++ L+KA  P WSP+A++SAIMTTA   +    P+  D +G+ A AF +G+G V
Sbjct  566  CPHVSGVIGLLKAARPEWSPAAMRSAIMTTARTQDNTGAPMR-DSNGKEATAFAYGAGNV  624

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P R +DPGLVYD  P +Y  FLC++G+  + L  ++G   +C         LNYPSI V
Sbjct  625  HPNRAVDPGLVYDITPDEYFTFLCALGFTTKDLSRLSGGKFSCPAKPPPMEDLNYPSIVV  684

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            PAL H  ++TR + NVG P  +Y+A    P GIN+TV P+ L F+  G++  F ++    
Sbjct  685  PALRHNMTLTRRLKNVGRP-GTYRASWRAPFGINMTVDPKVLVFEKAGEEKEFKVNIASQ  743

Query  276  APT--QGYVFGSFSWRSKKNWVRSPLVVRVAG  187
                 +GYVFG   W    ++VRSP+VV   G
Sbjct  744  KDKLGRGYVFGKLVWSDGIHYVRSPVVVNALG  775



>ref|XP_003634152.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 126/208 (61%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPD-GRRANAFDFGSGFV  637
            PH+ GIVAL+K++HP WSP+AIKSAI+TT    +   +PI A+ D  + A+ FDFG G V
Sbjct  558  PHIAGIVALLKSLHPHWSPAAIKSAIVTTGWTTDPSGEPIFAEGDPTKLADPFDFGGGIV  617

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP R  DPGLVYD   ADY  +LC++GYN  ++   T  +  C     S   LN PSIT+
Sbjct  618  NPNRAADPGLVYDMGTADYIHYLCTLGYNNSAIFQFTEQSIRCPTREHSILDLNLPSITI  677

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF-KM  280
            P+L +  S+TR VTNVG   S+YKA +  P G  +TV P  L F    + + F+++   +
Sbjct  678  PSLQNSTSLTRNVTNVGAVNSTYKASIISPAGTTITVKPDTLIFDSTIKTVTFSVTVSSI  737

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                 GY FGS +W    + VRSP+ VR
Sbjct  738  QQVNTGYSFGSLTWIDGVHAVRSPISVR  765



>ref|XP_002985742.1| hypothetical protein SELMODRAFT_424716 [Selaginella moellendorffii]
 gb|EFJ13320.1| hypothetical protein SELMODRAFT_424716 [Selaginella moellendorffii]
Length=636

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 132/213 (62%), Gaps = 6/213 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+G +A +K++HP+WSP+AIKSA+MTTA   +  +K I      + A  FD G+G + 
Sbjct  424  PHVSGTIAYLKSIHPTWSPAAIKSAVMTTAITKDNTNKTIVDPSTNKAATVFDVGNGEIQ  483

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PA+ +DPGLVYD  P DY  +LC+ GY  + +  ITGD+S+      +  +LNYPSI V 
Sbjct  484  PAKAVDPGLVYDTDPLDYITYLCNSGYTSKQIQNITGDSSSKCPRNDTSFSLNYPSIAVL  543

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSF----  286
                  +V RTVTNVG PR++Y A V   +GI+++V P +L+F   GQKL+++++     
Sbjct  544  LDGSSKTVERTVTNVGNPRATYTASVGSAKGISISVTPSKLSFTSAGQKLSYSVTVSAKG  603

Query  285  KMAAPTQG--YVFGSFSWRSKKNWVRSPLVVRV  193
             +AA  Q   + F   +W    + VRSP+ VR+
Sbjct  604  SIAADPQARKWSFSDLTWEDGVHVVRSPIAVRM  636



>gb|KEH35216.1| subtilisin-like serine protease [Medicago truncatula]
Length=649

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 128/209 (61%), Gaps = 5/209 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GIV L+++++PSW+P+AIKSAIMTTAT L+   +PI  +    +A  F +G+G V
Sbjct  442  CPHISGIVGLLRSLYPSWTPAAIKSAIMTTATTLDNKAEPI-MNATKSQATPFSYGAGHV  500

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   +DPGLVYD    DY  FLC++GYNE  + L +     C +   S   LNYPSITV
Sbjct  501  QPNSAMDPGLVYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKNF-SILNLNYPSITV  559

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM-  280
            P L    +VTRT+ NVG P  +Y   V  P GI ++V P  L FK  G++  F +  K+ 
Sbjct  560  PNLSGSVTVTRTLKNVGAP-GTYIVHVQSPSGITISVKPNILEFKKVGEEKRFEVKLKVK  618

Query  279  -AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                T+ YVFG   W   K++V+SPLVV+
Sbjct  619  KGKATKSYVFGKMIWSDGKHYVKSPLVVK  647



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 133/209 (64%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGF  640
             PH++GIVAL+KA+HP+WSP+AIKSA++TTA++ +++ + I A+    ++A+ FD+G G 
Sbjct  518  CPHISGIVALLKAIHPTWSPAAIKSALVTTASLEDEYAQSIVAEGAPHKQADPFDYGGGH  577

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P + + PGL+YD + +DY  FLCS+GYN  ++ L+ G   TC ++ +    LN PSIT
Sbjct  578  VDPNKAISPGLIYDIESSDYIHFLCSMGYNNTAISLVAGTKITCQKSTKFIVNLNLPSIT  637

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +  L    +V+R VTNVG   S Y A V  P G++V V P  L+F    +KL F + F  
Sbjct  638  IHELKQSMTVSRRVTNVGPVNSVYFARVQAPAGVSVKVKPSVLSFNSTVKKLEFKVIFCS  697

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG + FG+  W    + VR PLVVR
Sbjct  698  LLRVQGRFTFGNLFWEDGLHVVRIPLVVR  726



>ref|XP_006449983.1| hypothetical protein CICLE_v10018000mg [Citrus clementina]
 gb|ESR63223.1| hypothetical protein CICLE_v10018000mg [Citrus clementina]
Length=760

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV G+V L+K  HP WSPSAI+SAIMTTA   +    P+  D   ++A  F +GSG +
Sbjct  545  CPHVAGVVGLLKTAHPDWSPSAIRSAIMTTARTRDNTANPMR-DGSFKKATPFSYGSGHI  603

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLCSIGYN+ ++    G    C ++       NYPSI+V
Sbjct  604  RPNRAMDPGLVYDLSEDDYLDFLCSIGYNQTTIKRFFGSQYECSKSANLED-FNYPSISV  662

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSFK  283
            P +    +++R + NVG P S+Y A V  P GI+V+V P+ LTFK  G++ +F  TL  K
Sbjct  663  PMISGSVTLSRKLKNVGSP-SNYAASVREPLGISVSVEPKILTFKKIGEEKSFKVTLKPK  721

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             +     Y FG  +W   K++VRSP+VV  A
Sbjct  722  WSGAPDNYRFGELTWTDGKHYVRSPIVVNQA  752



>gb|KEH35215.1| subtilisin-like serine protease [Medicago truncatula]
Length=634

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 128/209 (61%), Gaps = 5/209 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GIV L+++++PSW+P+AIKSAIMTTAT L+   +PI  +    +A  F +G+G V
Sbjct  427  CPHISGIVGLLRSLYPSWTPAAIKSAIMTTATTLDNKAEPI-MNATKSQATPFSYGAGHV  485

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   +DPGLVYD    DY  FLC++GYNE  + L +     C +   S   LNYPSITV
Sbjct  486  QPNSAMDPGLVYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKNF-SILNLNYPSITV  544

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM-  280
            P L    +VTRT+ NVG P  +Y   V  P GI ++V P  L FK  G++  F +  K+ 
Sbjct  545  PNLSGSVTVTRTLKNVGAP-GTYIVHVQSPSGITISVKPNILEFKKVGEEKRFEVKLKVK  603

Query  279  -AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                T+ YVFG   W   K++V+SPLVV+
Sbjct  604  KGKATKSYVFGKMIWSDGKHYVKSPLVVK  632



>gb|EEC68285.1| hypothetical protein OsI_36335 [Oryza sativa Indica Group]
Length=774

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 129/212 (61%), Gaps = 13/212 (6%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPD-GRRANAFDFGSGF  640
             PHV+GIVAL+K++HP WSP+A+KSAIMTTA + + +  P+ AD    + A+ FD+G+GF
Sbjct  562  CPHVSGIVALLKSLHPDWSPAALKSAIMTTAHITDNNGLPLVADATPNKIADPFDYGAGF  621

Query  639  VNPARVLDPGLVYDAQPADYKA-FLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSI  463
            VNP +  DPGL+YD  P+DY+  F C IG N          N +C     S   LN PSI
Sbjct  622  VNPTKASDPGLIYDIDPSDYQMLFNCMIGSNT---------NRSCTAIESSLFDLNLPSI  672

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
             +P L    +++RTVTNVG+P   YKA + PP G+++ V P+ L F    +   F ++FK
Sbjct  673  AIPNLKTSQTISRTVTNVGQPDVVYKAFLQPPAGVDMLVKPKMLVFDKNTRSQCFKVTFK  732

Query  282  MAAPTQG-YVFGSFSWR-SKKNWVRSPLVVRV  193
                 QG Y FGS +W     +WVR P+ +RV
Sbjct  733  ARQKFQGDYTFGSLAWHDGSSHWVRIPIAIRV  764



>gb|ACN36528.1| unknown [Zea mays]
Length=342

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 128/207 (62%), Gaps = 3/207 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH++GI A+IK++HPSWSP+AIKSAIMT++   +    PI  D   RRA+ +  G+G+VN
Sbjct  130  PHLSGIAAIIKSLHPSWSPAAIKSAIMTSSGTADHAGVPIK-DEQYRRASFYSMGAGYVN  188

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQ-SPSALNYPSITV  457
            P+R +DPGLVYD    +Y A+LC +G  +  +  ITG    C +    + + LNYPS+ V
Sbjct  189  PSRAVDPGLVYDLGAGEYIAYLCGLGIGDDGVKEITGRRVACAKLKAITEAELNYPSLVV  248

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK-M  280
              L H  +V RTVTNVG+  S YKAVV  PR ++V V P  L F    +K +FT++ +  
Sbjct  249  KLLSHPITVRRTVTNVGKANSVYKAVVDMPRAVSVVVRPPVLRFARANEKQSFTVTVRWN  308

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVV  199
              P      G+  W S ++ VRSP+V+
Sbjct  309  GPPAVAGAEGNLKWVSSEHVVRSPIVI  335



>ref|XP_002982819.1| hypothetical protein SELMODRAFT_179856 [Selaginella moellendorffii]
 gb|EFJ16064.1| hypothetical protein SELMODRAFT_179856 [Selaginella moellendorffii]
Length=765

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
            +PHV G+  L+K++H  WSP+AIKSAIMTTA   +   K I  D D   A  F++GSG +
Sbjct  542  SPHVAGLSTLLKSLHSDWSPAAIKSAIMTTAYTQDNTGKTI-LDGDYDVAGPFNYGSGHI  600

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP    DPGLVYDA   DY AFLC+IG++   +  +TG+   C  T    S LNYPS+T+
Sbjct  601  NPVAAADPGLVYDAGKQDYVAFLCNIGFSAGQIQAMTGEPGNCPATRGRGSDLNYPSVTL  660

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              L    +VTRT+T+V +  S+Y   + PP GI+VTV P  LTF   G++  FTL+F + 
Sbjct  661  TNLARGAAVTRTLTSVSDSPSTYSIGITPPSGISVTVNPTSLTFSKKGEQKTFTLNFVVN  720

Query  276  ---APTQGYVFGSFSWRSKKNWVRSPLVVR  196
                P Q YV+G + W    + VRSP+VV 
Sbjct  721  YDFLPRQ-YVYGEYVWYDNTHTVRSPIVVN  749



>ref|XP_010421966.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=762

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 125/208 (60%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            P + G+V L+KA+HP WSP+AIKSAI+TTA   +   +PI AD  GR+ A+ FD+G G V
Sbjct  544  PIIAGVVVLLKALHPDWSPAAIKSAIVTTAWKTDPSGEPIFADGSGRKLADPFDYGGGLV  603

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +   PGL+YD    DY  +LCS  YN+ S+  + G  + C     S   LN PSIT+
Sbjct  604  NPDKAARPGLIYDINTNDYVLYLCSTDYNDTSISQVVGKKTECPNPKPSVLDLNLPSITI  663

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  K ++TRTVTNVG P S YK ++ PP G+ +TV P  L F    +K++FT++    
Sbjct  664  PNLKDKVTLTRTVTNVGPPNSIYKVLINPPSGVRMTVKPNMLRFNPRTKKVSFTVTVSTT  723

Query  276  APTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
                 GY FGS +W    + V  P+ VR
Sbjct  724  HKVNTGYYFGSLTWTDNVHRVVIPVSVR  751



>ref|XP_004502100.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=772

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 129/209 (62%), Gaps = 5/209 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K +HPSWSP+AIKSAIMTTAT L+   +PI  +    +A  F +G+G V
Sbjct  565  CPHISGIAGLLKTLHPSWSPAAIKSAIMTTATTLDNEAEPI-LNATESQATPFSYGAGHV  623

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P + +DPGLVYD    DY  FLC++GY+E  + + +     C +   S   LNYPSITV
Sbjct  624  QPNKAMDPGLVYDTTVNDYLNFLCALGYDETQISVFSKAPHPCHKNF-SLINLNYPSITV  682

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM-  280
            P L    +VTRT+ NVG P ++Y A V  P GI V+V P  L FK+ G++  F +  K+ 
Sbjct  683  PNLSGSVTVTRTLKNVGSP-ATYIARVQNPNGITVSVKPNILEFKNVGEEKRFEIRLKVR  741

Query  279  -AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                 + YVFG   W   K++V+SP+VV+
Sbjct  742  KGKGKEKYVFGKLIWSDGKHYVKSPIVVK  770



>ref|XP_010107369.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC15620.1| Subtilisin-like protease [Morus notabilis]
Length=752

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 129/211 (61%), Gaps = 5/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L+K +HP WSP+AIKSAIMTTA   +   +P+  +    +A  F +G+G V
Sbjct  545  CPHVSGIVGLLKTLHPDWSPAAIKSAIMTTARTRDNQMEPL-LNSSNFKATPFSYGAGHV  603

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP   +DPGLVYD    DY  FLC++ YN   + + +     C + + S + LNYPSITV
Sbjct  604  NPNGAMDPGLVYDLSFNDYLNFLCALRYNATQIEMFSEKPYKCSKKI-SLTNLNYPSITV  662

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L    +VTRT+ NVG P  +Y+A V    GI+V+V P+ L FK  G++ +FTL+ K  
Sbjct  663  PKLSGSIAVTRTLKNVGTP-GTYRARVENQAGISVSVEPKSLKFKRVGEEKSFTLTLKAK  721

Query  276  AP--TQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             P   + Y FG   W    ++VRSP+VV+ A
Sbjct  722  NPKAAKDYAFGKLIWSDGTHYVRSPIVVKAA  752



>ref|XP_011012404.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=789

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 129/209 (62%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
             PHV+GIVALIK++HP+WSP+AI+SA++TTA+        I  +   R+ A+ FD G G 
Sbjct  574  CPHVSGIVALIKSLHPNWSPAAIRSALVTTASQTGTDGMKIFEEGSTRKEADPFDMGGGH  633

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP +   PGLVYD    +Y  +LCSIGY+  S+  +T     C +   +   LN PSIT
Sbjct  634  VNPEKAAYPGLVYDTTTEEYIQYLCSIGYSSSSITRLTNTKINCMKNTNTRLNLNLPSIT  693

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  K +VTR VTNVG   S YKA+V  P GI++ V P+ L+F    + L+F ++F  
Sbjct  694  IPNLKTKVTVTRKVTNVGNVNSVYKAIVQAPIGISLAVEPQTLSFNRINKILSFRVTFLS  753

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
            +   QG Y FGS  W   +++VRSP+ VR
Sbjct  754  SQKVQGEYRFGSLIWTDGEHFVRSPISVR  782



>ref|XP_010689355.1| PREDICTED: subtilisin-like protease SBT5.3 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 131/208 (63%), Gaps = 5/208 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GIV L+K ++P WSP+AIKSAIMTTA+V++  H+PI+ +    +AN F +G+G V
Sbjct  560  CPHISGIVGLLKTLYPHWSPAAIKSAIMTTASVIDNVHEPIT-NASNIQANPFHYGAGHV  618

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLC++GYNE+S+ L    +  C +   S   LNYPSITV
Sbjct  619  QPNRAVDPGLVYDMTTTDYLNFLCALGYNEKSIALFHAGHYLCPKNF-SILDLNYPSITV  677

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L +  +VTRTV NVG P   YKA V  PRGI++ V P  L F    Q+ +F L+ ++ 
Sbjct  678  PRLKNTITVTRTVKNVGSP-GKYKAHVQNPRGISIFVSPPILEFTTLCQEKSFHLTLEVV  736

Query  276  AP--TQGYVFGSFSWRSKKNWVRSPLVV  199
                ++ Y FG   W    + V SP+VV
Sbjct  737  KGKISKNYAFGRIIWSDGYHNVSSPIVV  764



>ref|XP_011081168.1| PREDICTED: subtilisin-like protease SDD1, partial [Sesamum indicum]
Length=740

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 127/210 (60%), Gaps = 4/210 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+ AL+K+ HP WSP+AIKSAIMTTA V+N  H PI  D + + A+ F  G+G V
Sbjct  532  CPHLSGVAALLKSAHPDWSPAAIKSAIMTTADVVNLAHNPIE-DQNLQPADVFATGAGHV  590

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSP-SALNYPSIT  460
            NP+R  DPGLVYD QP DY  +LC + Y +R + +IT     C +    P S LNYPS +
Sbjct  591  NPSRANDPGLVYDIQPNDYIPYLCGLEYTDREVGIITQQKVNCSKISWIPESQLNYPSFS  650

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            V       + TRTVTNVGE  SSY   + PP G++V V P +L F    QK  + ++F  
Sbjct  651  VLFGSRVQTYTRTVTNVGEANSSYVVEISPPPGVHVAVKPEKLEFMEQKQKATYEVTFSR  710

Query  279  --AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
              +A    +  G   W S+K +VRSP+ ++
Sbjct  711  LPSAGNSNFSQGFLMWTSEKCFVRSPISIK  740



>ref|XP_011038012.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 129/209 (62%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
             PHV+GIVALIK++HP+WSP+AI+SA++TTA+        I  +   R+ A+ FD G G 
Sbjct  563  CPHVSGIVALIKSLHPNWSPAAIRSALVTTASQTGTDGMKIFEEGSTRKEADPFDMGGGH  622

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP +   PGLVYD    +Y  +LCSIGY+  S+  +T     C +   +   LN PSIT
Sbjct  623  VNPEKAAYPGLVYDTTTEEYIQYLCSIGYSSSSITRLTNTKINCMKNTNTRLNLNLPSIT  682

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +P L  K +VTR VTNVG   S YKA+V  P GI++ V P+ L+F    + L+F ++F  
Sbjct  683  IPNLKTKVTVTRKVTNVGNVNSVYKAIVQAPIGISLAVEPQTLSFNRINKILSFRVTFLS  742

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
            +   QG Y FGS  W   +++VRSP+ VR
Sbjct  743  SQKVQGEYRFGSLIWTDGEHFVRSPISVR  771



>dbj|BAK07347.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=797

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 124/216 (57%), Gaps = 11/216 (5%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV GI  L+K +HP WSP+AIKSAIMTTAT L+   +PI  +P  + A  F +GSG V 
Sbjct  579  PHVAGIAGLVKTLHPDWSPAAIKSAIMTTATDLDVEQRPI-LNPFLQPATPFSYGSGHVF  637

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PAR LDPGLVYDA  ADY  F C++GYN  ++         C     +   LNYPSIT+P
Sbjct  638  PARALDPGLVYDASYADYLNFFCALGYNATAMAKFNETRYACPAAAVAVRDLNYPSITLP  697

Query  453  ALIHKFSVTRTVTNVGEPRSSY-KAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
             L    +V R V NVG PRS+Y  AVV  P G+ VTV P  L F   G++  F +SF   
Sbjct  698  DLAGLTTVRRRVRNVGPPRSTYTAAVVREPEGVQVTVTPTTLAFGAVGEEKEFQVSFVAR  757

Query  276  AP-------TQGYVFGSFSWRS--KKNWVRSPLVVR  196
             P         GY FG+  W      + VR+PLV+R
Sbjct  758  VPFVPPPKGAGGYGFGAIVWSDGPGNHRVRTPLVIR  793



>gb|AFW61874.1| putative subtilase family protein [Zea mays]
Length=802

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 134/224 (60%), Gaps = 17/224 (8%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+G+ AL+KA HPSWSP+AIKSA+MTTA V +  +  ++ +  G  A AFD G+G V+
Sbjct  574  PHVSGLAALLKAAHPSWSPAAIKSALMTTAYVRDNSNGTVADESTGAAAGAFDLGAGHVD  633

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA--LNYPSIT  460
            P R +DPGLVYD  P+DY +FLC++ Y ER++  +T   + C    ++  A  LNYPS++
Sbjct  634  PMRAMDPGLVYDIGPSDYVSFLCNLNYTERNIRAVTRRPADCRGARRAGHAGNLNYPSLS  693

Query  459  V---------PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQK  307
                       A   +    RTVTNVG   + Y+A V  P G NVTV PRRL F+  GQ+
Sbjct  694  ATFVAAGAAAAAAASRTHFIRTVTNVGGGSAVYRASVTAPEGCNVTVQPRRLAFRRDGQR  753

Query  306  LNFTLSFKMA-----APTQGYV-FGSFSWRSKKNWVRSPLVVRV  193
            L+F +  + A      P    V  G+ +W   ++ VRSP+VV V
Sbjct  754  LSFAVRVEAALGGRMEPGSSLVRSGALTWSDGRHVVRSPIVVTV  797



>ref|XP_012078498.1| PREDICTED: subtilisin-like protease SBT5.4 [Jatropha curcas]
 gb|KDP32632.1| hypothetical protein JCGZ_13182 [Jatropha curcas]
Length=769

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 128/210 (61%), Gaps = 4/210 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L+K +HP WSP+AI+SA+MTTA     + +PI      + A  FD+G+G V
Sbjct  560  CPHVSGIVGLLKTLHPDWSPAAIRSALMTTARTRGNNMEPIIDSSTNKEATPFDYGAGHV  619

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP + +DPGL+YD    DY  FLC+ GYN+  + L +    +C ++ +  +  NYPSIT+
Sbjct  620  NPNKAMDPGLIYDLTENDYLNFLCAKGYNKTQIRLFSSKPYSCPKSFKI-ADFNYPSITI  678

Query  456  PALIHKFS-VTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK-  283
            P+LI     VTR V NVG   S Y A V  P G++V V P+ L F+  G++  F ++ K 
Sbjct  679  PSLISLGGPVTRRVKNVGSGPSKYCANVKAPHGVSVLVEPKCLEFEKTGEEKIFKVALKS  738

Query  282  -MAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
             +    + YVFG   W   K++VRSP+VVR
Sbjct  739  LVKNEVKDYVFGKLIWSDGKHYVRSPIVVR  768



>ref|XP_002275429.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=740

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 6/211 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH++GI AL+K+ HP WSP+AIKSAIMTTA VLN    PI  D     A+ F  G+G VN
Sbjct  529  PHLSGIAALLKSSHPEWSPAAIKSAIMTTADVLNLKGDPI-LDETHEPADVFAVGAGHVN  587

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA-LNYPSITV  457
            P+R  DPGL+YD QP DY  +LC +GYN+  +  I      C +    P A LNYPS +V
Sbjct  588  PSRANDPGLIYDIQPNDYIPYLCGLGYNDTQVRAIIRHKVQCSKESSIPEAQLNYPSFSV  647

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM-  280
                    + RTVTNVGE ++SY   +  P+G++V+V PR+L F    QK  +T++F+  
Sbjct  648  AMGSSALKLQRTVTNVGEAKASYIVKISAPQGVDVSVKPRKLDFTQTNQKKTYTVTFERK  707

Query  279  ---AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                  ++ +  G   W S K+ VRSP+ V+
Sbjct  708  DDGKTGSKPFAQGFLEWVSAKHSVRSPISVK  738



>ref|XP_002986601.1| hypothetical protein SELMODRAFT_425502 [Selaginella moellendorffii]
 gb|EFJ12458.1| hypothetical protein SELMODRAFT_425502 [Selaginella moellendorffii]
Length=581

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 137/218 (63%), Gaps = 10/218 (5%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH TG  A +K++HPSWSP+AIKSAIMTTA  L+   KPI+ + DG   ++F  G+G +
Sbjct  365  CPHATGTAAFVKSIHPSWSPAAIKSAIMTTARYLDNTGKPIT-ESDGSPGDSFSIGAGVI  423

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNST-CDQTLQSPSALNYPSIT  460
             P + +DPGLVY+    DY  +LCSIGY+ + +  ITGD +T C     +P++LNYPSI 
Sbjct  424  QPMKAIDPGLVYETAILDYILYLCSIGYSSKQVQNITGDTATSCPDGTSTPASLNYPSIG  483

Query  459  VP-ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRG--INVTVVPRRLTFKHYGQKLNFTLS  289
               +++   ++ RTVTNVG+  S YKA V  P    +++TV P+ L F + G+KL+F ++
Sbjct  484  FNISVVKSATIPRTVTNVGDASSIYKARVEAPSDLRLSITVSPQELKFLNQGEKLSFNVT  543

Query  288  FKMAAPTQ-----GYVFGSFSWRSKKNWVRSPLVVRVA  190
              +++  +      + F S +W   K+ VRSP+ V ++
Sbjct  544  ISLSSSKEPIASNPWAFSSLTWDDGKHSVRSPIAVAIS  581



>gb|KCW88587.1| hypothetical protein EUGRSUZ_A00964 [Eucalyptus grandis]
Length=421

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 124/209 (59%), Gaps = 5/209 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+G+  L+K +HP WSP+AI+SAIMT+AT+L+   + I  +    +A  F +G+G +
Sbjct  213  CPHVSGVAGLLKTLHPEWSPAAIRSAIMTSATILDNAMESI-MNNSFYKATPFSYGAGHI  271

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLCS+GYN   +  +T     C + +      NYPSITV
Sbjct  272  QPNRAMDPGLVYDLGIIDYLNFLCSLGYNAMQISNVTDGAYDCSKRIGLLD-FNYPSITV  330

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSFK  283
            P L    +VTRTV NVG P  +Y+A +  P G+ V V P  L FK  G++ +F   L  K
Sbjct  331  PKLSRSITVTRTVKNVGFP-GTYRASILEPNGVLVLVKPAYLKFKKIGEEKSFKVMLKVK  389

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
             A  T+ Y FG   W   ++ VRSP+VV+
Sbjct  390  GAGATEDYSFGELIWSDTEHHVRSPIVVK  418



>ref|XP_010092450.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB51216.1| Subtilisin-like protease [Morus notabilis]
Length=328

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 132/214 (62%), Gaps = 7/214 (3%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
             PHV+GIVALIK+VH  WSPSAIKSA++TT + +      I  +   R+ A  FD G G 
Sbjct  107  CPHVSGIVALIKSVHKDWSPSAIKSALVTTGSQVGTDGSNIYVEGLNRKLAYPFDMGGGL  166

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA--LNYPS  466
            VNP + LDPGL+Y+    DY  FL SIG+ + S+ ++T + S  +   +  SA  LN PS
Sbjct  167  VNPEKALDPGLIYNVTIEDYCQFLASIGFLDASISVLT-NVSINNSNRKGFSALDLNLPS  225

Query  465  ITVPALIH--KFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTL  292
            ITVP L +  K  VTRTVTN+G+  S YKAV+  P GI +T+ P+ L F    + L+F +
Sbjct  226  ITVPNLRNGEKVIVTRTVTNIGDVNSVYKAVIEAPPGIKITIEPQILRFNSTIKSLSFKV  285

Query  291  SFKMAAPTQGYV-FGSFSWRSKKNWVRSPLVVRV  193
            SF       GY  FGS +W   K+ VRSP+VVRV
Sbjct  286  SFFSNQKLHGYYKFGSLTWSDDKHLVRSPIVVRV  319



>ref|XP_011044970.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=727

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 125/209 (60%), Gaps = 1/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+ + A++K+  PSWSP+AIKSAIMTTA V++   K I  DPD  +A  FD+GSG +
Sbjct  516  CPHVSAVAAILKSYRPSWSPAAIKSAIMTTAIVMDNTRKLIGRDPDDTQATPFDYGSGHI  575

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP   L+PGLVYD    D   FLCS G +   L  +TG  + C +  + P   NYPSI V
Sbjct  576  NPLAALNPGLVYDFDSDDVINFLCSTGASPAQLKNLTGQPTYCPKQTKPPYDFNYPSIGV  635

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              +    SV RTVT  G+ R++Y A V  P G+ VTV P  L F    +KL+F + FK  
Sbjct  636  SNMNGSISVYRTVTYYGKGRTAYVAKVDYPSGVQVTVTPATLKFTKTAEKLSFKIDFKPL  695

Query  276  APTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
              + G +VFG+ +W +  + VRSP+ + V
Sbjct  696  KTSDGNFVFGALTWSNGIHKVRSPIALNV  724



>ref|NP_001132028.1| uncharacterized protein LOC100193436 [Zea mays]
 gb|ACF80704.1| unknown [Zea mays]
Length=283

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 132/210 (63%), Gaps = 6/210 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH++GI A+IK++HPSWSP+A+KSAIMT++   +    PI  D   RRA+ +  G+G+VN
Sbjct  68   PHLSGIAAVIKSLHPSWSPAAVKSAIMTSSDAADHAGVPIK-DEQYRRASFYSMGAGYVN  126

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC-DQTLQ--SPSALNYPSI  463
            P+R +DPGLVYD    DY A+LC +G  +  +  ITG    C  + L+  + + LNYPS+
Sbjct  127  PSRAVDPGLVYDLGAGDYVAYLCGLGIGDGGVKEITGRRVACGGKRLKAITEAELNYPSL  186

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVV-FPPRGINVTVVPRRLTFKHYGQKLNFTLSF  286
             V  L    +V RTVTNVG+  S Y+AVV  P R ++V V P  L F    +K +FT++ 
Sbjct  187  VVKLLSRPVTVRRTVTNVGKASSVYRAVVDMPSRAVSVVVRPPTLRFDRVNEKRSFTVTV  246

Query  285  KMAA-PTQGYVFGSFSWRSKKNWVRSPLVV  199
            + +  P  G V G+  W S+ + VRSP+V+
Sbjct  247  RWSGPPAVGGVEGNLKWVSRDHVVRSPIVI  276



>gb|KEH29866.1| subtilisin-like serine protease [Medicago truncatula]
Length=657

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 124/209 (59%), Gaps = 1/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++ +  +IK+ HP+WSP+AI SAIMTTATV++  +  I  DP+G +   FD+GSG V
Sbjct  446  CPHISAVATIIKSYHPTWSPAAIMSAIMTTATVMDNTNHLIGRDPNGTQTTPFDYGSGHV  505

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP   L+PGLVYD    D   FLCS G +   L  ITG+ + C +T       NYPSI V
Sbjct  506  NPLASLNPGLVYDFSSQDALDFLCSTGASPSQLKNITGELTQCQKTPTPSYNFNYPSIGV  565

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              L    SV RTVT  G+  + Y A V  P G+NVTV P  L F   G+KL F + F   
Sbjct  566  SNLNGSLSVYRTVTFYGQEPAVYVASVESPFGVNVTVTPVALKFWKTGEKLTFRVDFNPF  625

Query  276  APTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
              + G +VFG+ +W++ K  VRSP+ V V
Sbjct  626  VNSNGNFVFGALTWKNGKQRVRSPIGVNV  654



>ref|XP_003601486.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES71737.1| subtilisin-like serine protease [Medicago truncatula]
Length=772

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 128/209 (61%), Gaps = 5/209 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GIV L+++++PSW+P+AIKSAIMTTAT L+   +PI  +    +A  F +G+G V
Sbjct  565  CPHISGIVGLLRSLYPSWTPAAIKSAIMTTATTLDNKAEPI-MNATKSQATPFSYGAGHV  623

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   +DPGLVYD    DY  FLC++GYNE  + L +     C +   S   LNYPSITV
Sbjct  624  QPNSAMDPGLVYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKNF-SILNLNYPSITV  682

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM-  280
            P L    +VTRT+ NVG P  +Y   V  P GI ++V P  L FK  G++  F +  K+ 
Sbjct  683  PNLSGSVTVTRTLKNVGAP-GTYIVHVQSPSGITISVKPNILEFKKVGEEKRFEVKLKVK  741

Query  279  -AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                T+ YVFG   W   K++V+SPLVV+
Sbjct  742  KGKATKSYVFGKMIWSDGKHYVKSPLVVK  770



>gb|KJB22186.1| hypothetical protein B456_004G034100 [Gossypium raimondii]
Length=772

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L+K++HP WSP+AI+SAIMTTA + +    P+  D   +RA  F +GSG V
Sbjct  563  CPHVSGIVGLLKSLHPDWSPAAIRSAIMTTARIQDDTGNPM-LDSSNKRATPFAYGSGHV  621

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
               R +DPGLVYD    DY  FLC+ GYN+  L L +     C ++      LNYPSI+V
Sbjct  622  RLNRAMDPGLVYDITVNDYFNFLCARGYNQSLLSLFSDKPYACPKSYGVMD-LNYPSISV  680

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM-  280
              L    +V+RTV NVG  RS+YKA V  P G+ V+V P  L F+  G++  F + F++ 
Sbjct  681  SQLNGSMTVSRTVKNVGSARSTYKARVRSPAGVTVSVKPSTLKFEKIGEEKKFEVKFELN  740

Query  279  --AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
               A ++ YVFG   W    + VRSP+VV+
Sbjct  741  KSNAKSEDYVFGELLWSDGSHHVRSPIVVK  770



>ref|XP_002465976.1| hypothetical protein SORBIDRAFT_01g049280 [Sorghum bicolor]
 gb|EER92974.1| hypothetical protein SORBIDRAFT_01g049280 [Sorghum bicolor]
Length=755

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 130/207 (63%), Gaps = 3/207 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH++GI A+IK++HPSWSP+AIKSAIMT++   +    PI  D   RRA+ +  G+G+VN
Sbjct  543  PHLSGIAAIIKSLHPSWSPAAIKSAIMTSSNTADHTGVPIK-DEQYRRASFYGMGAGYVN  601

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQ-SPSALNYPSITV  457
            P+R +DPGLVYD    +Y A+LC +G  +  +  ITG    C +    + + LNYPS+ V
Sbjct  602  PSRAVDPGLVYDLSAGEYVAYLCGLGLGDDGVKEITGRRIACAKLKAITEAELNYPSLVV  661

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK-M  280
              L H  +V RTVTNVG+  S YKAVV  P+G++V V P  L F    +K +FT++ +  
Sbjct  662  KLLSHPITVRRTVTNVGKANSVYKAVVDMPKGVSVVVRPPMLRFTKVNEKQSFTVTVRWN  721

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVV  199
              P  G   G+  W S ++ VRSP+V+
Sbjct  722  GPPAVGGAEGNLKWVSSEHEVRSPIVI  748



>gb|AES88343.2| subtilisin-like serine protease [Medicago truncatula]
Length=734

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 124/209 (59%), Gaps = 1/209 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++ +  +IK+ HP+WSP+AI SAIMTTATV++  +  I  DP+G +   FD+GSG V
Sbjct  523  CPHISAVATIIKSYHPTWSPAAIMSAIMTTATVMDNTNHLIGRDPNGTQTTPFDYGSGHV  582

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP   L+PGLVYD    D   FLCS G +   L  ITG+ + C +T       NYPSI V
Sbjct  583  NPLASLNPGLVYDFSSQDALDFLCSTGASPSQLKNITGELTQCQKTPTPSYNFNYPSIGV  642

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              L    SV RTVT  G+  + Y A V  P G+NVTV P  L F   G+KL F + F   
Sbjct  643  SNLNGSLSVYRTVTFYGQEPAVYVASVESPFGVNVTVTPVALKFWKTGEKLTFRVDFNPF  702

Query  276  APTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
              + G +VFG+ +W++ K  VRSP+ V V
Sbjct  703  VNSNGNFVFGALTWKNGKQRVRSPIGVNV  731



>ref|XP_011626021.1| PREDICTED: subtilisin-like protease SBT5.3 [Amborella trichopoda]
Length=759

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 116/208 (56%), Gaps = 1/208 (0%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+G  AL+KA HPSWS  A+KSA+MTT TVL+     I  DP G   + FD GSG +
Sbjct  547  CPHVSGAAALVKANHPSWSAMAVKSALMTTGTVLDNTKGSILRDPQGSSTSPFDLGSGHL  606

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP   +DPGLVYD    D   FLC  G     L  +TG+   C   L     LNYPSI V
Sbjct  607  NPLAAIDPGLVYDFDTKDIITFLCGSGATPEQLQNLTGEAICCKIGLVEAYNLNYPSIGV  666

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              L  + SV RTVTN G  RS+Y   V  P G+ +++ P +L F H G+K  F +   + 
Sbjct  667  ANLRGRVSVYRTVTNYGTSRSTYLPSVELPWGVQISIAPSKLKFSHIGEKQTFRVDLTVK  726

Query  276  APTQG-YVFGSFSWRSKKNWVRSPLVVR  196
             P+ G +VFGS +W   K  V +P+ V 
Sbjct  727  KPSNGSFVFGSITWSDGKYQVFTPIAVN  754



>ref|XP_011040610.1| PREDICTED: subtilisin-like protease SBT3.3 [Populus euphratica]
Length=770

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 132/210 (63%), Gaps = 6/210 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            PHV+GIVAL+KAVHP WSP+AIKS+I+TTA   N    PI A+   ++ A+ FD+G G V
Sbjct  555  PHVSGIVALLKAVHPDWSPAAIKSSIVTTAWRNNPSGFPIFAEGSPQKLADTFDYGGGIV  614

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSAL--NYPSI  463
            NP     PGLVYD    DY  +LC++ YN  ++  +TG+ + C   ++ PS L  N PSI
Sbjct  615  NPNSAAYPGLVYDMGTEDYINYLCAMNYNNTAISRLTGNLTVC--PIEEPSILNINLPSI  672

Query  462  TVPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK  283
            T+P L +  ++TRTVTNVG   S Y+ ++ PP G +V+V P  L F H  +K+ FT++  
Sbjct  673  TIPNLRNSITLTRTVTNVGASNSIYRVMIEPPFGTSVSVKPNVLVFNHKTKKITFTVTVT  732

Query  282  MAAPTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
             A      Y FGS +W   ++ VRSPL VR
Sbjct  733  TAHQVNTEYSFGSLTWTDGEHKVRSPLSVR  762



>ref|XP_011088876.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=726

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 125/208 (60%), Gaps = 1/208 (0%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV+ I A++K+ HPSWSP+AIKSAIMTTAT+ +     I   P+G + + FD+GSG +N
Sbjct  516  PHVSAIAAIVKSSHPSWSPAAIKSAIMTTATIHDNTKNFIRRHPNGTQTSPFDYGSGHIN  575

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITVP  454
            PA  +DPGLVYD   +D   FLCS G     L  +TG+   C +  +S    NYPSI V 
Sbjct  576  PAAAIDPGLVYDFDTSDIIDFLCSTGATPAQLKNLTGEVMYCRKNPKSSYDFNYPSIGVS  635

Query  453  ALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMAA  274
             L    SV RTVT  GE  + YKA V  P G+NV++ P  L F+  G K++F + F    
Sbjct  636  NLRGSISVHRTVTYYGEGPAVYKAEVDHPAGVNVSITPNELRFEKNGDKMSFVIGFTPYK  695

Query  273  PTQG-YVFGSFSWRSKKNWVRSPLVVRV  193
             + G +VFG+ +W    + VRSP+ + +
Sbjct  696  ASNGEFVFGALTWTDGIHVVRSPIGLNI  723



>ref|XP_002991849.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
 gb|EFJ07111.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
Length=753

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 130/227 (57%), Gaps = 21/227 (9%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV G+VAL+KA HPSWSP+A+KSAIMTTA   +    PI   P G+ ANAFD+GSG VN
Sbjct  526  PHVAGVVALLKAAHPSWSPAALKSAIMTTALTEDNTRSPILTLPHGKVANAFDYGSGHVN  585

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC--DQTLQSP-SALNYPSI  463
            P R  +PGLVYDA P ++ A+LCS GY+ + L  +TGD S C   Q+ + P S LNYP+I
Sbjct  586  PRRAANPGLVYDAGPGEFMAYLCSSGYDTKLLQKVTGDKSICPSSQSARRPISNLNYPAI  645

Query  462  TVPALIHKFSVT-RTVTNVG----EPRSSY------------KAVVFPPRGINVTVVPRR  334
             V  L    + T  +VT VG       S Y            KA V  P GI V VVP  
Sbjct  646  VVSRLGGGVAATAASVTYVGASPARKNSDYSASTAVTTPTVFKASVVAPPGIRVRVVPDE  705

Query  333  LTFKHYGQKLNFTLSFKMAAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
            L F  Y ++  F +       T G +VFG  +W + +  VRSPL V+
Sbjct  706  LRFSSYMERRAFNVELTSVDHTNGRFVFGWLTWSNGRQRVRSPLAVK  752



>ref|XP_009408716.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 122/208 (59%), Gaps = 4/208 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++G+  L+K +HP WSP+ I+SA+MTTA   +    P+  D +  +A  FD+G+G V
Sbjct  558  CPHISGVAGLLKKLHPRWSPAVIRSAVMTTARTRDNTRTPMK-DDNREKAIPFDYGAGHV  616

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P R +DPGLVYD    DY  FLCS GYN  ++    G    C         LNYPSITV
Sbjct  617  RPNRAMDPGLVYDITFTDYVHFLCSRGYNASNMAQFIGKRFACPSKTMRAEDLNYPSITV  676

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L   F+V+RTV NVG P  +Y   +  P GI+V+V P+ L F   G++  F +  +  
Sbjct  677  PNLQKSFTVSRTVRNVGTP-GTYNVRIKAPFGIHVSVKPQTLEFAKVGEEKTFQVRLRSR  735

Query  276  APT--QGYVFGSFSWRSKKNWVRSPLVV  199
            + +   GYVFG  +W   K++VRSPLVV
Sbjct  736  SESVGVGYVFGGLTWTDGKHYVRSPLVV  763



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 127/209 (61%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGF  640
            AP ++G+VAL+KA+HP WSP+AIKSAI+TTA   +   + I A+   R+ A+ FD+G G 
Sbjct  555  APVISGVVALLKAMHPDWSPAAIKSAIVTTAWRTDPFGEQIFAEGSSRKVADPFDYGGGL  614

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            VNP +  DPGL+YD  P DY  +LCS GYN+ S+  + G  + C     S   +N PS+T
Sbjct  615  VNPEKAADPGLIYDMGPKDYILYLCSAGYNDSSISQLVGQVTVCSNPKPSVLDVNLPSLT  674

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK-  283
            +P L  + ++TRTVTNVG   S YK VV PP G+ V V P++L F    + L+F +    
Sbjct  675  IPNLKEEVNLTRTVTNVGPVNSVYKVVVEPPLGVRVVVTPKKLVFNSKTKSLSFMVRVST  734

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
            +     G+ FGS  WR   + V  P+ VR
Sbjct  735  IHKINTGFYFGSLIWRDSVHNVTIPVSVR  763



>ref|XP_008236858.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=771

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 133/209 (64%), Gaps = 2/209 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPD-GRRANAFDFGSGF  640
             PH++GIVAL+KA+HP+WSP+AIKSA++TTA++ +++ + I A+    ++A+ FD+G G 
Sbjct  553  CPHISGIVALLKAIHPTWSPAAIKSALVTTASLGDEYAQSIVAEGAPHKQADPFDYGGGH  612

Query  639  VNPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSIT  460
            V+P + + PGL+YD + +DY  FLCS+GYN  ++ L+ G   TC ++ +    LN PSIT
Sbjct  613  VDPNKAISPGLIYDIESSDYIRFLCSMGYNNTAISLMAGTKITCQKSTKFIVNLNLPSIT  672

Query  459  VPALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKM  280
            +  L    +V+R VTNVG   S Y A V  P G++V V P  L+F    +KL F + F  
Sbjct  673  IHELKQNMTVSRRVTNVGPVNSVYFARVQAPAGVSVKVKPSVLSFNSTVKKLEFKVIFCS  732

Query  279  AAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
                QG + FG+  W    + VR PLVVR
Sbjct  733  LLRVQGRFSFGNLFWEDGLHVVRIPLVVR  761



>ref|XP_010100157.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB81608.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=771

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 134/213 (63%), Gaps = 7/213 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISAD-PDGRRANAFDFGSGFV  637
            PHV+GIVALIK+VH  WSPSAIKSA++TT + +      I A+ P+ + A+ FD G G V
Sbjct  551  PHVSGIVALIKSVHKDWSPSAIKSALITTGSQVGTDGSYIYAEGPNRKLADPFDMGGGLV  610

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA--LNYPSI  463
            NP + LDPGL+Y+    DY  FL SIG+ + S+ ++T D S  +   +  SA  LN PSI
Sbjct  611  NPEKALDPGLIYNVTIEDYYQFLVSIGFVDASISVLT-DMSINNSNRKGFSALDLNLPSI  669

Query  462  TVPALIH--KFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLS  289
            TVP L +  K  VTRTVTN+G+  S YKAV+  P GI +T+ P+ L F    + L+F +S
Sbjct  670  TVPNLRNGEKVIVTRTVTNIGDVNSVYKAVIEAPPGIKITIEPQSLGFNSTIKSLSFKVS  729

Query  288  FKMAAPTQGYV-FGSFSWRSKKNWVRSPLVVRV  193
            F       GY  FGS +W   K+ VRSP+ VRV
Sbjct  730  FFSNQKLHGYYKFGSLTWSDGKHLVRSPIAVRV  762



>ref|XP_008348301.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=775

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 125/211 (59%), Gaps = 4/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K ++P WSP+AIKSAIMTTA   +    P+  +     A  F +G+G V
Sbjct  567  CPHISGICGLLKTLYPHWSPAAIKSAIMTTAITRDNSMGPL-LNASFYEATPFSYGAGHV  625

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            +P   +DPGLVYD    DY  FLC++GYNE  + + + D   C +   SP+ LNYPSIT+
Sbjct  626  BPNSAMDPGLVYDLSLNDYLNFLCAMGYNETEMEMFSEDTYECPKPAISPTNLNYPSITI  685

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFT--LSFK  283
            P L     VTRTV NVG P  +YKA +  P G++ +V P++L F   G++ +F   L  K
Sbjct  686  PKLSGXLEVTRTVKNVGSP-GTYKAXIQSPDGVSXSVEPKKLKFXKIGEEKSFKVLLQVK  744

Query  282  MAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
             A   + YV G       K+ VRSP+VV+ +
Sbjct  745  EAXQAKNYVXGKLIXSDGKHXVRSPIVVKAS  775



>ref|XP_002982832.1| hypothetical protein SELMODRAFT_234125 [Selaginella moellendorffii]
 gb|EFJ16077.1| hypothetical protein SELMODRAFT_234125 [Selaginella moellendorffii]
Length=687

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 132/216 (61%), Gaps = 8/216 (4%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+G  AL+K+VHP WSP+AI+SA+MTTAT+L+  + PIS D +   +  FD G+G +
Sbjct  466  CPHVSGAAALLKSVHPDWSPAAIRSALMTTATILDNTNSPIS-DFNKSTSGPFDTGAGEI  524

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGD-NSTCD--QTLQSPSALNYPS  466
            NPA+ LDPGLVYD  P DY ++LC  GYN   + LI+ D N++C   ++  +   LNYPS
Sbjct  525  NPAKALDPGLVYDITPQDYISYLCESGYNTTQVRLISSDPNTSCKPPKSNATTPFLNYPS  584

Query  465  ITVPALIHKF--SVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTL  292
            I    L      S  R VTNVG P+S Y A +  P   ++ V P  L F   GQKL++T+
Sbjct  585  IGFMGLTTTSPQSTERIVTNVGAPKSVYTAEITAPSSTSIVVEPSSLEFSSTGQKLSYTI  644

Query  291  --SFKMAAPTQGYVFGSFSWRSKKNWVRSPLVVRVA  190
              + K + P   + FGS +W +  + VRSP+ V  A
Sbjct  645  TATAKNSLPVSMWSFGSITWIASSHTVRSPIAVTSA  680



>ref|XP_011012624.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=769

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 129/208 (62%), Gaps = 3/208 (1%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PHV+GIV L+K +HP+WSP++IKSAIMTTA   +   +PI  + +  +A+ F +G+G +
Sbjct  562  CPHVSGIVGLLKTMHPTWSPASIKSAIMTTAMTQDNTMEPI-LNANHTKASPFSYGAGHI  620

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P + +DPGLVYD    DY  FLC++GYNE  +   +     C     S +  NYPSITV
Sbjct  621  RPNKAMDPGLVYDLTVDDYLNFLCALGYNETQISTFSDAPYECPSKPISLANFNYPSITV  680

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFK-M  280
            P      +++RTV NVG P ++YK  +  P G++V V P++L FK  G++  FT++ K  
Sbjct  681  PKFNGSITLSRTVKNVGSP-NTYKLRIRKPTGVSVYVEPKKLEFKKVGEEKAFTVTLKGK  739

Query  279  AAPTQGYVFGSFSWRSKKNWVRSPLVVR  196
                + YVFG   W  KK+ VRSP+VV+
Sbjct  740  GKAAKDYVFGELIWSDKKHHVRSPIVVK  767



>ref|XP_002993007.1| hypothetical protein SELMODRAFT_236650 [Selaginella moellendorffii]
 gb|EFJ05953.1| hypothetical protein SELMODRAFT_236650 [Selaginella moellendorffii]
Length=755

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 130/227 (57%), Gaps = 21/227 (9%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PHV G+VAL+KA HPSWSP+A+KSAIMTTA   +    PI   P G+ ANAFD+GSG VN
Sbjct  528  PHVAGVVALLKAAHPSWSPAALKSAIMTTALTEDNTRSPILTLPHGKVANAFDYGSGHVN  587

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTC--DQTLQSP-SALNYPSI  463
            P R  +PGLVYDA P ++ A+LCS GY+ + L  +TGD S C   Q+ + P S LNYP+I
Sbjct  588  PRRAANPGLVYDAGPGEFMAYLCSSGYDTKLLQKVTGDKSICPSSQSARRPISNLNYPAI  647

Query  462  TVPALIHKFSVT-RTVTNVG----EPRSSY------------KAVVFPPRGINVTVVPRR  334
             V  L    + T  +VT VG       S Y            KA V  P GI V VVP  
Sbjct  648  VVSRLGGGVAATAASVTYVGASPARKNSDYSASTAVTTPTVFKASVVAPPGIRVRVVPDE  707

Query  333  LTFKHYGQKLNFTLSFKMAAPTQG-YVFGSFSWRSKKNWVRSPLVVR  196
            L F  Y ++  F +       T G +VFG  +W + +  VRSPL V+
Sbjct  708  LRFSSYMERRAFNVELTSVDHTNGRFVFGWLTWSNGRQRVRSPLAVK  754



>gb|AAM15440.1| subtilisin-like serine protease AIR3, partial [Arabidopsis thaliana]
Length=578

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = -3

Query  816  APHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFV  637
             PH++GI  L+K  +PSWSP+AI+SAIMTTAT+++    PI  +    +A  F FG+G V
Sbjct  370  CPHISGIAGLLKTRYPSWSPAAIRSAIMTTATIMDDIPGPIQ-NATNMKATPFSFGAGHV  428

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
             P   ++PGLVYD    DY  FLCS+GYN   + + +G+N TC     S   LNYPSITV
Sbjct  429  QPNLAVNPGLVYDLGIKDYLNFLCSLGYNASQISVFSGNNFTCSSPKISLVNLNYPSITV  488

Query  456  PALI-HKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNF--TLSF  286
            P L   K +V+RTV NVG P S Y   V  P+G+ V V P  L F   G++  F   L  
Sbjct  489  PNLTSSKVTVSRTVKNVGRP-SMYTVKVNNPQGVYVAVKPTSLNFTKVGEQKTFKVILVK  547

Query  285  KMAAPTQGYVFGSFSWRSKKNWVRSPLVVRV  193
                  +GYVFG   W  KK+ VRSP+VV++
Sbjct  548  SKGNVAKGYVFGELVWSDKKHRVRSPIVVKL  578



>ref|XP_010529680.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Tarenaya 
hassleriana]
Length=707

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 131/208 (63%), Gaps = 2/208 (1%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRR-ANAFDFGSGFV  637
            P V+GIVAL++A+HP+WSP+AI+SAI+TTA   +   +PI AD   R+ A+ FD+G G V
Sbjct  489  PVVSGIVALLRALHPNWSPAAIRSAIVTTAWKTDPSGEPIFADGSNRKLADPFDYGGGLV  548

Query  636  NPARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSALNYPSITV  457
            NP +  DPGLVYD   +DY  ++CS+GY + S+ L+ G  + C     S   LN PSIT+
Sbjct  549  NPEKATDPGLVYDMGTSDYIHYMCSVGYKDPSISLVVGKATICPHPNPSVLDLNLPSITI  608

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
            P L  + ++TRTVTNVG   S YK V+ PP G+++ V P+ L F    ++++FT+    +
Sbjct  609  PDLSGEVTITRTVTNVGPRNSVYKVVIDPPSGVHMDVNPKTLVFNPKTERVSFTVRVSTS  668

Query  276  APTQ-GYVFGSFSWRSKKNWVRSPLVVR  196
                 G+ FGS +W    + V  P+ VR
Sbjct  669  HKVNTGFYFGSLTWTDSVHNVAIPVSVR  696



>gb|KEH31683.1| subtilisin-like serine protease [Medicago truncatula]
Length=755

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 128/210 (61%), Gaps = 6/210 (3%)
 Frame = -3

Query  813  PHVTGIVALIKAVHPSWSPSAIKSAIMTTATVLNKHHKPISADPDGRRANAFDFGSGFVN  634
            PH++GI AL+K+ HP WSP+AIKSAIMT+A  LN  +K I  D   + AN F  GSG VN
Sbjct  546  PHLSGIAALLKSSHPDWSPAAIKSAIMTSADTLNLENKLI-VDETLQPANLFATGSGHVN  604

Query  633  PARVLDPGLVYDAQPADYKAFLCSIGYNERSLHLITGDNSTCDQTLQSPSA-LNYPSITV  457
            P R  DPGLVYD QP DY  +LC +GY++R + +I      C +T   P   LNYPS +V
Sbjct  605  PPRADDPGLVYDIQPDDYIPYLCGLGYSDREVGIIAHRKINCTETSSIPEGELNYPSFSV  664

Query  456  PALIHKFSVTRTVTNVGEPRSSYKAVVFPPRGINVTVVPRRLTFKHYGQKLNFTLSFKMA  277
              L    + TRTVTNVGE +SSY A+V  P+G++V+V P +L F    QK  ++++F   
Sbjct  665  -VLGSSQTFTRTVTNVGEAQSSYFAIVAAPKGVDVSVHPNKLYFSEANQKQTYSVTFNRI  723

Query  276  APTQGYVF---GSFSWRSKKNWVRSPLVVR  196
                  V    G   W S K+ VRSP++V 
Sbjct  724  GSGHKTVEHGQGFLKWVSAKHTVRSPILVN  753



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1765995469312