BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1443

Length=825
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606652.1|  PREDICTED: aspartic proteinase-like protein ...    315   8e-102   Nicotiana tomentosiformis
ref|XP_009804210.1|  PREDICTED: aspartic proteinase-like protein ...    315   2e-101   Nicotiana sylvestris
ref|XP_009606651.1|  PREDICTED: aspartic proteinase-like protein ...    317   7e-101   Nicotiana tomentosiformis
ref|XP_009804209.1|  PREDICTED: aspartic proteinase-like protein ...    316   9e-101   Nicotiana sylvestris
ref|XP_004237880.1|  PREDICTED: aspartic proteinase-like protein 1      308   7e-98    Solanum lycopersicum
emb|CDP21094.1|  unnamed protein product                                303   5e-96    Coffea canephora [robusta coffee]
ref|XP_011098089.1|  PREDICTED: aspartic proteinase-like protein 1      273   3e-84    Sesamum indicum [beniseed]
gb|EYU43596.1|  hypothetical protein MIMGU_mgv1a0074171mg               248   6e-77    Erythranthe guttata [common monkey flower]
ref|XP_010652837.1|  PREDICTED: aspartic proteinase-like protein ...    250   2e-76    Vitis vinifera
ref|XP_010261202.1|  PREDICTED: aspartic proteinase-like protein ...    249   6e-76    Nelumbo nucifera [Indian lotus]
ref|XP_002281243.2|  PREDICTED: aspartic proteinase-like protein ...    251   2e-75    Vitis vinifera
ref|XP_002528982.1|  Aspartic proteinase nepenthesin-1 precursor,...    250   3e-75    Ricinus communis
ref|XP_010261201.1|  PREDICTED: aspartic proteinase-like protein ...    249   4e-75    
gb|KDO43757.1|  hypothetical protein CISIN_1g0095931mg                  243   5e-75    Citrus sinensis [apfelsine]
ref|XP_011039550.1|  PREDICTED: aspartic proteinase-like protein ...    246   1e-74    Populus euphratica
gb|KDO43754.1|  hypothetical protein CISIN_1g0095931mg                  243   6e-74    Citrus sinensis [apfelsine]
gb|KDO43752.1|  hypothetical protein CISIN_1g0095931mg                  243   6e-74    Citrus sinensis [apfelsine]
ref|XP_010269163.1|  PREDICTED: aspartic proteinase-like protein ...    244   1e-73    Nelumbo nucifera [Indian lotus]
ref|XP_011039549.1|  PREDICTED: aspartic proteinase-like protein ...    246   1e-73    Populus euphratica
ref|XP_004304837.1|  PREDICTED: aspartic proteinase-like protein 1      246   1e-73    Fragaria vesca subsp. vesca
ref|XP_007205026.1|  hypothetical protein PRUPE_ppa003982mg             245   4e-73    Prunus persica
ref|XP_010269161.1|  PREDICTED: aspartic proteinase-like protein ...    244   6e-73    Nelumbo nucifera [Indian lotus]
ref|XP_010099945.1|  Aspartic proteinase-like protein 1                 244   1e-72    Morus notabilis
ref|XP_012093314.1|  PREDICTED: aspartic proteinase-like protein ...    241   1e-72    Jatropha curcas
ref|XP_008233626.1|  PREDICTED: aspartic proteinase-like protein 1      243   2e-72    Prunus mume [ume]
ref|XP_006472655.1|  PREDICTED: aspartic proteinase-like protein ...    239   3e-72    
ref|XP_012093305.1|  PREDICTED: aspartic proteinase-like protein ...    241   5e-72    Jatropha curcas
ref|XP_006464280.1|  PREDICTED: aspartic proteinase-like protein ...    240   1e-71    
ref|XP_008440642.1|  PREDICTED: aspartic proteinase-like protein ...    238   2e-71    Cucumis melo [Oriental melon]
gb|KGN48775.1|  hypothetical protein Csa_6G500670                       236   3e-71    Cucumis sativus [cucumbers]
ref|XP_006464278.1|  PREDICTED: aspartic proteinase-like protein ...    240   3e-71    Citrus sinensis [apfelsine]
ref|XP_008374327.1|  PREDICTED: aspartic proteinase-like protein ...    237   3e-71    
ref|XP_006434048.1|  hypothetical protein CICLE_v10000815mg             236   5e-71    
ref|XP_002301033.1|  hypothetical protein POPTR_0002s09270g             239   5e-71    
ref|XP_006472654.1|  PREDICTED: aspartic proteinase-like protein ...    239   6e-71    Citrus sinensis [apfelsine]
ref|XP_008440641.1|  PREDICTED: aspartic proteinase-like protein ...    239   7e-71    Cucumis melo [Oriental melon]
ref|XP_006363948.1|  PREDICTED: aspartic proteinase-like protein ...    236   9e-71    Solanum tuberosum [potatoes]
ref|XP_006363947.1|  PREDICTED: aspartic proteinase-like protein ...    236   9e-71    Solanum tuberosum [potatoes]
ref|XP_008374326.1|  PREDICTED: aspartic proteinase-like protein ...    238   1e-70    
ref|XP_011027671.1|  PREDICTED: aspartic proteinase-like protein ...    236   2e-70    Populus euphratica
ref|XP_010664297.1|  PREDICTED: aspartic proteinase-like protein ...    235   2e-70    Vitis vinifera
ref|XP_007048042.1|  Eukaryotic aspartyl protease family protein        238   2e-70    
ref|XP_011657988.1|  PREDICTED: aspartic proteinase-like protein ...    235   3e-70    Cucumis sativus [cucumbers]
ref|XP_002513870.1|  Aspartic proteinase nepenthesin-2 precursor,...    237   3e-70    
ref|XP_011027670.1|  PREDICTED: aspartic proteinase-like protein ...    237   4e-70    Populus euphratica
ref|XP_004143563.2|  PREDICTED: aspartic proteinase-like protein ...    236   8e-70    Cucumis sativus [cucumbers]
ref|XP_006434046.1|  hypothetical protein CICLE_v10000815mg             236   8e-70    Citrus clementina [clementine]
ref|XP_002284255.2|  PREDICTED: aspartic proteinase-like protein ...    235   1e-69    Vitis vinifera
emb|CBI19115.3|  unnamed protein product                                235   1e-69    Vitis vinifera
ref|XP_006363946.1|  PREDICTED: aspartic proteinase-like protein ...    236   1e-69    Solanum tuberosum [potatoes]
ref|XP_011027669.1|  PREDICTED: aspartic proteinase-like protein ...    236   2e-69    Populus euphratica
ref|XP_010027812.1|  PREDICTED: aspartic proteinase-like protein ...    233   2e-69    Eucalyptus grandis [rose gum]
ref|XP_009776923.1|  PREDICTED: aspartic proteinase-like protein ...    232   3e-69    Nicotiana sylvestris
ref|XP_011027668.1|  PREDICTED: aspartic proteinase-like protein ...    236   3e-69    Populus euphratica
ref|XP_009378547.1|  PREDICTED: aspartic proteinase-like protein ...    232   3e-69    Pyrus x bretschneideri [bai li]
ref|XP_006363945.1|  PREDICTED: aspartic proteinase-like protein ...    235   4e-69    Solanum tuberosum [potatoes]
ref|XP_010319758.1|  PREDICTED: aspartic proteinase-like protein ...    231   7e-69    
ref|XP_010027811.1|  PREDICTED: aspartic proteinase-like protein ...    234   8e-69    Eucalyptus grandis [rose gum]
ref|XP_009776922.1|  PREDICTED: aspartic proteinase-like protein ...    232   2e-68    Nicotiana sylvestris
ref|XP_009378546.1|  PREDICTED: aspartic proteinase-like protein ...    232   2e-68    Pyrus x bretschneideri [bai li]
ref|XP_009618453.1|  PREDICTED: aspartic proteinase-like protein ...    231   2e-68    Nicotiana tomentosiformis
ref|XP_009776921.1|  PREDICTED: aspartic proteinase-like protein ...    232   3e-68    Nicotiana sylvestris
ref|XP_009776920.1|  PREDICTED: aspartic proteinase-like protein ...    232   4e-68    Nicotiana sylvestris
ref|XP_009618452.1|  PREDICTED: aspartic proteinase-like protein ...    231   7e-68    Nicotiana tomentosiformis
ref|XP_004237424.1|  PREDICTED: aspartic proteinase-like protein ...    231   9e-68    Solanum lycopersicum
ref|XP_012078113.1|  PREDICTED: aspartic proteinase-like protein ...    227   1e-67    
ref|XP_007163626.1|  hypothetical protein PHAVU_001G250200g             230   1e-67    Phaseolus vulgaris [French bean]
ref|XP_003537508.1|  PREDICTED: aspartic proteinase-like protein ...    228   6e-67    Glycine max [soybeans]
ref|XP_011090459.1|  PREDICTED: aspartic proteinase-like protein ...    225   7e-67    
ref|XP_011090458.1|  PREDICTED: aspartic proteinase-like protein ...    225   9e-67    
ref|XP_006382913.1|  hypothetical protein POPTR_0005s08170g             222   1e-66    
ref|XP_012078112.1|  PREDICTED: aspartic proteinase-like protein ...    227   2e-66    
gb|KJB49159.1|  hypothetical protein B456_008G103400                    224   2e-66    Gossypium raimondii
ref|XP_010905920.1|  PREDICTED: aspartic proteinase-like protein ...    223   4e-66    
ref|XP_010680590.1|  PREDICTED: aspartic proteinase-like protein ...    224   4e-66    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN31350.1|  Aspartic proteinase-like protein 1                      224   4e-66    Glycine soja [wild soybean]
ref|XP_006382912.1|  hypothetical protein POPTR_0005s08170g             223   5e-66    
ref|XP_007018870.1|  Eukaryotic aspartyl protease family protein ...    226   5e-66    
ref|XP_010546403.1|  PREDICTED: aspartic proteinase-like protein 1      226   6e-66    Tarenaya hassleriana [spider flower]
emb|CDP01409.1|  unnamed protein product                                225   9e-66    Coffea canephora [robusta coffee]
gb|KJB49158.1|  hypothetical protein B456_008G103400                    225   2e-65    Gossypium raimondii
ref|XP_010680589.1|  PREDICTED: aspartic proteinase-like protein ...    224   2e-65    Beta vulgaris subsp. vulgaris [field beet]
gb|KEH35308.1|  eukaryotic aspartyl protease family protein             220   3e-65    Medicago truncatula
ref|XP_010905919.1|  PREDICTED: aspartic proteinase-like protein ...    223   3e-65    
ref|XP_003552102.1|  PREDICTED: aspartic proteinase-like protein ...    223   4e-65    Glycine max [soybeans]
gb|KEH35307.1|  eukaryotic aspartyl protease family protein             220   9e-65    Medicago truncatula
ref|XP_004502449.1|  PREDICTED: aspartic proteinase-like protein ...    223   1e-64    Cicer arietinum [garbanzo]
ref|XP_002307112.2|  hypothetical protein POPTR_0005s08170g             222   2e-64    
ref|XP_006464279.1|  PREDICTED: aspartic proteinase-like protein ...    221   2e-64    Citrus sinensis [apfelsine]
ref|XP_004502450.1|  PREDICTED: aspartic proteinase-like protein ...    218   6e-64    Cicer arietinum [garbanzo]
ref|XP_011090460.1|  PREDICTED: aspartic proteinase-like protein ...    216   7e-64    
ref|XP_003602006.1|  Aspartic proteinase-like protein                   220   9e-64    
ref|XP_009347207.1|  PREDICTED: aspartic proteinase-like protein 1      218   3e-63    Pyrus x bretschneideri [bai li]
ref|XP_008812722.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    218   4e-63    
ref|XP_004502448.1|  PREDICTED: aspartic proteinase-like protein ...    218   6e-63    Cicer arietinum [garbanzo]
ref|XP_009401448.1|  PREDICTED: aspartic proteinase-like protein 1      216   1e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006593577.1|  PREDICTED: aspartic proteinase-like protein ...    212   9e-61    
gb|KHN04699.1|  Aspartic proteinase-like protein 1                      211   3e-60    Glycine soja [wild soybean]
ref|XP_006596325.1|  PREDICTED: aspartic proteinase-like protein ...    206   2e-59    
gb|KDO80881.1|  hypothetical protein CISIN_1g0092712mg                  202   7e-59    Citrus sinensis [apfelsine]
ref|XP_007223258.1|  hypothetical protein PRUPE_ppa004428mg             206   1e-58    
ref|XP_006596324.1|  PREDICTED: aspartic proteinase-like protein ...    206   1e-58    
ref|XP_009381525.1|  PREDICTED: aspartic proteinase-like protein 1      205   4e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008681163.1|  PREDICTED: pepsin A isoform X1                     202   4e-58    Zea mays [maize]
ref|XP_004953938.1|  PREDICTED: aspartic proteinase-like protein ...    202   5e-58    Setaria italica
ref|XP_003542587.1|  PREDICTED: aspartic proteinase-like protein ...    204   8e-58    
gb|KDO80878.1|  hypothetical protein CISIN_1g0092712mg                  202   9e-58    Citrus sinensis [apfelsine]
ref|XP_007141134.1|  hypothetical protein PHAVU_008G170200g             204   1e-57    Phaseolus vulgaris [French bean]
ref|NP_001048134.1|  Os02g0751100                                       203   2e-57    
ref|NP_001132197.1|  pepsin A precursor                                 203   2e-57    Zea mays [maize]
gb|EEC74016.1|  hypothetical protein OsI_08957                          203   2e-57    Oryza sativa Indica Group [Indian rice]
ref|XP_004953937.1|  PREDICTED: aspartic proteinase-like protein ...    202   5e-57    Setaria italica
gb|AGV54159.1|  aspartic proteinase-like protein                        202   6e-57    Phaseolus vulgaris [French bean]
ref|XP_008339224.1|  PREDICTED: aspartic proteinase-like protein 1      198   4e-56    
gb|KJB49161.1|  hypothetical protein B456_008G103400                    195   5e-56    Gossypium raimondii
gb|ACN27411.1|  unknown                                                 194   2e-55    Zea mays [maize]
dbj|BAE98882.1|  predicted GPI-anchored protein                         191   5e-55    Arabidopsis thaliana [mouse-ear cress]
gb|EYU31043.1|  hypothetical protein MIMGU_mgv1a018151mg                196   7e-55    Erythranthe guttata [common monkey flower]
gb|ACG31680.1|  pepsin A                                                194   1e-54    Zea mays [maize]
ref|XP_006647899.1|  PREDICTED: aspartic proteinase-like protein ...    194   3e-54    Oryza brachyantha
ref|XP_008460494.1|  PREDICTED: aspartic proteinase-like protein 1      194   4e-54    Cucumis melo [Oriental melon]
gb|ACL54367.1|  unknown                                                 194   6e-54    Zea mays [maize]
ref|NP_001141522.1|  uncharacterized protein LOC100273634 precursor     193   6e-54    Zea mays [maize]
ref|XP_004140314.1|  PREDICTED: aspartic proteinase-like protein 1      193   1e-53    Cucumis sativus [cucumbers]
ref|XP_006368037.1|  PREDICTED: aspartic proteinase-like protein ...    190   2e-53    Solanum tuberosum [potatoes]
ref|NP_196570.1|  aspartyl protease family protein                      192   2e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399498.1|  hypothetical protein EUTSA_v10013235mg             191   7e-53    Eutrema salsugineum [saltwater cress]
gb|EMT00913.1|  Aspartic proteinase-like protein 1                      190   7e-53    
ref|XP_009122092.1|  PREDICTED: aspartic proteinase-like protein ...    189   2e-52    Brassica rapa
emb|CDX69862.1|  BnaA10g22110D                                          189   2e-52    
gb|AFK40902.1|  unknown                                                 181   3e-52    Lotus japonicus
ref|XP_010491661.1|  PREDICTED: aspartic proteinase-like protein 1      189   4e-52    Camelina sativa [gold-of-pleasure]
ref|XP_010530170.1|  PREDICTED: aspartic proteinase-like protein ...    188   5e-52    Tarenaya hassleriana [spider flower]
gb|ACK44517.1|  AT5G10080-like protein                                  188   6e-52    Arabidopsis arenosa
gb|AAZ67590.1|  80A08_5                                                 189   1e-51    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010422895.1|  PREDICTED: aspartic proteinase-like protein 1      187   2e-51    Camelina sativa [gold-of-pleasure]
ref|XP_002871403.1|  aspartyl protease family protein                   187   3e-51    Arabidopsis lyrata subsp. lyrata
ref|XP_010236110.1|  PREDICTED: aspartic proteinase-like protein 1      186   4e-51    Brachypodium distachyon [annual false brome]
gb|EMS50313.1|  Aspartic proteinase-like protein 1                      184   4e-51    Triticum urartu
ref|XP_010453028.1|  PREDICTED: aspartic proteinase-like protein 1      185   1e-50    Camelina sativa [gold-of-pleasure]
emb|CDY21629.1|  BnaC09g46630D                                          182   9e-50    Brassica napus [oilseed rape]
dbj|BAK05106.1|  predicted protein                                      182   2e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008676833.1|  PREDICTED: uncharacterized protein LOC100273...    178   9e-48    
ref|XP_006827007.1|  PREDICTED: aspartic proteinase-like protein 1      177   1e-47    Amborella trichopoda
emb|CDY21633.1|  BnaC09g46590D                                          174   2e-47    Brassica napus [oilseed rape]
gb|KFK25303.1|  hypothetical protein AALP_AA8G094900                    174   1e-46    Arabis alpina [alpine rockcress]
gb|AFW64462.1|  hypothetical protein ZEAMMB73_591827                    171   7e-46    
gb|KEH28058.1|  eukaryotic aspartyl protease family protein             169   1e-45    Medicago truncatula
gb|KHN44321.1|  Aspartic proteinase-like protein 1                      163   3e-45    Glycine soja [wild soybean]
ref|XP_009122093.1|  PREDICTED: aspartic proteinase-like protein ...    168   5e-45    Brassica rapa
gb|AES97910.2|  eukaryotic aspartyl protease family protein             169   1e-44    Medicago truncatula
ref|XP_003614952.1|  Aspartic proteinase-like protein                   163   1e-42    
ref|XP_006434047.1|  hypothetical protein CICLE_v10000815mg             149   1e-38    
gb|KDO80879.1|  hypothetical protein CISIN_1g0092712mg                  149   9e-38    Citrus sinensis [apfelsine]
gb|KDO43756.1|  hypothetical protein CISIN_1g0095931mg                  143   4e-37    Citrus sinensis [apfelsine]
ref|XP_006428132.1|  hypothetical protein CICLE_v10025730mg             140   4e-35    
ref|XP_006428131.1|  hypothetical protein CICLE_v10025730mg             140   6e-35    
ref|XP_007018872.1|  Eukaryotic aspartyl protease family protein ...    140   7e-35    
ref|XP_010530171.1|  PREDICTED: aspartic proteinase-like protein ...    129   1e-30    Tarenaya hassleriana [spider flower]
ref|XP_006828808.1|  PREDICTED: aspartic proteinase-like protein 1      129   2e-30    Amborella trichopoda
ref|XP_010680395.1|  PREDICTED: aspartic proteinase-like protein 1      125   3e-29    Beta vulgaris subsp. vulgaris [field beet]
gb|KDO80880.1|  hypothetical protein CISIN_1g0092712mg                  122   2e-28    Citrus sinensis [apfelsine]
ref|XP_007018871.1|  Eukaryotic aspartyl protease family protein ...    122   2e-28    
emb|CBI25840.3|  unnamed protein product                                120   3e-28    Vitis vinifera
ref|XP_006354023.1|  PREDICTED: aspartic proteinase-like protein ...    116   4e-28    
ref|XP_007018873.1|  Eukaryotic aspartyl protease family protein ...    120   1e-27    
ref|XP_008671078.1|  PREDICTED: aspartic proteinase-like protein 1      114   1e-27    Zea mays [maize]
ref|XP_002269916.3|  PREDICTED: aspartic proteinase-like protein 1      120   2e-27    Vitis vinifera
dbj|BAJ95388.1|  predicted protein                                      119   3e-27    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD46595.1|  aspartic proteinase nepenthesin II -like               118   8e-27    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063819.1|  Os09g0542100                                       118   9e-27    
ref|XP_010113296.1|  Aspartic proteinase-like protein 1                 117   1e-26    
gb|EMS49647.1|  Aspartic proteinase-like protein 1                      117   2e-26    Triticum urartu
gb|EEC84974.1|  hypothetical protein OsI_32231                          117   2e-26    Oryza sativa Indica Group [Indian rice]
gb|AIU50177.1|  aspartyl protease family protein                        116   3e-26    Phaseolus vulgaris [French bean]
ref|XP_004509400.1|  PREDICTED: aspartic proteinase-like protein ...    117   3e-26    Cicer arietinum [garbanzo]
gb|AIU50160.1|  aspartyl protease family protein                        115   4e-26    Glycine max [soybeans]
dbj|BAC79194.1|  chloroplast nucleoid DNA-binding protein -like p...    118   4e-26    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010680394.1|  PREDICTED: aspartic proteinase-like protein ...    116   5e-26    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007156197.1|  hypothetical protein PHAVU_003G266500g             116   5e-26    Phaseolus vulgaris [French bean]
ref|XP_010113297.1|  Aspartic proteinase-like protein 1                 118   7e-26    
gb|AIU50181.1|  aspartyl protease family protein                        115   8e-26    Solanum lycopersicum
gb|KHN35548.1|  Aspartic proteinase-like protein 1                      115   9e-26    Glycine soja [wild soybean]
ref|XP_007156199.1|  hypothetical protein PHAVU_003G266600g             114   9e-26    Phaseolus vulgaris [French bean]
gb|KDP23963.1|  hypothetical protein JCGZ_25351                         115   9e-26    Jatropha curcas
ref|XP_006425378.1|  hypothetical protein CICLE_v10025361mg             114   9e-26    
ref|XP_012088469.1|  PREDICTED: aspartic proteinase-like protein 1      115   1e-25    Jatropha curcas
ref|XP_002462757.1|  hypothetical protein SORBIDRAFT_02g031460          115   1e-25    Sorghum bicolor [broomcorn]
gb|KJB43278.1|  hypothetical protein B456_007G191400                    115   1e-25    Gossypium raimondii
ref|XP_006599302.1|  PREDICTED: aspartic proteinase-like protein ...    115   1e-25    Glycine max [soybeans]
ref|XP_003578546.1|  PREDICTED: aspartic proteinase-like protein 1      115   1e-25    Brachypodium distachyon [annual false brome]
gb|AIU50171.1|  aspartyl protease family protein                        114   1e-25    Medicago truncatula
gb|KFK30223.1|  hypothetical protein AALP_AA7G233600                    115   1e-25    Arabis alpina [alpine rockcress]
ref|XP_007156198.1|  hypothetical protein PHAVU_003G266600g             115   1e-25    Phaseolus vulgaris [French bean]
ref|XP_008242027.1|  PREDICTED: aspartic proteinase-like protein 1      115   1e-25    Prunus mume [ume]
ref|XP_004232518.1|  PREDICTED: aspartic proteinase-like protein ...    114   3e-25    Solanum lycopersicum
ref|XP_002310698.2|  hypothetical protein POPTR_0007s08610g             113   3e-25    
ref|XP_004957514.1|  PREDICTED: aspartic proteinase-like protein ...    114   3e-25    Setaria italica
ref|XP_006425377.1|  hypothetical protein CICLE_v10025361mg             114   3e-25    Citrus clementina [clementine]
ref|XP_006467010.1|  PREDICTED: aspartic proteinase-like protein ...    114   3e-25    Citrus sinensis [apfelsine]
gb|AIU50184.1|  aspartyl protease family protein                        113   3e-25    Lactuca sativa [cultivated lettuce]
gb|AET03725.2|  eukaryotic aspartyl protease family protein             114   4e-25    Medicago truncatula
ref|XP_006660917.1|  PREDICTED: aspartic proteinase-like protein ...    111   4e-25    
gb|KEH20366.1|  eukaryotic aspartyl protease family protein             112   5e-25    Medicago truncatula
ref|XP_006574660.1|  PREDICTED: aspartic proteinase-like protein ...    113   5e-25    Glycine max [soybeans]
gb|AIU50174.1|  aspartyl protease family protein                        112   5e-25    Solanum tuberosum [potatoes]
ref|XP_010029640.1|  PREDICTED: aspartic proteinase-like protein 1      113   5e-25    Eucalyptus grandis [rose gum]
gb|AIU50186.1|  aspartyl protease family protein                        110   5e-25    Cinnamomum camphora
gb|KHG06656.1|  hypothetical protein F383_03930                         113   6e-25    Gossypium arboreum [tree cotton]
ref|XP_004509401.1|  PREDICTED: aspartic proteinase-like protein ...    113   7e-25    Cicer arietinum [garbanzo]
gb|AIU50147.1|  aspartyl protease family protein                        112   7e-25    Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU50164.1|  aspartyl protease family protein                        112   7e-25    Chloranthus japonicus
gb|AET03732.2|  eukaryotic aspartyl protease family protein             112   9e-25    Medicago truncatula
gb|AIU50156.1|  aspartyl protease family protein                        111   9e-25    Citrus clementina [clementine]
ref|XP_010531119.1|  PREDICTED: aspartic proteinase-like protein 1      112   1e-24    Tarenaya hassleriana [spider flower]
gb|KHN00446.1|  Aspartic proteinase-like protein 1                      112   1e-24    Glycine soja [wild soybean]
gb|AIU50154.1|  aspartyl protease family protein                        111   1e-24    Acorus calamus [flagroot]
gb|AIU50185.1|  aspartyl protease family protein                        111   1e-24    Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU50165.1|  aspartyl protease family protein                        111   1e-24    Ceratophyllum demersum [hornwort]
gb|AIU50159.1|  aspartyl protease family protein                        111   1e-24    Capsella rubella
ref|XP_008806141.1|  PREDICTED: aspartic proteinase-like protein 1      112   1e-24    Phoenix dactylifera
ref|XP_009149096.1|  PREDICTED: aspartic proteinase-like protein 1      112   2e-24    Brassica rapa
gb|AIU50190.1|  aspartyl protease family protein                        110   2e-24    Alisma plantago-aquatica
gb|AIU50187.1|  aspartyl protease family protein                        110   2e-24    Platanus x hispanica [London plane tree]
ref|XP_006425376.1|  hypothetical protein CICLE_v10025361mg             111   3e-24    
ref|XP_006467011.1|  PREDICTED: aspartic proteinase-like protein ...    111   3e-24    Citrus sinensis [apfelsine]
gb|AIU50158.1|  aspartyl protease family protein                        110   3e-24    Carica papaya [mamon]
gb|KHG24810.1|  hypothetical protein F383_07826                         110   3e-24    Gossypium arboreum [tree cotton]
gb|AIU50150.1|  aspartyl protease family protein                        110   3e-24    Arabidopsis thaliana [mouse-ear cress]
gb|AIU50151.1|  aspartyl protease family protein                        110   3e-24    Lilium brownii [Hong Kong lily]
gb|AIU50149.1|  aspartyl protease family protein                        110   4e-24    Arabidopsis lyrata [lyrate rockcress]
emb|CDX75536.1|  BnaA01g01660D                                          110   5e-24    
emb|CDX69179.1|  BnaC01g02740D                                          110   5e-24    
gb|AIU50162.1|  aspartyl protease family protein                        109   6e-24    Buxus sinica
ref|XP_010266874.1|  PREDICTED: aspartic proteinase-like protein 1      110   7e-24    Nelumbo nucifera [Indian lotus]
gb|AIU50157.1|  aspartyl protease family protein                        109   7e-24    Gossypium raimondii
ref|XP_011043127.1|  PREDICTED: aspartic proteinase-like protein ...    110   8e-24    Populus euphratica
ref|XP_011043126.1|  PREDICTED: aspartic proteinase-like protein ...    110   9e-24    Populus euphratica
ref|XP_007203645.1|  hypothetical protein PRUPE_ppa004265mg             109   1e-23    Prunus persica
ref|XP_011011846.1|  PREDICTED: aspartic proteinase-like protein ...    109   1e-23    Populus euphratica
ref|XP_002869053.1|  aspartyl protease family protein                   109   1e-23    Arabidopsis lyrata subsp. lyrata
ref|XP_011011847.1|  PREDICTED: aspartic proteinase-like protein ...    109   1e-23    Populus euphratica
ref|NP_195313.2|  aspartyl protease family protein                      109   1e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437405.1|  PREDICTED: aspartic proteinase-like protein 1      109   1e-23    Camelina sativa [gold-of-pleasure]
ref|XP_010446864.1|  PREDICTED: aspartic proteinase-like protein 1      109   1e-23    Camelina sativa [gold-of-pleasure]
gb|KJB17586.1|  hypothetical protein B456_003G006500                    109   2e-23    Gossypium raimondii
gb|AIU50183.1|  aspartyl protease family protein                        108   2e-23    Vitis vinifera
ref|XP_009605165.1|  PREDICTED: aspartic proteinase-like protein ...    108   2e-23    Nicotiana tomentosiformis
emb|CDP01850.1|  unnamed protein product                                108   2e-23    Coffea canephora [robusta coffee]
gb|KDO71327.1|  hypothetical protein CISIN_1g010129mg                   107   2e-23    Citrus sinensis [apfelsine]
gb|AIU50155.1|  aspartyl protease family protein                        107   2e-23    Sarcandra glabra
gb|KJB17591.1|  hypothetical protein B456_003G006500                    109   2e-23    Gossypium raimondii
ref|XP_008800052.1|  PREDICTED: aspartic proteinase-like protein ...    108   2e-23    Phoenix dactylifera
gb|KJB17588.1|  hypothetical protein B456_003G006500                    108   3e-23    Gossypium raimondii
ref|XP_010432218.1|  PREDICTED: aspartic proteinase-like protein 1      108   3e-23    Camelina sativa [gold-of-pleasure]
gb|EYU37079.1|  hypothetical protein MIMGU_mgv1a019301mg                107   3e-23    Erythranthe guttata [common monkey flower]
ref|XP_009801051.1|  PREDICTED: aspartic proteinase-like protein 1      108   4e-23    Nicotiana sylvestris
gb|EYU37075.1|  hypothetical protein MIMGU_mgv1a005076mg                107   4e-23    Erythranthe guttata [common monkey flower]
ref|XP_010935168.1|  PREDICTED: aspartic proteinase-like protein ...    108   5e-23    Elaeis guineensis
ref|XP_011092022.1|  PREDICTED: aspartic proteinase-like protein ...    107   5e-23    Sesamum indicum [beniseed]
ref|XP_008800053.1|  PREDICTED: aspartic proteinase-like protein ...    107   5e-23    Phoenix dactylifera
ref|XP_009136613.1|  PREDICTED: aspartic proteinase-like protein 1      108   5e-23    Brassica rapa
emb|CDX90651.1|  BnaA03g41300D                                          107   5e-23    
ref|XP_006412049.1|  hypothetical protein EUTSA_v10024926mg             107   6e-23    Eutrema salsugineum [saltwater cress]
emb|CDY24371.1|  BnaA07g02960D                                          107   6e-23    Brassica napus [oilseed rape]
ref|XP_011092020.1|  PREDICTED: aspartic proteinase-like protein ...    107   6e-23    Sesamum indicum [beniseed]
gb|AIU50153.1|  aspartyl protease family protein                        106   6e-23    Theobroma cacao [chocolate]
gb|KHN35547.1|  Aspartic proteinase-like protein 1                      107   6e-23    Glycine soja [wild soybean]
gb|AIU50175.1|  aspartyl protease family protein                        106   7e-23    Prunus persica
gb|AIU50166.1|  aspartyl protease family protein                        106   7e-23    Chimonanthus praecox [wintersweet]
ref|XP_006574352.1|  PREDICTED: uncharacterized protein LOC100500...    107   7e-23    
ref|XP_003547911.1|  PREDICTED: aspartic proteinase-like protein ...    107   7e-23    Glycine max [soybeans]
gb|AIU50182.1|  aspartyl protease family protein                        106   7e-23    Schrenkiella parvula
gb|KJB17584.1|  hypothetical protein B456_003G006400                    107   7e-23    Gossypium raimondii
ref|XP_010941344.1|  PREDICTED: aspartic proteinase-like protein ...    107   7e-23    
ref|XP_007046607.1|  Eukaryotic aspartyl protease family protein ...    107   7e-23    
ref|XP_007204828.1|  hypothetical protein PRUPE_ppa004096mg             107   7e-23    
ref|XP_008448519.1|  PREDICTED: aspartic proteinase-like protein ...    107   7e-23    
ref|XP_009121084.1|  PREDICTED: aspartic proteinase-like protein 1      107   8e-23    Brassica rapa
ref|XP_009801749.1|  PREDICTED: aspartic proteinase-like protein 1      107   8e-23    
ref|XP_010316442.1|  PREDICTED: aspartic proteinase-like protein ...    107   9e-23    
ref|XP_008241996.1|  PREDICTED: aspartic proteinase-like protein ...    106   1e-22    
emb|CDY20815.1|  BnaC07g06640D                                          107   1e-22    
ref|XP_002534038.1|  Aspartic proteinase nepenthesin-1 precursor,...    107   1e-22    
ref|XP_006403927.1|  hypothetical protein EUTSA_v10010279mg             107   1e-22    
gb|EPS72692.1|  aspartyl protease family protein                        106   1e-22    
ref|XP_006467009.1|  PREDICTED: aspartic proteinase-like protein ...    106   2e-22    
gb|AEZ00856.1|  putative peptidase A1 protein                           103   2e-22    
emb|CDY29013.1|  BnaC07g32190D                                          106   2e-22    
ref|XP_002269880.1|  PREDICTED: aspartic proteinase-like protein 1      106   2e-22    
gb|AIU50168.1|  aspartyl protease family protein                        104   2e-22    
gb|AIU50189.1|  aspartyl protease family protein                        104   2e-22    
ref|XP_003612242.1|  Aspartic proteinase-like protein                   106   2e-22    
ref|XP_006590736.1|  PREDICTED: peroxidase                              105   2e-22    
ref|XP_006425380.1|  hypothetical protein CICLE_v10025374mg             105   3e-22    
ref|XP_008242026.1|  PREDICTED: aspartic proteinase-like protein 1      106   3e-22    
ref|XP_010548254.1|  PREDICTED: aspartic proteinase-like protein ...    105   3e-22    
ref|XP_008653555.1|  PREDICTED: aspartic proteinase-like protein 1      105   3e-22    
ref|XP_003517157.1|  PREDICTED: aspartic proteinase-like protein ...    105   3e-22    
gb|AIU50148.1|  aspartyl protease family protein                        100   3e-22    
ref|XP_009344832.1|  PREDICTED: aspartic proteinase-like protein 1      105   3e-22    
gb|KCW56587.1|  hypothetical protein EUGRSUZ_I02313                     104   4e-22    
ref|XP_009387321.1|  PREDICTED: aspartic proteinase-like protein ...    105   4e-22    
gb|EYU45425.1|  hypothetical protein MIMGU_mgv1a025381mg                103   5e-22    
ref|XP_007046606.1|  Eukaryotic aspartyl protease family protein ...    105   6e-22    
gb|EYU30817.1|  hypothetical protein MIMGU_mgv1a023837mg                104   6e-22    
gb|KHG24812.1|  hypothetical protein F383_07828                         105   6e-22    
ref|XP_008448518.1|  PREDICTED: aspartic proteinase-like protein ...    105   6e-22    
gb|KJB17589.1|  hypothetical protein B456_003G006500                    103   6e-22    
ref|XP_008337974.1|  PREDICTED: aspartic proteinase-like protein 1      104   7e-22    
ref|XP_008241995.1|  PREDICTED: aspartic proteinase-like protein ...    104   8e-22    
ref|XP_010033529.1|  PREDICTED: aspartic proteinase-like protein 1      104   8e-22    
ref|XP_008393791.1|  PREDICTED: aspartic proteinase-like protein 1      104   9e-22    
gb|AIU34719.1|  aspartic protease                                       102   9e-22    
gb|EYU34843.1|  hypothetical protein MIMGU_mgv1a026673mg                103   1e-21    
ref|XP_008811699.1|  PREDICTED: aspartic proteinase-like protein 1      103   1e-21    
ref|NP_001237772.1|  uncharacterized protein LOC100500675               100   1e-21    
gb|AIU50188.1|  aspartyl protease family protein                        102   2e-21    
gb|AIU50152.1|  aspartyl protease family protein                        102   2e-21    
ref|XP_010548253.1|  PREDICTED: aspartic proteinase-like protein ...    103   2e-21    
gb|AIU50180.1|  aspartyl protease family protein                        102   2e-21    
ref|XP_009767400.1|  PREDICTED: aspartic proteinase-like protein 1      103   2e-21    
ref|XP_009350978.1|  PREDICTED: aspartic proteinase-like protein 1      101   3e-21    
ref|XP_009350976.1|  PREDICTED: aspartic proteinase-like protein 1      103   3e-21    
ref|XP_009150762.1|  PREDICTED: aspartic proteinase-like protein 1      102   3e-21    
ref|XP_009350980.1|  PREDICTED: aspartic proteinase-like protein 1      101   3e-21    
ref|XP_006290915.1|  hypothetical protein CARUB_v10017028mg             102   3e-21    
gb|AIU50163.1|  aspartyl protease family protein                        101   3e-21    
ref|XP_010426690.1|  PREDICTED: aspartic proteinase-like protein 1      103   3e-21    
ref|XP_010266039.1|  PREDICTED: aspartic proteinase-like protein 1      102   3e-21    
ref|XP_002884082.1|  aspartyl protease family protein                   102   4e-21    
gb|AIU50179.1|  aspartyl protease family protein                        101   4e-21    
ref|XP_009393977.1|  PREDICTED: aspartic proteinase-like protein 1      102   4e-21    
ref|XP_009395379.1|  PREDICTED: aspartic proteinase-like protein 1      102   4e-21    
ref|XP_002534040.1|  Aspartic proteinase nepenthesin-2 precursor,...    102   5e-21    
ref|XP_008337971.1|  PREDICTED: aspartic proteinase-like protein 1      102   5e-21    
ref|XP_006467012.1|  PREDICTED: aspartic proteinase-like protein ...    102   5e-21    
ref|XP_009387322.1|  PREDICTED: aspartic proteinase-like protein ...    101   6e-21    
gb|KFK34380.1|  hypothetical protein AALP_AA5G137700                    102   6e-21    
gb|KFK40158.1|  hypothetical protein AALP_AA3G337900                    101   8e-21    
ref|XP_004234596.1|  PREDICTED: aspartic proteinase-like protein 1      101   8e-21    
gb|AIU50169.1|  aspartyl protease family protein                        100   9e-21    
ref|XP_010515540.1|  PREDICTED: aspartic proteinase-like protein 1      101   1e-20    
ref|XP_009363451.1|  PREDICTED: aspartic proteinase-like protein 1      101   1e-20    
ref|XP_009363449.1|  PREDICTED: aspartic proteinase-like protein ...    101   1e-20    
ref|XP_009383415.1|  PREDICTED: aspartic proteinase-like protein 1      101   1e-20    
ref|XP_010503828.1|  PREDICTED: aspartic proteinase-like protein 1      101   1e-20    
ref|XP_010550486.1|  PREDICTED: aspartic proteinase-like protein 1      101   1e-20    
ref|XP_010316441.1|  PREDICTED: aspartic proteinase-like protein ...    101   1e-20    
ref|XP_006299902.1|  hypothetical protein CARUB_v10016111mg             100   2e-20    
ref|XP_003629249.1|  Aspartic proteinase-like protein                   100   2e-20    
ref|XP_009408741.1|  PREDICTED: aspartic proteinase-like protein 1      100   2e-20    
gb|KHG06657.1|  hypothetical protein F383_03931                         100   2e-20    
ref|XP_004232517.1|  PREDICTED: aspartic proteinase-like protein ...    100   2e-20    
ref|XP_010489408.1|  PREDICTED: aspartic proteinase-like protein 1      100   2e-20    
gb|EYU22099.1|  hypothetical protein MIMGU_mgv1a024547mg              99.4    2e-20    
ref|XP_007046609.1|  Eukaryotic aspartyl protease family protein,...    100   2e-20    
ref|XP_006340776.1|  PREDICTED: aspartic proteinase-like protein ...    100   2e-20    
ref|XP_007157872.1|  hypothetical protein PHAVU_002G105200g             100   3e-20    
gb|AAK74041.1|  AT3g51330/F24M12_370                                  97.4    3e-20    
ref|XP_003629256.1|  Aspartic proteinase-like protein                   100   3e-20    
gb|AIU50178.1|  aspartyl protease family protein                      98.6    3e-20    
gb|KJB43270.1|  hypothetical protein B456_007G191200                    100   3e-20    
gb|AIU50191.1|  aspartyl protease family protein                      98.6    3e-20    
ref|XP_010680393.1|  PREDICTED: aspartic proteinase-like protein ...    100   3e-20    
emb|CDP01851.1|  unnamed protein product                              99.8    4e-20    
ref|XP_010467570.1|  PREDICTED: aspartic proteinase-like protein 1    99.8    4e-20    
ref|NP_190703.2|  aspartyl protease family protein                    99.8    4e-20    
ref|XP_006285837.1|  hypothetical protein CARUB_v10007317mg           99.8    4e-20    
ref|XP_004512176.1|  PREDICTED: aspartic proteinase-like protein ...  99.4    5e-20    
ref|XP_011099888.1|  PREDICTED: aspartic proteinase-like protein 1    99.4    5e-20    
pir||B84556  hypothetical protein At2g17760 [imported] - Arabidop...  99.0    5e-20 
ref|XP_004146158.2|  PREDICTED: aspartic proteinase-like protein ...  99.0    6e-20    
ref|NP_849967.1|  aspartyl protease family protein                    99.0    7e-20    
gb|EYU37087.1|  hypothetical protein MIMGU_mgv1a026688mg              97.1    7e-20    
ref|XP_010514664.1|  PREDICTED: aspartic proteinase-like protein 1    98.2    1e-19    
gb|AIU50172.1|  aspartyl protease family protein                      97.1    1e-19    
ref|XP_004975122.1|  PREDICTED: aspartic proteinase-like protein ...  97.1    1e-19    
emb|CDP12942.1|  unnamed protein product                              97.8    1e-19    
gb|KJB43271.1|  hypothetical protein B456_007G191200                  98.2    1e-19    
gb|KHN36002.1|  Aspartic proteinase-like protein 1                    97.8    1e-19    
ref|XP_010680396.1|  PREDICTED: aspartic proteinase-like protein 1    97.8    1e-19    
gb|KJB43272.1|  hypothetical protein B456_007G191200                  97.8    2e-19    
gb|EYU37088.1|  hypothetical protein MIMGU_mgv1a025500mg              97.8    2e-19    
ref|NP_566948.1|  aspartyl protease family protein                    97.8    2e-19    
ref|XP_006409248.1|  hypothetical protein EUTSA_v10022648mg           97.4    2e-19    
ref|XP_004975120.1|  PREDICTED: aspartic proteinase-like protein ...  97.4    3e-19    
gb|EYU37092.1|  hypothetical protein MIMGU_mgv1a026715mg              95.9    3e-19    
ref|XP_002437603.1|  hypothetical protein SORBIDRAFT_10g030330        97.1    3e-19    
ref|XP_011658062.1|  PREDICTED: aspartic proteinase-like protein ...  95.5    4e-19    
ref|XP_010935167.1|  PREDICTED: aspartic proteinase-like protein ...  96.7    5e-19    
ref|XP_009605164.1|  PREDICTED: aspartic proteinase-like protein ...  96.7    5e-19    
gb|EAY92726.1|  hypothetical protein OsI_14476                        96.7    5e-19    
ref|NP_001052287.1|  Os04g0228000                                     96.7    5e-19    
ref|XP_009387323.1|  PREDICTED: aspartic proteinase-like protein 1    96.3    5e-19    
emb|CAH66084.1|  H0209A05.1                                           96.3    5e-19    
ref|XP_008440867.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  96.3    6e-19    
ref|XP_011650278.1|  PREDICTED: aspartic proteinase-like protein ...  96.3    6e-19    
emb|CAB62656.1|  putative protein                                     96.3    6e-19    
ref|XP_006652122.1|  PREDICTED: aspartic proteinase-like protein ...  95.1    6e-19    
ref|XP_002877797.1|  aspartyl protease family protein                 96.3    7e-19    
gb|KGN48952.1|  hypothetical protein Csa_6G507260                     95.9    7e-19    
ref|XP_010266873.1|  PREDICTED: aspartic proteinase-like protein 1    95.9    8e-19    
ref|NP_190702.2|  aspartyl protease family protein                    95.9    8e-19    
gb|EMS47670.1|  Aspartic proteinase-like protein 1                    94.4    8e-19    
ref|XP_009605166.1|  PREDICTED: aspartic proteinase-like protein 1    95.9    1e-18    
ref|XP_011658061.1|  PREDICTED: aspartic proteinase-like protein ...  95.5    1e-18    
gb|AIU50170.1|  aspartyl protease family protein                      94.4    1e-18    
ref|XP_009115813.1|  PREDICTED: aspartic proteinase-like protein 1    95.1    2e-18    
ref|XP_006292832.1|  hypothetical protein CARUB_v10019091mg           94.7    2e-18    
dbj|BAK06090.1|  predicted protein                                    94.7    2e-18    
gb|EMT11027.1|  Aspartic proteinase-like protein 1                    92.0    2e-18    
dbj|BAK06209.1|  predicted protein                                    94.4    2e-18    
ref|XP_010918116.1|  PREDICTED: aspartic proteinase-like protein 1    90.9    2e-18    
gb|EMT21844.1|  Aspartic proteinase-like protein 1                    94.4    3e-18    
ref|XP_012088470.1|  PREDICTED: aspartic proteinase-like protein 1    94.0    4e-18    
ref|XP_004287774.1|  PREDICTED: aspartic proteinase-like protein 1    94.0    4e-18    
ref|NP_001058598.1|  Os06g0717900                                     90.9    8e-18    
ref|XP_010426688.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  92.8    8e-18    
ref|XP_001752854.1|  predicted protein                                92.4    1e-17    
ref|XP_004975121.1|  PREDICTED: aspartic proteinase-like protein ...  92.0    1e-17    
dbj|BAJ91083.1|  predicted protein                                    92.0    2e-17    
emb|CDX77999.1|  BnaA09g31940D                                        91.7    2e-17    
ref|XP_004289072.1|  PREDICTED: aspartic proteinase-like protein 1    91.7    2e-17    
ref|XP_002877800.1|  predicted protein                                91.3    3e-17    
gb|EYU40081.1|  hypothetical protein MIMGU_mgv1a025468mg              90.9    5e-17    
gb|EYU37089.1|  hypothetical protein MIMGU_mgv1a024952mg              89.4    5e-17    
ref|XP_003581483.1|  PREDICTED: aspartic proteinase-like protein 1    90.1    6e-17    
gb|AAL79734.1|AC091774_25  putative chloroplast nucleoid DNA-bind...  90.1    7e-17    
ref|NP_001146408.1|  uncharacterized protein LOC100279988             89.0    8e-17    
ref|XP_004135019.1|  PREDICTED: aspartic proteinase-like protein 1    89.7    8e-17    
gb|EYU24233.1|  hypothetical protein MIMGU_mgv1a019172mg              87.8    8e-17    
gb|EAZ02384.1|  hypothetical protein OsI_24487                        89.7    9e-17    
ref|XP_010557570.1|  PREDICTED: aspartic proteinase-like protein 1    89.4    1e-16    
emb|CAB62655.1|  putative protein                                     89.7    1e-16    
tpg|DAA38345.1|  TPA: hypothetical protein ZEAMMB73_272638            89.0    2e-16    
emb|CDX73728.1|  BnaC08g22750D                                        89.0    2e-16    
ref|XP_008440866.1|  PREDICTED: aspartic proteinase-like protein 1    88.6    3e-16    
emb|CDY07819.1|  BnaC03g48030D                                        88.2    3e-16    
ref|XP_008440865.1|  PREDICTED: aspartic proteinase-like protein 1    88.2    3e-16    
ref|XP_003560331.2|  PREDICTED: aspartic proteinase-like protein 1    88.2    3e-16    
ref|XP_008354641.1|  PREDICTED: aspartic proteinase-like protein 1    87.8    5e-16    
ref|XP_004966476.1|  PREDICTED: aspartic proteinase-like protein ...  87.4    5e-16    
ref|XP_006657351.1|  PREDICTED: aspartic proteinase-like protein ...  87.4    5e-16    
ref|XP_010515543.1|  PREDICTED: aspartic proteinase-like protein ...  85.9    6e-16    
ref|XP_002437757.1|  hypothetical protein SORBIDRAFT_10g002060        87.0    9e-16    
ref|XP_002446191.1|  hypothetical protein SORBIDRAFT_06g003200        86.7    1e-15    
gb|EYU26833.1|  hypothetical protein MIMGU_mgv1a017833mg              86.3    1e-15    
gb|ACN35785.1|  unknown                                               86.7    1e-15    
gb|EYU37086.1|  hypothetical protein MIMGU_mgv1a026643mg              86.3    1e-15    
gb|EYU37082.1|  hypothetical protein MIMGU_mgv1a021789mg              85.9    1e-15    
ref|XP_010515541.1|  PREDICTED: aspartic proteinase-like protein ...  85.9    2e-15    
ref|NP_001147826.1|  aspartic-type endopeptidase/ pepsin A            85.9    2e-15    
ref|XP_006403926.1|  hypothetical protein EUTSA_v10010308mg           85.5    2e-15    
gb|KGN48951.1|  hypothetical protein Csa_6G507250                     85.1    3e-15    
emb|CDX78000.1|  BnaA09g31950D                                        84.7    4e-15    
gb|ACG43422.1|  aspartic-type endopeptidase/ pepsin A                 84.7    4e-15    
ref|XP_009115814.1|  PREDICTED: aspartic proteinase-like protein 1    84.3    5e-15    
ref|XP_008667842.1|  PREDICTED: uncharacterized protein LOC100279...  84.3    5e-15    
ref|XP_010503830.1|  PREDICTED: aspartic proteinase-like protein ...  83.2    6e-15    
ref|XP_006292525.1|  hypothetical protein CARUB_v10018764mg           83.2    1e-14    
emb|CDX73727.1|  BnaC08g22760D                                        83.2    1e-14    
ref|XP_010503829.1|  PREDICTED: aspartic proteinase-like protein ...  82.8    2e-14    
ref|XP_011658499.1|  PREDICTED: aspartic proteinase-like protein 1    82.8    2e-14    
gb|KFK34378.1|  hypothetical protein AALP_AA5G137500                  82.8    2e-14    
ref|XP_010426691.1|  PREDICTED: aspartic proteinase-like protein 1    82.8    2e-14    
ref|XP_006343425.1|  PREDICTED: aspartic proteinase-like protein ...  81.6    5e-14    
gb|EYU37083.1|  hypothetical protein MIMGU_mgv1a026712mg              80.1    7e-14    
ref|NP_190704.2|  aspartyl protease family protein                    80.5    1e-13    
ref|XP_002877799.1|  hypothetical protein ARALYDRAFT_906483           80.1    1e-13    
ref|XP_010426689.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  80.1    2e-13    
gb|KFK34381.1|  hypothetical protein AALP_AA5G137800                  79.7    2e-13    
ref|XP_002877801.1|  aspartyl protease family protein                 79.0    4e-13    
gb|EEE70143.1|  hypothetical protein OsJ_30189                        76.3    3e-12    
gb|KEH20367.1|  eukaryotic aspartyl protease family protein           71.2    1e-10    
ref|XP_010507390.1|  PREDICTED: aspartic proteinase-like protein 1    70.5    1e-10    
gb|ADM76760.1|  aspartyl protease-like protein                        65.9    4e-10    
gb|ADM76762.1|  aspartyl protease-like protein                        65.5    4e-10    
gb|ADM76761.1|  aspartyl protease-like protein                        65.5    4e-10    
gb|EMS45701.1|  Aspartic proteinase-like protein 1                    68.9    5e-10    
emb|CAN63378.1|  hypothetical protein VITISV_015700                   68.2    1e-09    
gb|KDO71328.1|  hypothetical protein CISIN_1g010129mg                 65.1    1e-08    
ref|XP_011014856.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    2e-08    
ref|XP_011014855.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    2e-08    
gb|EYU44070.1|  hypothetical protein MIMGU_mgv1a023396mg              64.7    2e-08    
gb|KJB17585.1|  hypothetical protein B456_003G006400                  63.9    3e-08    
gb|AIU50176.1|  aspartyl protease family protein                      63.5    4e-08    
gb|EYU37084.1|  hypothetical protein MIMGU_mgv1a0223402mg             62.4    5e-08    
ref|XP_007804147.1|  hypothetical protein EPUS_00299                  62.0    2e-07    
ref|XP_010941345.1|  PREDICTED: aspartic proteinase-like protein ...  61.6    2e-07    
ref|XP_006383048.1|  hypothetical protein POPTR_0005s11050g           61.2    3e-07    
ref|XP_010671691.1|  PREDICTED: aspartic proteinase-like protein 1    55.8    1e-06    
ref|XP_009363450.1|  PREDICTED: aspartic proteinase-like protein ...  59.3    1e-06    
gb|EYU28253.1|  hypothetical protein MIMGU_mgv1a018176mg              58.9    1e-06    
gb|AIU50161.1|  aspartyl protease family protein                      58.9    1e-06    
tpg|DAA64286.1|  TPA: hypothetical protein ZEAMMB73_677781            55.8    1e-06    
ref|XP_004245764.1|  PREDICTED: aspartic proteinase nepenthesin-1     58.2    3e-06    
gb|KDO71330.1|  hypothetical protein CISIN_1g010129mg                 57.4    5e-06    
gb|EMT22111.1|  hypothetical protein F775_42924                       56.6    7e-06    
ref|XP_006425379.1|  hypothetical protein CICLE_v10025374mg           56.6    8e-06    



>ref|XP_009606652.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=428

 Score =   315 bits (808),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 200/249 (80%), Gaps = 0/249 (0%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            VPHSFSL FD+S+SG IFFGDQGP NQR + F+ L+GNYN YIVEV+ YC+  +CLKQ+G
Sbjct  165  VPHSFSLCFDKSNSGTIFFGDQGPENQRLSSFVSLDGNYNTYIVEVQRYCLGGTCLKQNG  224

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
            F+A VDSGSSFT LP E + KVV +F+E +NATR + + F YCYKA S+GLPNIPSMKL+
Sbjct  225  FQALVDSGSSFTYLPSEIFTKVVTEFEEQINATRLATEDFPYCYKASSQGLPNIPSMKLV  284

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
            L+ANQSFVIQNP+F I + QG   YC+G+LPIEG+ G+IGQN M GYRMVFDWEN+KLGW
Sbjct  285  LAANQSFVIQNPVFTISSGQGDNFYCVGILPIEGMIGIIGQNLMQGYRMVFDWENMKLGW  344

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaasPC  105
            S S C+D+  + KVP TP P GL+++PLPTNEQQR P GHAVAPA+AG+A  +PSAAS  
Sbjct  345  SYSKCQDIGGSAKVPPTPPPSGLASNPLPTNEQQRNPGGHAVAPAIAGKATLKPSAASLH  404

Query  104  TIHYQHCTL  78
             +  +HC +
Sbjct  405  AVSCRHCAM  413



>ref|XP_009804210.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=424

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 200/266 (75%), Gaps = 6/266 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +PHSFSL FD+++SG IFFGDQGP NQR + F+ L+GNYN YIVEV+ YC   +CLKQSG
Sbjct  165  LPHSFSLCFDKTNSGTIFFGDQGPENQRLSSFVSLDGNYNTYIVEVQRYCFGGTCLKQSG  224

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
            F+A VDSGSSFT LP E + KVV +F+E +NATR + + F YCYKA S GLPNIPSMKL+
Sbjct  225  FQALVDSGSSFTYLPSEIFPKVVTEFEEQINATRLATEDFPYCYKASSRGLPNIPSMKLV  284

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
            L+ANQSFVIQ+P+F I + QG   YC+G+LPIEG+ G+IGQN M GYRMVFDWEN+KLGW
Sbjct  285  LAANQSFVIQSPVFTISSDQGDNFYCVGILPIEGMIGIIGQNLMEGYRMVFDWENMKLGW  344

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaasPC  105
            S S C+D+  + KVP TP P GL+++PLPTNEQQR+P GHAVAPA+AG+           
Sbjct  345  SHSKCQDIGGSAKVPPTPPPSGLASNPLPTNEQQRSPGGHAVAPAIAGKPSAASLH----  400

Query  104  TIHYQHCTLILILLMLQSFVWLCCLV  27
             + Y HC +  +LL     VWL  L+
Sbjct  401  AVSYWHCAMSSLLLSF--VVWLPYLI  424



>ref|XP_009606651.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=527

 Score =   317 bits (811),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 200/249 (80%), Gaps = 0/249 (0%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            VPHSFSL FD+S+SG IFFGDQGP NQR + F+ L+GNYN YIVEV+ YC+  +CLKQ+G
Sbjct  264  VPHSFSLCFDKSNSGTIFFGDQGPENQRLSSFVSLDGNYNTYIVEVQRYCLGGTCLKQNG  323

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
            F+A VDSGSSFT LP E + KVV +F+E +NATR + + F YCYKA S+GLPNIPSMKL+
Sbjct  324  FQALVDSGSSFTYLPSEIFTKVVTEFEEQINATRLATEDFPYCYKASSQGLPNIPSMKLV  383

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
            L+ANQSFVIQNP+F I + QG   YC+G+LPIEG+ G+IGQN M GYRMVFDWEN+KLGW
Sbjct  384  LAANQSFVIQNPVFTISSGQGDNFYCVGILPIEGMIGIIGQNLMQGYRMVFDWENMKLGW  443

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaasPC  105
            S S C+D+  + KVP TP P GL+++PLPTNEQQR P GHAVAPA+AG+A  +PSAAS  
Sbjct  444  SYSKCQDIGGSAKVPPTPPPSGLASNPLPTNEQQRNPGGHAVAPAIAGKATLKPSAASLH  503

Query  104  TIHYQHCTL  78
             +  +HC +
Sbjct  504  AVSCRHCAM  512



>ref|XP_009804209.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Nicotiana 
sylvestris]
Length=523

 Score =   316 bits (809),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 200/266 (75%), Gaps = 6/266 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +PHSFSL FD+++SG IFFGDQGP NQR + F+ L+GNYN YIVEV+ YC   +CLKQSG
Sbjct  264  LPHSFSLCFDKTNSGTIFFGDQGPENQRLSSFVSLDGNYNTYIVEVQRYCFGGTCLKQSG  323

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
            F+A VDSGSSFT LP E + KVV +F+E +NATR + + F YCYKA S GLPNIPSMKL+
Sbjct  324  FQALVDSGSSFTYLPSEIFPKVVTEFEEQINATRLATEDFPYCYKASSRGLPNIPSMKLV  383

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
            L+ANQSFVIQ+P+F I + QG   YC+G+LPIEG+ G+IGQN M GYRMVFDWEN+KLGW
Sbjct  384  LAANQSFVIQSPVFTISSDQGDNFYCVGILPIEGMIGIIGQNLMEGYRMVFDWENMKLGW  443

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaasPC  105
            S S C+D+  + KVP TP P GL+++PLPTNEQQR+P GHAVAPA+AG+           
Sbjct  444  SHSKCQDIGGSAKVPPTPPPSGLASNPLPTNEQQRSPGGHAVAPAIAGKPSAASLH----  499

Query  104  TIHYQHCTLILILLMLQSFVWLCCLV  27
             + Y HC +  +LL     VWL  L+
Sbjct  500  AVSYWHCAMSSLLLSF--VVWLPYLI  523



>ref|XP_004237880.1| PREDICTED: aspartic proteinase-like protein 1 [Solanum lycopersicum]
Length=528

 Score =   308 bits (790),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 168/268 (63%), Positives = 205/268 (76%), Gaps = 7/268 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            VP SFSL F +S+SG IFFGD+GP NQR + F+ L+ NYN Y+VEV+HYCV  +C KQSG
Sbjct  266  VPRSFSLCFGKSNSGTIFFGDKGPENQRRSSFVSLDENYNTYVVEVQHYCVGGTCPKQSG  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
            F+A VDSGSSFT LP E + KVV +F+E MN TR +I+ F  CYKA S+GLPNIPSMKL+
Sbjct  326  FQALVDSGSSFTFLPSEIFTKVVTEFEEQMNVTRLAIEDFPCCYKASSQGLPNIPSMKLL  385

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
            L+ANQSFVIQNPMF I + QG   YC+G+LPIEG+ G+IGQNFM GYR+VFDWEN+KLGW
Sbjct  386  LAANQSFVIQNPMFTISSSQGDNFYCVGLLPIEGMIGIIGQNFMEGYRLVFDWENMKLGW  445

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaasPC  105
            S S C+D+D   KV  TP P GL+++PLPT EQQR P GHAVAPA+AG+A P+PSAAS  
Sbjct  446  SRSKCQDIDGTAKVSPTPPPSGLTSNPLPTTEQQRNPGGHAVAPAIAGKATPKPSAASLL  505

Query  104  TI--HYQHCTLILILLMLQSFVWLCCLV  27
             I  HY   +LI +L+     VWL  L+
Sbjct  506  AISRHYTMSSLIFLLV-----VWLPYLI  528



>emb|CDP21094.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            VPHSFS  FD S+SGR++FGDQGP  QR T F+P +G Y+ Y +EVE YC+ S CLKQ+G
Sbjct  249  VPHSFSYCFDNSYSGRMYFGDQGPATQRSTTFVPYKGEYSGYFIEVEDYCIGSFCLKQNG  308

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
            F+AQVDSGSSFT LP E YK  V +FD+ MNATRS I+ F YCYKARS G P++PS+K  
Sbjct  309  FQAQVDSGSSFTYLPSEDYKLFVAEFDKQMNATRSGIEKFPYCYKARSHGQPDVPSIKFK  368

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
             + NQSFVI+NPMF I++YQG   YCLG+ P++G  G+IGQNFM GYR+VFDWENLKLGW
Sbjct  369  FALNQSFVIENPMFHIIDYQGDDLYCLGIQPLDGGIGIIGQNFMMGYRLVFDWENLKLGW  428

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            S SNC+D+ D+D+V +TP+P   + +PLPTNEQQRTP GH
Sbjct  429  SHSNCQDIRDSDRVHLTPSPNS-AVNPLPTNEQQRTPGGH  467



>ref|XP_011098089.1| PREDICTED: aspartic proteinase-like protein 1 [Sesamum indicum]
Length=532

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 166/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +PHSFS  +D+S+SGR++FGDQGP +Q+ T  LPLEGN   YIVEVE YCV SSCL ++G
Sbjct  271  IPHSFSFCYDKSYSGRLYFGDQGPSSQKSTSLLPLEGNSLAYIVEVETYCVGSSCLNKTG  330

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
             +AQVD+GSSFT LP E+Y++V ++F    NATR +I  F  CYKAR+  +PNIPSMKL+
Sbjct  331  NKAQVDTGSSFTYLPSESYEQVASEFHRQANATRITIQGFENCYKARALKVPNIPSMKLV  390

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
             S NQS +I+NPMF I + QG   YCLG+  I+G  GLIGQNF+ GYRMVFDWE LKLGW
Sbjct  391  FSMNQSLLIENPMFHIADDQG-GLYCLGIQRIDGDIGLIGQNFLMGYRMVFDWEKLKLGW  449

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            S SNC+D+  +D++   P P   S +PLPTNEQQ+ P+GH
Sbjct  450  SNSNCQDIASDDEIHSKPPPSDASPNPLPTNEQQQNPHGH  489



>gb|EYU43596.1| hypothetical protein MIMGU_mgv1a0074171mg, partial [Erythranthe 
guttata]
Length=303

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 164/222 (74%), Gaps = 4/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +PHSFS  +D+S+SGR++FGD+GP +Q  T FLPL+     YIVEVE Y V SS LK++G
Sbjct  38   IPHSFSFCYDKSYSGRLYFGDEGPTSQSSTSFLPLK-ETRAYIVEVEGYSVGSSSLKETG  96

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
            ++AQVD+GSSFT LP E+Y+ V ++F   +NAT+ +   F  CYKARS  + NIPSMKL+
Sbjct  97   YKAQVDTGSSFTYLPTESYEHVASEFHRQVNATKITTQNFENCYKARSLNVENIPSMKLV  156

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
             S NQ+FVI+NPMF I + QG   YCLG+LPI+G  G+IGQNF+ GYR+VFDW+ +KLGW
Sbjct  157  FSTNQTFVIENPMFHIADDQG-GVYCLGILPIDGDIGIIGQNFLMGYRLVFDWDKMKLGW  215

Query  284  SASNCKDLDDNDKVPVT--PTPGGLSASPLPTNEQQRTPNGH  165
            S SNC+D+D+  K  +T  P+    S  PLPTN+Q + PNGH
Sbjct  216  STSNCEDIDNGGKFHITPSPSDSESSPYPLPTNQQHQNPNGH  257



>ref|XP_010652837.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Vitis 
vinifera]
Length=424

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 159/222 (72%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F+   SGRIFFGDQG   Q+ T FLP +G Y  YIV VE  C+ SSC+KQ+ 
Sbjct  157  VKNSFSLCFNDDDSGRIFFGDQGLATQQTTLFLPSDGKYETYIVGVEACCIGSSCIKQTS  216

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            FRA VDSG+SFT LP E+Y+ VV++FD+ +NATR S + +   YCYK+ S+ L   PS+ 
Sbjct  217  FRALVDSGASFTFLPDESYRNVVDEFDKQVNATRFSFEGYPWEYCYKSSSKELLKNPSVI  276

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  + N SFV+ NP+F +  YQGV  +CL + P +G  G++GQNFMTGYRMVFD ENLKL
Sbjct  277  LKFALNNSFVVHNPVFVVHGYQGVVGFCLAIQPADGDIGILGQNFMTGYRMVFDRENLKL  336

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL D +++P+TP+P     +PLP NEQQ T +GH
Sbjct  337  GWSRSNCQDLTDGERMPLTPSPNDRPPNPLPANEQQNTHSGH  378



>ref|XP_010261202.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Nelumbo 
nucifera]
Length=447

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 157/222 (71%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F    SGRIFFGDQG   Q+ TPFLPLEG Y  YIV VE  C+ +SCL Q+G
Sbjct  181  IRNSFSICFGDDDSGRIFFGDQGFATQQSTPFLPLEGKYITYIVGVEGCCIGNSCLHQTG  240

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRS-SIDVFHYCYK-ARSEGLPNIPSMK  471
            F+AQ+DSGSSFT LP E Y+KVV +FD  +NATRS    +  YCY+ + S+GL NIP++ 
Sbjct  241  FQAQIDSGSSFTFLPDEVYQKVVTEFDRQVNATRSYKGSLLDYCYEPSTSQGLLNIPAVI  300

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+ + N SFV+ NP   I   Q V  +CL +   EG +G+IGQNFMTGYR+VFD ENLKL
Sbjct  301  LMFAPNNSFVVHNPTIFIYANQDVVGFCLAIQRTEGNFGVIGQNFMTGYRLVFDRENLKL  360

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL D   +P+TP P     +PLPTNEQQRTPNG 
Sbjct  361  GWSRSNCQDLTDGRSIPLTPPPYDRPENPLPTNEQQRTPNGR  402



>ref|XP_002281243.2| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Vitis 
vinifera]
 emb|CBI21469.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 159/222 (72%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F+   SGRIFFGDQG   Q+ T FLP +G Y  YIV VE  C+ SSC+KQ+ 
Sbjct  263  VKNSFSLCFNDDDSGRIFFGDQGLATQQTTLFLPSDGKYETYIVGVEACCIGSSCIKQTS  322

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            FRA VDSG+SFT LP E+Y+ VV++FD+ +NATR S + +   YCYK+ S+ L   PS+ 
Sbjct  323  FRALVDSGASFTFLPDESYRNVVDEFDKQVNATRFSFEGYPWEYCYKSSSKELLKNPSVI  382

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  + N SFV+ NP+F +  YQGV  +CL + P +G  G++GQNFMTGYRMVFD ENLKL
Sbjct  383  LKFALNNSFVVHNPVFVVHGYQGVVGFCLAIQPADGDIGILGQNFMTGYRMVFDRENLKL  442

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL D +++P+TP+P     +PLP NEQQ T +GH
Sbjct  443  GWSRSNCQDLTDGERMPLTPSPNDRPPNPLPANEQQNTHSGH  484



>ref|XP_002528982.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF33401.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=542

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 158/222 (71%), Gaps = 3/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ TPFL L+GNY  Y+V VE +CV SSCLKQ+ 
Sbjct  276  IRNSFSMCFDEDDSGRIFFGDQGPTTQQSTPFLTLDGNYTTYVVGVEGFCVGSSCLKQTS  335

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            FRA VD+G+SFT LP   Y+++  +FD  +NAT SS + +   YCYK+ S  L  +PS+K
Sbjct  336  FRALVDTGTSFTFLPNGVYERITEEFDRQVNATISSFNGYPWKYCYKSSSNHLTKVPSVK  395

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI   N SFVI NP+F I   QG+  +CL + P EG  G IGQNFM GYR+VFD EN+KL
Sbjct  396  LIFPLNNSFVIHNPVFMIYGIQGITGFCLAIQPTEGDIGTIGQNFMAGYRVVFDRENMKL  455

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS S+C+D  ++ ++P+T +P G   +PLPTNEQQ +P GH
Sbjct  456  GWSHSSCEDRSNDKRMPLT-SPNGTLVNPLPTNEQQSSPGGH  496



>ref|XP_010261201.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Nelumbo 
nucifera]
Length=530

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 157/222 (71%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F    SGRIFFGDQG   Q+ TPFLPLEG Y  YIV VE  C+ +SCL Q+G
Sbjct  264  IRNSFSICFGDDDSGRIFFGDQGFATQQSTPFLPLEGKYITYIVGVEGCCIGNSCLHQTG  323

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRS-SIDVFHYCYK-ARSEGLPNIPSMK  471
            F+AQ+DSGSSFT LP E Y+KVV +FD  +NATRS    +  YCY+ + S+GL NIP++ 
Sbjct  324  FQAQIDSGSSFTFLPDEVYQKVVTEFDRQVNATRSYKGSLLDYCYEPSTSQGLLNIPAVI  383

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+ + N SFV+ NP   I   Q V  +CL +   EG +G+IGQNFMTGYR+VFD ENLKL
Sbjct  384  LMFAPNNSFVVHNPTIFIYANQDVVGFCLAIQRTEGNFGVIGQNFMTGYRLVFDRENLKL  443

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL D   +P+TP P     +PLPTNEQQRTPNG 
Sbjct  444  GWSRSNCQDLTDGRSIPLTPPPYDRPENPLPTNEQQRTPNGR  485



>gb|KDO43757.1| hypothetical protein CISIN_1g0095931mg [Citrus sinensis]
Length=301

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 155/222 (70%), Gaps = 3/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ T FL   G Y  YI+ VE  C+ SSCLKQ+ 
Sbjct  36   IRNSFSMCFDKDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTS  95

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHY--CYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP E Y+ +  +FD  +N T +S + + +  CYK+ S+ LP +PS+K
Sbjct  96   FKAIVDSGSSFTFLPKEVYETIAAEFDRQVNDTITSFEGYPWKCCYKSSSQRLPKLPSVK  155

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F I   Q V  +CL + P++G  G IGQNFMTGYR+VFD ENLKL
Sbjct  156  LMFPQNNSFVVNNPVFVIYGTQVVTGFCLAIQPVDGDIGTIGQNFMTGYRVVFDRENLKL  215

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL+D  K P+TP P G  ++PLP N++Q +P GH
Sbjct  216  GWSHSNCQDLNDGTKSPLTPGP-GTPSNPLPANQEQSSPGGH  256



>ref|XP_011039550.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Populus 
euphratica]
Length=429

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 154/222 (69%), Gaps = 4/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F++  SGRIFFGDQGP  Q+  PFL L GNY  YIV VE  CV +SCLKQS 
Sbjct  165  IQNSFSMCFNEDDSGRIFFGDQGPTTQQSAPFLKLNGNYTTYIVGVEVCCVGTSCLKQSS  224

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP + ++ +  +FD  +NA+RSS +   + YCYK  S+ LP IPS++
Sbjct  225  FSALVDSGTSFTFLPDDVFEMIAEEFDTQVNASRSSFEGYSWKYCYKTSSQDLPKIPSLR  284

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI   N SF++QNP+F I   QGV  +CL + P +G  G IGQNFM GYR+VFD ENLKL
Sbjct  285  LIFPQNNSFMVQNPVFMIYGIQGVIGFCLAIQPADGDIGTIGQNFMMGYRVVFDRENLKL  344

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC D  D   +P+TP+  G   +PLPTNEQQ TP G+
Sbjct  345  GWSRSNCGDEGDGKTLPLTPS--GTPQNPLPTNEQQSTPGGN  384



>gb|KDO43754.1| hypothetical protein CISIN_1g0095931mg, partial [Citrus sinensis]
 gb|KDO43755.1| hypothetical protein CISIN_1g0095931mg, partial [Citrus sinensis]
Length=384

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 155/222 (70%), Gaps = 3/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ T FL   G Y  YI+ VE  C+ SSCLKQ+ 
Sbjct  119  IRNSFSMCFDKDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTS  178

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHY--CYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP E Y+ +  +FD  +N T +S + + +  CYK+ S+ LP +PS+K
Sbjct  179  FKAIVDSGSSFTFLPKEVYETIAAEFDRQVNDTITSFEGYPWKCCYKSSSQRLPKLPSVK  238

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F I   Q V  +CL + P++G  G IGQNFMTGYR+VFD ENLKL
Sbjct  239  LMFPQNNSFVVNNPVFVIYGTQVVTGFCLAIQPVDGDIGTIGQNFMTGYRVVFDRENLKL  298

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL+D  K P+TP P G  ++PLP N++Q +P GH
Sbjct  299  GWSHSNCQDLNDGTKSPLTPGP-GTPSNPLPANQEQSSPGGH  339



>gb|KDO43752.1| hypothetical protein CISIN_1g0095931mg [Citrus sinensis]
 gb|KDO43753.1| hypothetical protein CISIN_1g0095931mg [Citrus sinensis]
Length=386

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 155/222 (70%), Gaps = 3/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ T FL   G Y  YI+ VE  C+ SSCLKQ+ 
Sbjct  121  IRNSFSMCFDKDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTS  180

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHY--CYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP E Y+ +  +FD  +N T +S + + +  CYK+ S+ LP +PS+K
Sbjct  181  FKAIVDSGSSFTFLPKEVYETIAAEFDRQVNDTITSFEGYPWKCCYKSSSQRLPKLPSVK  240

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F I   Q V  +CL + P++G  G IGQNFMTGYR+VFD ENLKL
Sbjct  241  LMFPQNNSFVVNNPVFVIYGTQVVTGFCLAIQPVDGDIGTIGQNFMTGYRVVFDRENLKL  300

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL+D  K P+TP P G  ++PLP N++Q +P GH
Sbjct  301  GWSHSNCQDLNDGTKSPLTPGP-GTPSNPLPANQEQSSPGGH  341



>ref|XP_010269163.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Nelumbo 
nucifera]
Length=447

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 156/222 (70%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F++  SGRIFFGDQG   Q+ TPFLPL+G Y  Y+V V+  C+ +SCLKQ+ 
Sbjct  181  IRNSFSMCFNEDDSGRIFFGDQGFATQQSTPFLPLDGKYITYMVGVQSCCIGNSCLKQTS  240

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+AQ+DSG+SFT LP E YKKV  +F+  +N+TR S   F   YCY+A SE L +IPS+ 
Sbjct  241  FQAQIDSGTSFTFLPDEVYKKVTAEFERQVNSTRLSTKGFLWDYCYEASSERLLSIPSVV  300

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+ + N SFV++NP F   + QGV  +CL +   EG +G+IGQNFM GYR+VFD ENLKL
Sbjct  301  LMFAPNNSFVVRNPTFLFYDNQGVSRFCLAIQRAEGNFGIIGQNFMMGYRIVFDRENLKL  360

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL D   +P+TP       +PLPTNEQQ TP G 
Sbjct  361  GWSRSNCQDLSDGKAMPLTPPAHDRPENPLPTNEQQSTPTGR  402



>ref|XP_011039549.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Populus 
euphratica]
Length=531

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 154/222 (69%), Gaps = 4/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F++  SGRIFFGDQGP  Q+  PFL L GNY  YIV VE  CV +SCLKQS 
Sbjct  267  IQNSFSMCFNEDDSGRIFFGDQGPTTQQSAPFLKLNGNYTTYIVGVEVCCVGTSCLKQSS  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP + ++ +  +FD  +NA+RSS +   + YCYK  S+ LP IPS++
Sbjct  327  FSALVDSGTSFTFLPDDVFEMIAEEFDTQVNASRSSFEGYSWKYCYKTSSQDLPKIPSLR  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI   N SF++QNP+F I   QGV  +CL + P +G  G IGQNFM GYR+VFD ENLKL
Sbjct  387  LIFPQNNSFMVQNPVFMIYGIQGVIGFCLAIQPADGDIGTIGQNFMMGYRVVFDRENLKL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC D  D   +P+TP+  G   +PLPTNEQQ TP G+
Sbjct  447  GWSRSNCGDEGDGKTLPLTPS--GTPQNPLPTNEQQSTPGGN  486



>ref|XP_004304837.1| PREDICTED: aspartic proteinase-like protein 1 [Fragaria vesca 
subsp. vesca]
Length=539

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 152/221 (69%), Gaps = 2/221 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+  D+  SGRIFFGDQGP  Q+ T FLP  GNY  YIV VE  C+ +SCLKQ+ 
Sbjct  279  ITNSFSMCVDEEGSGRIFFGDQGPSTQQSTSFLPSNGNYETYIVGVEACCIGNSCLKQTS  338

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            FRA VDSG+SFT LP E Y K+V +FD+ +NAT +S +   + YCYK  S+ L  +PS+ 
Sbjct  339  FRALVDSGTSFTFLPEEVYDKIVVEFDKRVNATITSYEGSPWKYCYKTSSQDLLKVPSVT  398

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+  AN SFV+ +P+FP+   QG+   CL + P +G  G IGQNFMTGYR VFD EN+KL
Sbjct  399  LMFLANNSFVVHDPIFPMYGNQGLDGICLAIQPADGDIGTIGQNFMTGYRTVFDRENMKL  458

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNG  168
            GWS S C+DL D   +P+TP+P G    PLPT EQQ TP G
Sbjct  459  GWSHSKCQDLGDAKSMPLTPSPKGTPPIPLPTTEQQSTPGG  499



>ref|XP_007205026.1| hypothetical protein PRUPE_ppa003982mg [Prunus persica]
 gb|EMJ06225.1| hypothetical protein PRUPE_ppa003982mg [Prunus persica]
Length=536

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 151/219 (69%), Gaps = 3/219 (1%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGR+FFGDQGP  Q+ T FLP  GNY  YIV VE  C+E+SCLKQ+ F+
Sbjct  275  NSFSMCFDEDDSGRLFFGDQGPAAQQSTSFLPSNGNYETYIVGVEACCIENSCLKQTSFK  334

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMKLI  465
            A VDSG+SFT LP   Y K+  +FD  +NAT ++     + YCY   S+ LP +PS+ L+
Sbjct  335  ALVDSGTSFTFLPEALYDKISEEFDRQVNATITNYAGSPWKYCYNTSSQDLPKVPSVTLM  394

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
              AN SFV+ +P+FPI   QGV  +CL + P +G  G IGQNFMTGYR VFD ENLKLGW
Sbjct  395  FVANNSFVVHDPVFPINGNQGVVGFCLAIQPTDGDIGTIGQNFMTGYRTVFDRENLKLGW  454

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNG  168
            S SNC+D  D   +P+TP+  G   +PLPTNEQQ TP G
Sbjct  455  SRSNCQDFSDAKSMPLTPSK-GTPPNPLPTNEQQSTPGG  492



>ref|XP_010269161.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Nelumbo 
nucifera]
Length=530

 Score =   244 bits (623),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 156/222 (70%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F++  SGRIFFGDQG   Q+ TPFLPL+G Y  Y+V V+  C+ +SCLKQ+ 
Sbjct  264  IRNSFSMCFNEDDSGRIFFGDQGFATQQSTPFLPLDGKYITYMVGVQSCCIGNSCLKQTS  323

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+AQ+DSG+SFT LP E YKKV  +F+  +N+TR S   F   YCY+A SE L +IPS+ 
Sbjct  324  FQAQIDSGTSFTFLPDEVYKKVTAEFERQVNSTRLSTKGFLWDYCYEASSERLLSIPSVV  383

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+ + N SFV++NP F   + QGV  +CL +   EG +G+IGQNFM GYR+VFD ENLKL
Sbjct  384  LMFAPNNSFVVRNPTFLFYDNQGVSRFCLAIQRAEGNFGIIGQNFMMGYRIVFDRENLKL  443

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL D   +P+TP       +PLPTNEQQ TP G 
Sbjct  444  GWSRSNCQDLSDGKAMPLTPPAHDRPENPLPTNEQQSTPTGR  485



>ref|XP_010099945.1| Aspartic proteinase-like protein 1 [Morus notabilis]
 gb|EXB80874.1| Aspartic proteinase-like protein 1 [Morus notabilis]
Length=558

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 157/224 (70%), Gaps = 4/224 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPL--EGNYNKYIVEVEHYCVESSCLKQ  651
            V +SFSL FD+ +SGRIFFGDQGP NQ+ T FLP    GNY+ YIV V+ +C+ +SC+KQ
Sbjct  284  VRNSFSLCFDEDNSGRIFFGDQGPVNQQSTSFLPSTPNGNYDTYIVGVQAFCIGNSCMKQ  343

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPS  477
            +GF+A VDSG+SFT +P E Y+KV  +FD  +NATR+S + +   YCYK  S+ LP IPS
Sbjct  344  TGFKALVDSGTSFTYVPQEVYEKVSKEFDRRVNATRTSYEGYPWKYCYKTSSQALPKIPS  403

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L+  AN SFV+  P+FPI   +G   +CL + P +   G IGQNFMTGYRMVFD E L
Sbjct  404  VVLVFPANNSFVVSYPIFPINGEEGAIGFCLAIQPGDEEIGTIGQNFMTGYRMVFDREAL  463

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            KLGWS SNC+DL D   + +TP   G  ++PLPTNEQQ T   H
Sbjct  464  KLGWSRSNCQDLTDAKNMNLTPPTKGTPSNPLPTNEQQSTHGEH  507



>ref|XP_012093314.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Jatropha 
curcas]
Length=440

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 154/222 (69%), Gaps = 9/222 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ TPFL L GNY  YIV V+ +CV SSCLKQ+ 
Sbjct  181  IRNSFSMCFDEDDSGRIFFGDQGPSTQQSTPFLTLNGNYTTYIVGVDAFCVGSSCLKQTS  240

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            FRA VD+G+SFT LP + Y+++  +FD  +NAT SS + +   YCYK+ S  +P +PS++
Sbjct  241  FRALVDTGTSFTFLPVDIYERITKEFDRQVNATISSFEGYPWKYCYKSSSN-MPKVPSLQ  299

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    N SFVI NP+F I + QG+  +CL V P +   G +GQNFM GYR+VFD ENLKL
Sbjct  300  LTFPLNNSFVIHNPVFMIYDMQGISGFCLAVQPTDEDIGTLGQNFMMGYRVVFDRENLKL  359

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS S+C+  DD  ++P+TP       +PLPTNEQQ  P GH
Sbjct  360  GWSRSSCEFRDDGKRMPLTPL------NPLPTNEQQSAPGGH  395



>ref|XP_008233626.1| PREDICTED: aspartic proteinase-like protein 1 [Prunus mume]
Length=536

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 150/219 (68%), Gaps = 3/219 (1%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGR+FFGDQGP  Q+ T FLP  GNY  YIV VE  C+ +SCLKQ+ F+
Sbjct  275  NSFSMCFDEDDSGRLFFGDQGPATQQSTSFLPSNGNYETYIVGVEACCIGNSCLKQTNFK  334

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMKLI  465
            A VDSG+SFT LP   Y K+  +FD  +NAT ++     + YCY   S+ LP +PS+ L+
Sbjct  335  ALVDSGTSFTFLPEAVYDKISKEFDRQVNATITNYAGSPWKYCYNTSSQDLPKVPSVTLM  394

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
              AN SFV+ +P+FPI   QGV  +CL + P +G  G IGQNFMTGYR VFD ENLKLGW
Sbjct  395  FVANNSFVVHDPVFPINGNQGVVGFCLAIQPTDGDIGTIGQNFMTGYRTVFDRENLKLGW  454

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNG  168
            S SNC+D  D   +P+TP+  G   +PLPTNEQQ TP G
Sbjct  455  SRSNCQDFSDAKSMPLTPSK-GTPPNPLPTNEQQSTPGG  492



>ref|XP_006472655.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X2 
[Citrus sinensis]
Length=422

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 153/222 (69%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD++ SG +FFGDQGP  Q+ T FLP+   Y+ Y V VE YC+ +SCL QSG
Sbjct  157  IQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPIGEKYDAYFVGVESYCIGNSCLTQSG  216

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP E Y +VV KFD+L+++ R S+  + + YCY A SE +  +P M+
Sbjct  217  FQALVDSGASFTFLPTEIYAEVVVKFDKLVSSKRISLQGNSWKYCYNASSEEMLKVPDMR  276

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI S NQSFV++N +F     +G   +CL V+  +G YG+IGQNFM G+RMVFD ENLKL
Sbjct  277  LIFSKNQSFVVRNHIFSFPENEGFTVFCLTVMSTDGDYGIIGQNFMMGHRMVFDRENLKL  336

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             WS S C+++ D   V + P P G S +PLPT EQQ T NG 
Sbjct  337  AWSHSKCEEVIDKSHVHLVPPPAGQSPNPLPTTEQQSTSNGQ  378



>ref|XP_012093305.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Jatropha 
curcas]
 gb|KDP46891.1| hypothetical protein JCGZ_24100 [Jatropha curcas]
Length=528

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 154/222 (69%), Gaps = 9/222 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ TPFL L GNY  YIV V+ +CV SSCLKQ+ 
Sbjct  269  IRNSFSMCFDEDDSGRIFFGDQGPSTQQSTPFLTLNGNYTTYIVGVDAFCVGSSCLKQTS  328

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            FRA VD+G+SFT LP + Y+++  +FD  +NAT SS + +   YCYK+ S  +P +PS++
Sbjct  329  FRALVDTGTSFTFLPVDIYERITKEFDRQVNATISSFEGYPWKYCYKS-SSNMPKVPSLQ  387

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    N SFVI NP+F I + QG+  +CL V P +   G +GQNFM GYR+VFD ENLKL
Sbjct  388  LTFPLNNSFVIHNPVFMIYDMQGISGFCLAVQPTDEDIGTLGQNFMMGYRVVFDRENLKL  447

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS S+C+  DD  ++P+TP       +PLPTNEQQ  P GH
Sbjct  448  GWSRSSCEFRDDGKRMPLTPL------NPLPTNEQQSAPGGH  483



>ref|XP_006464280.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X3 
[Citrus sinensis]
Length=508

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 154/222 (69%), Gaps = 3/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ T FL   G Y  YI+ VE  C+ SSCLKQ+ 
Sbjct  243  IRNSFSMCFDEDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTI  302

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP + Y+ +  +FD  +N T +S + +   YCYK+ S+ LP +PS+K
Sbjct  303  FKAIVDSGSSFTFLPKDIYETIAAEFDRQVNDTITSFEGYPWKYCYKSSSQRLPKLPSVK  362

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV  NP+F I    GV  +CL + P +G  G IGQNFMTGYR+VFD ENLKL
Sbjct  363  LMFPQNNSFVANNPVFVIYGTPGVTGFCLAIQPADGDIGTIGQNFMTGYRVVFDRENLKL  422

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL+D+ K P+TP PG  S +PLP N++Q +P GH
Sbjct  423  GWSHSNCQDLNDSTKSPLTPGPGTPS-NPLPANQEQSSPGGH  463



>ref|XP_008440642.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Cucumis 
melo]
Length=452

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 159/227 (70%), Gaps = 12/227 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F++  SGRIFFGD+GP +Q+ T F+PL+G Y  YIV VE  C+E+SCLKQ+ 
Sbjct  184  VQNSFSLCFNEDGSGRIFFGDEGPASQQMTSFVPLDGKYETYIVGVEACCIENSCLKQTS  243

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV----FHYCYKARSEGLPNIPS  477
            F+A +DSG+SFT LP E Y+ +V +FD+ +N T S++      + YCYK  ++ +P +PS
Sbjct  244  FKALIDSGTSFTYLPEEAYENIVMEFDKRLNTT-SAVSFKGYPWKYCYKISADAMPKVPS  302

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L+   N SFV+ +P+FPI   QG+  +C  +LP +G  G++GQN+MTGYRMVFD +NL
Sbjct  303  VTLLFPLNNSFVVHDPVFPIYGDQGLAGFCFAILPADGDIGILGQNYMTGYRMVFDRDNL  362

Query  296  KLGWSASNCKDLDDNDKVPVTP---TPGGLSASPLPTNEQQRTPNGH  165
            KLGWS +NC+DL +  K+P+TP   TP     +PLP NEQQ    GH
Sbjct  363  KLGWSHANCQDLSNEKKMPLTPAKETP----PNPLPANEQQSASGGH  405



>gb|KGN48775.1| hypothetical protein Csa_6G500670 [Cucumis sativus]
Length=395

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 159/227 (70%), Gaps = 12/227 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F++  SGRIFFGD+GP +Q+ T F+PL+G Y  YIV VE  C+E+SCLKQ+ 
Sbjct  128  VQNSFSLCFNEDGSGRIFFGDEGPASQQTTSFVPLDGKYETYIVGVEACCIENSCLKQTS  187

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV----FHYCYKARSEGLPNIPS  477
            F+A +DSG+SFT LP E Y+ +V +FD+ +N T S++      + YCYK  ++ +P +PS
Sbjct  188  FKALIDSGTSFTYLPEEAYENIVIEFDKRLNTT-SAVSFKGYPWKYCYKISADAMPKVPS  246

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L+   N SFV+ +P+FPI   QG+  +C  +LP +G  G++GQN+MTGYRMVFD +NL
Sbjct  247  VTLLFPLNNSFVVHDPVFPIYGDQGLAGFCFAILPADGDIGILGQNYMTGYRMVFDRDNL  306

Query  296  KLGWSASNCKDLDDNDKVPVTP---TPGGLSASPLPTNEQQRTPNGH  165
            KLGWS +NC+DL +  K+P+TP   TP     +PLP +EQQ    GH
Sbjct  307  KLGWSHANCQDLSNEKKMPLTPAKETP----PNPLPADEQQSASGGH  349



>ref|XP_006464278.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X1 
[Citrus sinensis]
Length=531

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 154/222 (69%), Gaps = 3/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ T FL   G Y  YI+ VE  C+ SSCLKQ+ 
Sbjct  266  IRNSFSMCFDEDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTI  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP + Y+ +  +FD  +N T +S + +   YCYK+ S+ LP +PS+K
Sbjct  326  FKAIVDSGSSFTFLPKDIYETIAAEFDRQVNDTITSFEGYPWKYCYKSSSQRLPKLPSVK  385

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV  NP+F I    GV  +CL + P +G  G IGQNFMTGYR+VFD ENLKL
Sbjct  386  LMFPQNNSFVANNPVFVIYGTPGVTGFCLAIQPADGDIGTIGQNFMTGYRVVFDRENLKL  445

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL+D+ K P+TP PG  S +PLP N++Q +P GH
Sbjct  446  GWSHSNCQDLNDSTKSPLTPGPGTPS-NPLPANQEQSSPGGH  486



>ref|XP_008374327.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Malus 
domestica]
Length=428

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGR+ FGDQGP  Q+ T FLP  GNY  YIV VE  C+ +SCLK++ F+
Sbjct  167  NSFSMCFDEDSSGRLLFGDQGPATQQSTXFLPSNGNYEMYIVGVEACCIGNSCLKZTSFK  226

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMKLI  465
            A VDSG+SFT LP   Y K+  +FD  +NAT ++     + YCY    + LP +PS+ L+
Sbjct  227  ALVDSGTSFTFLPESVYNKIAXEFDRRVNATIANYAGSPWKYCYNTSYQDLPKVPSVTLM  286

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
              AN SFV+ +P+F I   QGV  +CL + P EG  G +GQNFMTGYR VFD ENLKLGW
Sbjct  287  FLANNSFVVHDPVFLIHGDQGVNGFCLAIQPAEGDTGTVGQNFMTGYRTVFDRENLKLGW  346

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNG  168
            S SNC+DL+D   +P+ P P G   +PLPTNEQQ TP G
Sbjct  347  SXSNCRDLNDVKSMPLAP-PKGAPPNPLPTNEQQSTPGG  384



>ref|XP_006434048.1| hypothetical protein CICLE_v10000815mg [Citrus clementina]
 gb|ESR47288.1| hypothetical protein CICLE_v10000815mg [Citrus clementina]
Length=421

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 153/222 (69%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD++ SG +FFGDQGP  Q+ T FLP+   Y+ Y V VE YC+ +SCL QSG
Sbjct  157  IQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPIGEKYDAYFVGVESYCIGNSCLTQSG  216

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP E Y +VV KFD+L+++ R S+  + + YCY A SE +  +P M+
Sbjct  217  FQALVDSGASFTFLPTEIYAEVVMKFDKLVSSRRISLQGNSWKYCYNASSEEMLKVPDMR  276

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI S NQSFV++N +F     +G   +CL V+  +G YG+IGQNFM G+R+VFD ENLKL
Sbjct  277  LIFSKNQSFVVRNHIFSFPENEGFTVFCLTVMSTDGDYGIIGQNFMMGHRIVFDRENLKL  336

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             WS S C+++ D   V + P P G S +PLPT +QQ T NG 
Sbjct  337  AWSHSKCEEVIDKSHVHLVPPPAGQSPNPLPTTDQQSTSNGQ  378



>ref|XP_002301033.1| hypothetical protein POPTR_0002s09270g [Populus trichocarpa]
 gb|EEE80306.1| hypothetical protein POPTR_0002s09270g [Populus trichocarpa]
Length=536

 Score =   239 bits (610),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 156/219 (71%), Gaps = 2/219 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + + FSL FD++ SGRI FGD+G  +Q+ TPFLP++G Y  Y V VE YCV +SCLK+SG
Sbjct  272  IQNCFSLCFDENDSGRILFGDRGHASQQSTPFLPIQGTYVAYFVGVESYCVGNSCLKRSG  331

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP E Y ++V++FD+ +NA R S    ++ YCY A S+ L +IP+++
Sbjct  332  FKALVDSGSSFTYLPSEVYNELVSEFDKQVNAKRISFQDGLWDYCYNASSQELHDIPAIQ  391

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    NQ+FV+ NP + I ++QG   +CL + P +G YG+IGQNFM GYRMVFD ENLKL
Sbjct  392  LKFPRNQNFVVHNPTYSIPHHQGFTMFCLSLQPTDGSYGIIGQNFMIGYRMVFDIENLKL  451

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            GWS S+C+D  D+  V + P P   S +PLPTNEQQ  P
Sbjct  452  GWSNSSCQDTSDSADVHLAPPPDNKSPNPLPTNEQQSIP  490



>ref|XP_006472654.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X1 
[Citrus sinensis]
Length=538

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 153/222 (69%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD++ SG +FFGDQGP  Q+ T FLP+   Y+ Y V VE YC+ +SCL QSG
Sbjct  273  IQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPIGEKYDAYFVGVESYCIGNSCLTQSG  332

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP E Y +VV KFD+L+++ R S+  + + YCY A SE +  +P M+
Sbjct  333  FQALVDSGASFTFLPTEIYAEVVVKFDKLVSSKRISLQGNSWKYCYNASSEEMLKVPDMR  392

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI S NQSFV++N +F     +G   +CL V+  +G YG+IGQNFM G+RMVFD ENLKL
Sbjct  393  LIFSKNQSFVVRNHIFSFPENEGFTVFCLTVMSTDGDYGIIGQNFMMGHRMVFDRENLKL  452

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             WS S C+++ D   V + P P G S +PLPT EQQ T NG 
Sbjct  453  AWSHSKCEEVIDKSHVHLVPPPAGQSPNPLPTTEQQSTSNGQ  494



>ref|XP_008440641.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Cucumis 
melo]
Length=534

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 159/227 (70%), Gaps = 12/227 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F++  SGRIFFGD+GP +Q+ T F+PL+G Y  YIV VE  C+E+SCLKQ+ 
Sbjct  266  VQNSFSLCFNEDGSGRIFFGDEGPASQQMTSFVPLDGKYETYIVGVEACCIENSCLKQTS  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV----FHYCYKARSEGLPNIPS  477
            F+A +DSG+SFT LP E Y+ +V +FD+ +N T S++      + YCYK  ++ +P +PS
Sbjct  326  FKALIDSGTSFTYLPEEAYENIVMEFDKRLNTT-SAVSFKGYPWKYCYKISADAMPKVPS  384

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L+   N SFV+ +P+FPI   QG+  +C  +LP +G  G++GQN+MTGYRMVFD +NL
Sbjct  385  VTLLFPLNNSFVVHDPVFPIYGDQGLAGFCFAILPADGDIGILGQNYMTGYRMVFDRDNL  444

Query  296  KLGWSASNCKDLDDNDKVPVTP---TPGGLSASPLPTNEQQRTPNGH  165
            KLGWS +NC+DL +  K+P+TP   TP     +PLP NEQQ    GH
Sbjct  445  KLGWSHANCQDLSNEKKMPLTPAKETP----PNPLPANEQQSASGGH  487



>ref|XP_006363948.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X4 
[Solanum tuberosum]
Length=435

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 152/220 (69%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F +  SGRIFFGDQGP  Q+ T FLP EG +  Y+V VE  C  SSC++Q+ 
Sbjct  165  VRNSFSLCFKEDDSGRIFFGDQGPAGQQTTSFLPSEGQFVTYVVGVESCCFGSSCIEQTS  224

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SE LP IPS  
Sbjct  225  FKAIVDSGSSFTFLPDQIYDRVVKEFDRKVNATKASFEGYPWQYCYKSSSEVLPKIPSFT  284

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  +AN SF++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENLKL
Sbjct  285  LKFTANSSFIVQDPVFMIYGSQGAVGFCLAVEPSGIEIGTIGQNFMTGYRMVFDRENLKL  344

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL DN+K+P+ P  G  S + LP  EQQ TPN
Sbjct  345  GWSRSDCEDLTDNNKLPLAPADGN-SPNSLPA-EQQNTPN  382



>ref|XP_006363947.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X3 
[Solanum tuberosum]
Length=435

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 152/220 (69%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F +  SGRIFFGDQGP  Q+ T FLP EG +  Y+V VE  C  SSC++Q+ 
Sbjct  165  VRNSFSLCFKEDDSGRIFFGDQGPAGQQTTSFLPSEGQFVTYVVGVESCCFGSSCIEQTS  224

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SE LP IPS  
Sbjct  225  FKAIVDSGSSFTFLPDQIYDRVVKEFDRKVNATKASFEGYPWQYCYKSSSEVLPKIPSFT  284

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  +AN SF++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENLKL
Sbjct  285  LKFTANSSFIVQDPVFMIYGSQGAVGFCLAVEPSGIEIGTIGQNFMTGYRMVFDRENLKL  344

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL DN+K+P+ P  G  S + LP  EQQ TPN
Sbjct  345  GWSRSDCEDLTDNNKLPLAPADGN-SPNSLPA-EQQNTPN  382



>ref|XP_008374326.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Malus 
domestica]
Length=534

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 148/219 (68%), Gaps = 3/219 (1%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGR+ FGDQGP  Q+ T FLP  GNY  YIV VE  C+ +SCLK++ F+
Sbjct  273  NSFSMCFDEDSSGRLLFGDQGPATQQSTXFLPSNGNYEMYIVGVEACCIGNSCLKZTSFK  332

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMKLI  465
            A VDSG+SFT LP   Y K+  +FD  +NAT ++     + YCY    + LP +PS+ L+
Sbjct  333  ALVDSGTSFTFLPESVYNKIAXEFDRRVNATIANYAGSPWKYCYNTSYQDLPKVPSVTLM  392

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
              AN SFV+ +P+F I   QGV  +CL + P EG  G +GQNFMTGYR VFD ENLKLGW
Sbjct  393  FLANNSFVVHDPVFLIHGDQGVNGFCLAIQPAEGDTGTVGQNFMTGYRTVFDRENLKLGW  452

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNG  168
            S SNC+DL+D   +P+ P P G   +PLPTNEQQ TP G
Sbjct  453  SXSNCRDLNDVKSMPLAP-PKGAPPNPLPTNEQQSTPGG  490



>ref|XP_011027671.1| PREDICTED: aspartic proteinase-like protein 1 isoform X4 [Populus 
euphratica]
Length=474

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 154/219 (70%), Gaps = 2/219 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + + FSL FD++ SGRI FGD+G  +Q+ TPFLP++G Y  Y V VE YCV +SCLK+SG
Sbjct  153  IQNCFSLCFDENDSGRILFGDRGHASQQSTPFLPIQGTYVAYFVGVESYCVGNSCLKRSG  212

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT  P E Y ++V++FD+ +NA R S    ++ YCY A S+ L NIP+++
Sbjct  213  FKALVDSGSSFTYFPSEVYNELVSEFDKQVNAKRISFQEGLWDYCYNASSQELHNIPAIQ  272

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    NQ+FV+ NP + I N+QG   +CL + P +G YG+IGQNFM GYRMVFD ENLKL
Sbjct  273  LKFPRNQNFVVHNPTYSIPNHQGFTMFCLSLQPTDGSYGVIGQNFMIGYRMVFDIENLKL  332

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            GWS S+C+   D+  V + P P   S +PLPTNEQQ  P
Sbjct  333  GWSNSSCQYTSDSADVHLAPPPDNKSPNPLPTNEQQSIP  371



>ref|XP_010664297.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Vitis 
vinifera]
Length=430

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 158/223 (71%), Gaps = 3/223 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V ++FS+ FD +HSG I FGDQG   Q+ T F+PLEG +  Y++EVE Y V SS LK +G
Sbjct  165  VRNTFSICFDDNHSGTILFGDQGLVTQKSTSFVPLEGKFVTYLIEVEGYLVGSSSLKTAG  224

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LPYE Y+K+V +FD+ +NATRSS     + YCY + S+ L NIP++ 
Sbjct  225  FQALVDSGTSFTFLPYEIYEKIVVEFDKQVNATRSSFKGSPWKYCYNSSSQELLNIPTVT  284

Query  470  LILSANQSFVIQNPMFPILNY-QGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L+ + NQSF++ NP+  +++  +    +CL + PI   +G+IGQNFM GYRMVFD ENLK
Sbjct  285  LVFAMNQSFIVHNPVIKLISENEEFNVFCLPIQPIHEEFGIIGQNFMWGYRMVFDRENLK  344

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            LGWS SNC+D+ D   + +TP P   S +PLPTN+QQ TP+ H
Sbjct  345  LGWSTSNCQDITDGKIMHLTPPPNDRSPNPLPTNQQQMTPSRH  387



>ref|XP_007048042.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOX92199.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=539

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 152/222 (68%), Gaps = 4/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRI+FGD+GP  Q+ T FLP +G Y  Y V VE  C+  SCLKQ+G
Sbjct  267  IRNSFSMCFDEEDSGRIYFGDEGPATQQSTQFLPSDGKYMTYTVGVEACCIGDSCLKQTG  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP E Y+++  +FD  +N+T +S   +   YCYK+ S+ LPN+P +K
Sbjct  327  FSAVVDSGTSFTFLPNEVYERIAKEFDRRVNSTITSYPGYPWEYCYKSSSQELPNVPYLK  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F I   QGV  +CL + P E   G IGQNFMTGYRMVFD E +KL
Sbjct  387  LMFPLNNSFVVYNPVFVIYGLQGVSGFCLAIQPGERDVGTIGQNFMTGYRMVFDREKMKL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL D  ++P++P   G  ++PLPTN QQ TP G 
Sbjct  447  GWSPSNCQDLADGKRMPLSPN--GTRSNPLPTNVQQSTPGGR  486



>ref|XP_011657988.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Cucumis 
sativus]
Length=451

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 159/227 (70%), Gaps = 12/227 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F++  SGRIFFGD+GP +Q+ T F+PL+G Y  YIV VE  C+E+SCLKQ+ 
Sbjct  184  VQNSFSLCFNEDGSGRIFFGDEGPASQQTTSFVPLDGKYETYIVGVEACCIENSCLKQTS  243

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV----FHYCYKARSEGLPNIPS  477
            F+A +DSG+SFT LP E Y+ +V +FD+ +N T S++      + YCYK  ++ +P +PS
Sbjct  244  FKALIDSGTSFTYLPEEAYENIVIEFDKRLNTT-SAVSFKGYPWKYCYKISADAMPKVPS  302

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L+   N SFV+ +P+FPI   QG+  +C  +LP +G  G++GQN+MTGYRMVFD +NL
Sbjct  303  VTLLFPLNNSFVVHDPVFPIYGDQGLAGFCFAILPADGDIGILGQNYMTGYRMVFDRDNL  362

Query  296  KLGWSASNCKDLDDNDKVPVTP---TPGGLSASPLPTNEQQRTPNGH  165
            KLGWS +NC+DL +  K+P+TP   TP     +PLP +EQQ    GH
Sbjct  363  KLGWSHANCQDLSNEKKMPLTPAKETP----PNPLPADEQQSASGGH  405



>ref|XP_002513870.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF48453.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=535

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 153/220 (70%), Gaps = 2/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL FD + SG I FGDQG  +Q+ TP LP +GNY+ Y++EVE YCV +SCLKQSG
Sbjct  267  IRKSFSLCFDVNGSGTILFGDQGHTSQKSTPLLPTQGNYDAYLIEVESYCVGNSCLKQSG  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + Y K+V +FD+ +NA R S     ++YCY   S+ L N+P+M+
Sbjct  327  FKALVDSGASFTYLPIDVYNKIVLEFDKQVNAQRISSQGGPWNYCYNTSSKQLDNVPAMR  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    NQS +I N  + +   Q    +CL + P +  YG+IGQN+MTGYR+VFD ENLKL
Sbjct  387  LSFLMNQSLLIHNSTYYVPQNQEFAVFCLTLQPTDLNYGIIGQNYMTGYRVVFDMENLKL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS+SNCKD+ D  +V + P+P   S +PLPTNEQQ  PN
Sbjct  447  GWSSSNCKDISDETEVTLAPSPNDQSPNPLPTNEQQSVPN  486



>ref|XP_011027670.1| PREDICTED: aspartic proteinase-like protein 1 isoform X3 [Populus 
euphratica]
Length=541

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 154/219 (70%), Gaps = 2/219 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + + FSL FD++ SGRI FGD+G  +Q+ TPFLP++G Y  Y V VE YCV +SCLK+SG
Sbjct  284  IQNCFSLCFDENDSGRILFGDRGHASQQSTPFLPIQGTYVAYFVGVESYCVGNSCLKRSG  343

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT  P E Y ++V++FD+ +NA R S    ++ YCY A S+ L NIP+++
Sbjct  344  FKALVDSGSSFTYFPSEVYNELVSEFDKQVNAKRISFQEGLWDYCYNASSQELHNIPAIQ  403

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    NQ+FV+ NP + I N+QG   +CL + P +G YG+IGQNFM GYRMVFD ENLKL
Sbjct  404  LKFPRNQNFVVHNPTYSIPNHQGFTMFCLSLQPTDGSYGVIGQNFMIGYRMVFDIENLKL  463

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            GWS S+C+   D+  V + P P   S +PLPTNEQQ  P
Sbjct  464  GWSNSSCQYTSDSADVHLAPPPDNKSPNPLPTNEQQSIP  502



>ref|XP_004143563.2| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Cucumis 
sativus]
Length=533

 Score =   236 bits (602),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 159/227 (70%), Gaps = 12/227 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F++  SGRIFFGD+GP +Q+ T F+PL+G Y  YIV VE  C+E+SCLKQ+ 
Sbjct  266  VQNSFSLCFNEDGSGRIFFGDEGPASQQTTSFVPLDGKYETYIVGVEACCIENSCLKQTS  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV----FHYCYKARSEGLPNIPS  477
            F+A +DSG+SFT LP E Y+ +V +FD+ +N T S++      + YCYK  ++ +P +PS
Sbjct  326  FKALIDSGTSFTYLPEEAYENIVIEFDKRLNTT-SAVSFKGYPWKYCYKISADAMPKVPS  384

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L+   N SFV+ +P+FPI   QG+  +C  +LP +G  G++GQN+MTGYRMVFD +NL
Sbjct  385  VTLLFPLNNSFVVHDPVFPIYGDQGLAGFCFAILPADGDIGILGQNYMTGYRMVFDRDNL  444

Query  296  KLGWSASNCKDLDDNDKVPVTP---TPGGLSASPLPTNEQQRTPNGH  165
            KLGWS +NC+DL +  K+P+TP   TP     +PLP +EQQ    GH
Sbjct  445  KLGWSHANCQDLSNEKKMPLTPAKETP----PNPLPADEQQSASGGH  487



>ref|XP_006434046.1| hypothetical protein CICLE_v10000815mg [Citrus clementina]
 gb|ESR47286.1| hypothetical protein CICLE_v10000815mg [Citrus clementina]
Length=537

 Score =   236 bits (602),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 153/222 (69%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD++ SG +FFGDQGP  Q+ T FLP+   Y+ Y V VE YC+ +SCL QSG
Sbjct  273  IQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPIGEKYDAYFVGVESYCIGNSCLTQSG  332

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP E Y +VV KFD+L+++ R S+  + + YCY A SE +  +P M+
Sbjct  333  FQALVDSGASFTFLPTEIYAEVVMKFDKLVSSRRISLQGNSWKYCYNASSEEMLKVPDMR  392

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI S NQSFV++N +F     +G   +CL V+  +G YG+IGQNFM G+R+VFD ENLKL
Sbjct  393  LIFSKNQSFVVRNHIFSFPENEGFTVFCLTVMSTDGDYGIIGQNFMMGHRIVFDRENLKL  452

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             WS S C+++ D   V + P P G S +PLPT +QQ T NG 
Sbjct  453  AWSHSKCEEVIDKSHVHLVPPPAGQSPNPLPTTDQQSTSNGQ  494



>ref|XP_002284255.2| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Vitis 
vinifera]
Length=531

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 158/223 (71%), Gaps = 3/223 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V ++FS+ FD +HSG I FGDQG   Q+ T F+PLEG +  Y++EVE Y V SS LK +G
Sbjct  266  VRNTFSICFDDNHSGTILFGDQGLVTQKSTSFVPLEGKFVTYLIEVEGYLVGSSSLKTAG  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LPYE Y+K+V +FD+ +NATRSS     + YCY + S+ L NIP++ 
Sbjct  326  FQALVDSGTSFTFLPYEIYEKIVVEFDKQVNATRSSFKGSPWKYCYNSSSQELLNIPTVT  385

Query  470  LILSANQSFVIQNPMFPILNY-QGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L+ + NQSF++ NP+  +++  +    +CL + PI   +G+IGQNFM GYRMVFD ENLK
Sbjct  386  LVFAMNQSFIVHNPVIKLISENEEFNVFCLPIQPIHEEFGIIGQNFMWGYRMVFDRENLK  445

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            LGWS SNC+D+ D   + +TP P   S +PLPTN+QQ TP+ H
Sbjct  446  LGWSTSNCQDITDGKIMHLTPPPNDRSPNPLPTNQQQMTPSRH  488



>emb|CBI19115.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 158/223 (71%), Gaps = 3/223 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V ++FS+ FD +HSG I FGDQG   Q+ T F+PLEG +  Y++EVE Y V SS LK +G
Sbjct  256  VRNTFSICFDDNHSGTILFGDQGLVTQKSTSFVPLEGKFVTYLIEVEGYLVGSSSLKTAG  315

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LPYE Y+K+V +FD+ +NATRSS     + YCY + S+ L NIP++ 
Sbjct  316  FQALVDSGTSFTFLPYEIYEKIVVEFDKQVNATRSSFKGSPWKYCYNSSSQELLNIPTVT  375

Query  470  LILSANQSFVIQNPMFPILNY-QGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L+ + NQSF++ NP+  +++  +    +CL + PI   +G+IGQNFM GYRMVFD ENLK
Sbjct  376  LVFAMNQSFIVHNPVIKLISENEEFNVFCLPIQPIHEEFGIIGQNFMWGYRMVFDRENLK  435

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            LGWS SNC+D+ D   + +TP P   S +PLPTN+QQ TP+ H
Sbjct  436  LGWSTSNCQDITDGKIMHLTPPPNDRSPNPLPTNQQQMTPSRH  478



>ref|XP_006363946.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X2 
[Solanum tuberosum]
Length=537

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 152/220 (69%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F +  SGRIFFGDQGP  Q+ T FLP EG +  Y+V VE  C  SSC++Q+ 
Sbjct  267  VRNSFSLCFKEDDSGRIFFGDQGPAGQQTTSFLPSEGQFVTYVVGVESCCFGSSCIEQTS  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SE LP IPS  
Sbjct  327  FKAIVDSGSSFTFLPDQIYDRVVKEFDRKVNATKASFEGYPWQYCYKSSSEVLPKIPSFT  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  +AN SF++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENLKL
Sbjct  387  LKFTANSSFIVQDPVFMIYGSQGAVGFCLAVEPSGIEIGTIGQNFMTGYRMVFDRENLKL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL DN+K+P+ P  G  S + LP  EQQ TPN
Sbjct  447  GWSRSDCEDLTDNNKLPLAPADGN-SPNSLPA-EQQNTPN  484



>ref|XP_011027669.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Populus 
euphratica]
Length=592

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 154/219 (70%), Gaps = 2/219 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + + FSL FD++ SGRI FGD+G  +Q+ TPFLP++G Y  Y V VE YCV +SCLK+SG
Sbjct  271  IQNCFSLCFDENDSGRILFGDRGHASQQSTPFLPIQGTYVAYFVGVESYCVGNSCLKRSG  330

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT  P E Y ++V++FD+ +NA R S    ++ YCY A S+ L NIP+++
Sbjct  331  FKALVDSGSSFTYFPSEVYNELVSEFDKQVNAKRISFQEGLWDYCYNASSQELHNIPAIQ  390

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    NQ+FV+ NP + I N+QG   +CL + P +G YG+IGQNFM GYRMVFD ENLKL
Sbjct  391  LKFPRNQNFVVHNPTYSIPNHQGFTMFCLSLQPTDGSYGVIGQNFMIGYRMVFDIENLKL  450

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            GWS S+C+   D+  V + P P   S +PLPTNEQQ  P
Sbjct  451  GWSNSSCQYTSDSADVHLAPPPDNKSPNPLPTNEQQSIP  489



>ref|XP_010027812.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW54434.1| hypothetical protein EUGRSUZ_I00379 [Eucalyptus grandis]
Length=461

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 149/221 (67%), Gaps = 4/221 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            VP+SFSL FD+  SG IFFGDQGP NQ++T FLP  G Y  YIV VE  C+ +SCL Q+ 
Sbjct  181  VPNSFSLCFDEDDSGTIFFGDQGPANQKYTAFLPSNGKYETYIVGVEACCIGNSCLNQTS  240

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV--FHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP   ++ +  +FD  +NATRSSI    + YCYK  ++  P +PS+ 
Sbjct  241  FSALVDSGTSFTFLPNGVFETIAQEFDRRVNATRSSIKEVPWKYCYKPSTKEKPKVPSLT  300

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
             +   N+SFV+ +P+F I   +G+  +CL +   +   G IGQNFM GYR+VFD ENLKL
Sbjct  301  FVFPLNKSFVVFDPVFKIYGMEGLVGFCLAIQGTDIDIGTIGQNFMMGYRIVFDRENLKL  360

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNG  168
            GWS SNC+D+DD+  +P+TP   G S +PLPT EQQ  P G
Sbjct  361  GWSRSNCQDIDDDRSMPLTPN--GRSPNPLPTTEQQSAPGG  399



>ref|XP_009776923.1| PREDICTED: aspartic proteinase-like protein 1 isoform X4 [Nicotiana 
sylvestris]
Length=434

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 153/220 (70%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V + FSL F +  SGRIFFGDQGP  Q+ T FLP +G +  Y+V VE  CV SSC++Q+ 
Sbjct  164  VRNCFSLCFKEDDSGRIFFGDQGPATQQITSFLPSDGQFVTYLVGVESCCVGSSCIEQTN  223

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SEGLP IPS  
Sbjct  224  FKAIVDSGTSFTFLPDQIYDRVVKEFDREVNATKASFEGYPWQYCYKSSSEGLPKIPSFT  283

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    N +F++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENLKL
Sbjct  284  LKFMTNSTFIVQDPVFVIYGSQGAVGFCLAVEPSGIDIGTIGQNFMTGYRMVFDRENLKL  343

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL D++++P+TP  G  S + LPT +QQ +PN
Sbjct  344  GWSLSDCQDLTDSNRLPMTPANGS-SPNSLPT-DQQNSPN  381



>ref|XP_011027668.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Populus 
euphratica]
Length=605

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 154/219 (70%), Gaps = 2/219 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + + FSL FD++ SGRI FGD+G  +Q+ TPFLP++G Y  Y V VE YCV +SCLK+SG
Sbjct  284  IQNCFSLCFDENDSGRILFGDRGHASQQSTPFLPIQGTYVAYFVGVESYCVGNSCLKRSG  343

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT  P E Y ++V++FD+ +NA R S    ++ YCY A S+ L NIP+++
Sbjct  344  FKALVDSGSSFTYFPSEVYNELVSEFDKQVNAKRISFQEGLWDYCYNASSQELHNIPAIQ  403

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    NQ+FV+ NP + I N+QG   +CL + P +G YG+IGQNFM GYRMVFD ENLKL
Sbjct  404  LKFPRNQNFVVHNPTYSIPNHQGFTMFCLSLQPTDGSYGVIGQNFMIGYRMVFDIENLKL  463

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            GWS S+C+   D+  V + P P   S +PLPTNEQQ  P
Sbjct  464  GWSNSSCQYTSDSADVHLAPPPDNKSPNPLPTNEQQSIP  502



>ref|XP_009378547.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Pyrus 
x bretschneideri]
Length=428

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGR+ FGDQGP  Q+ T FLP  GNY  YIV VE  C+ +SCLKQ+ F+
Sbjct  167  NSFSICFDEDSSGRLLFGDQGPATQQSTSFLPSNGNYEMYIVGVEACCIGNSCLKQTSFK  226

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRS--SIDVFHYCYKARSEGLPNIPSMKLI  465
            A VDSG+SFT LP   Y K+  +FD  +NAT +  +   + YCY   S+ LP +PS+ L+
Sbjct  227  ALVDSGTSFTFLPEAVYDKIAMEFDRRVNATVANHAGSPWKYCYNTSSQDLPKVPSVTLM  286

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
              AN S V+ +P+F I   QGV  +CL + P EG  G +GQNFMTGYR VFD ENLKLGW
Sbjct  287  FLANNSIVVHDPVFLIHGDQGVIGFCLAIQPAEGDTGTVGQNFMTGYRTVFDRENLKLGW  346

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNG  168
            S SNC+DL+D   +P+  +P G   +PLPTNEQ  TP G
Sbjct  347  SRSNCRDLNDVKSMPLA-SPKGTPPNPLPTNEQPSTPGG  384



>ref|XP_006363945.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X1 
[Solanum tuberosum]
Length=581

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 152/220 (69%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F +  SGRIFFGDQGP  Q+ T FLP EG +  Y+V VE  C  SSC++Q+ 
Sbjct  311  VRNSFSLCFKEDDSGRIFFGDQGPAGQQTTSFLPSEGQFVTYVVGVESCCFGSSCIEQTS  370

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SE LP IPS  
Sbjct  371  FKAIVDSGSSFTFLPDQIYDRVVKEFDRKVNATKASFEGYPWQYCYKSSSEVLPKIPSFT  430

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  +AN SF++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENLKL
Sbjct  431  LKFTANSSFIVQDPVFMIYGSQGAVGFCLAVEPSGIEIGTIGQNFMTGYRMVFDRENLKL  490

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL DN+K+P+ P  G  S + LP  EQQ TPN
Sbjct  491  GWSRSDCEDLTDNNKLPLAPADGN-SPNSLPA-EQQNTPN  528



>ref|XP_010319758.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Solanum 
lycopersicum]
Length=435

 Score =   231 bits (589),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 151/220 (69%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F +   GRIFFGDQGP  Q+ T FLP EG +  Y+V VE  C  SSC++Q+ 
Sbjct  165  VRNSFSLCFKEDDLGRIFFGDQGPAGQQTTSFLPSEGQFVTYVVGVESCCFGSSCIEQTS  224

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SEGLP IPS  
Sbjct  225  FKAIVDSGTSFTFLPDQIYDRVVKEFDRKVNATKASFEGYPWQYCYKSSSEGLPKIPSFT  284

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  + N SF++Q+P+F I   QG   +CL V P     G IGQNFM+GYRMVFD EN+KL
Sbjct  285  LKFTMNSSFIVQDPVFMIYGSQGAVGFCLAVEPSGIDIGTIGQNFMSGYRMVFDRENMKL  344

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL DN+++P+ P  G  S + LP  EQQ TPN
Sbjct  345  GWSRSDCEDLTDNNRLPLAPADGS-SPNSLPA-EQQNTPN  382



>ref|XP_010027811.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW54433.1| hypothetical protein EUGRSUZ_I00379 [Eucalyptus grandis]
Length=552

 Score =   234 bits (596),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 149/221 (67%), Gaps = 4/221 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            VP+SFSL FD+  SG IFFGDQGP NQ++T FLP  G Y  YIV VE  C+ +SCL Q+ 
Sbjct  272  VPNSFSLCFDEDDSGTIFFGDQGPANQKYTAFLPSNGKYETYIVGVEACCIGNSCLNQTS  331

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV--FHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP   ++ +  +FD  +NATRSSI    + YCYK  ++  P +PS+ 
Sbjct  332  FSALVDSGTSFTFLPNGVFETIAQEFDRRVNATRSSIKEVPWKYCYKPSTKEKPKVPSLT  391

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
             +   N+SFV+ +P+F I   +G+  +CL +   +   G IGQNFM GYR+VFD ENLKL
Sbjct  392  FVFPLNKSFVVFDPVFKIYGMEGLVGFCLAIQGTDIDIGTIGQNFMMGYRIVFDRENLKL  451

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNG  168
            GWS SNC+D+DD+  +P+TP   G S +PLPT EQQ  P G
Sbjct  452  GWSRSNCQDIDDDRSMPLTPN--GRSPNPLPTTEQQSAPGG  490



>ref|XP_009776922.1| PREDICTED: aspartic proteinase-like protein 1 isoform X3 [Nicotiana 
sylvestris]
Length=512

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 153/220 (70%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V + FSL F +  SGRIFFGDQGP  Q+ T FLP +G +  Y+V VE  CV SSC++Q+ 
Sbjct  242  VRNCFSLCFKEDDSGRIFFGDQGPATQQITSFLPSDGQFVTYLVGVESCCVGSSCIEQTN  301

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SEGLP IPS  
Sbjct  302  FKAIVDSGTSFTFLPDQIYDRVVKEFDREVNATKASFEGYPWQYCYKSSSEGLPKIPSFT  361

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    N +F++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENLKL
Sbjct  362  LKFMTNSTFIVQDPVFVIYGSQGAVGFCLAVEPSGIDIGTIGQNFMTGYRMVFDRENLKL  421

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL D++++P+TP  G  S + LPT +QQ +PN
Sbjct  422  GWSLSDCQDLTDSNRLPMTPANGS-SPNSLPT-DQQNSPN  459



>ref|XP_009378546.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Pyrus 
x bretschneideri]
Length=534

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGR+ FGDQGP  Q+ T FLP  GNY  YIV VE  C+ +SCLKQ+ F+
Sbjct  273  NSFSICFDEDSSGRLLFGDQGPATQQSTSFLPSNGNYEMYIVGVEACCIGNSCLKQTSFK  332

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRS--SIDVFHYCYKARSEGLPNIPSMKLI  465
            A VDSG+SFT LP   Y K+  +FD  +NAT +  +   + YCY   S+ LP +PS+ L+
Sbjct  333  ALVDSGTSFTFLPEAVYDKIAMEFDRRVNATVANHAGSPWKYCYNTSSQDLPKVPSVTLM  392

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
              AN S V+ +P+F I   QGV  +CL + P EG  G +GQNFMTGYR VFD ENLKLGW
Sbjct  393  FLANNSIVVHDPVFLIHGDQGVIGFCLAIQPAEGDTGTVGQNFMTGYRTVFDRENLKLGW  452

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNG  168
            S SNC+DL+D   +P+  +P G   +PLPTNEQ  TP G
Sbjct  453  SRSNCRDLNDVKSMPLA-SPKGTPPNPLPTNEQPSTPGG  490



>ref|XP_009618453.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=505

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 154/220 (70%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F +  SGRIFFGDQGP +Q+ T FLP +G +  Y+V VE  CV SSC++Q+ 
Sbjct  235  VQNSFSLCFKEDDSGRIFFGDQGPASQQKTSFLPSDGQFVTYVVGVESCCVGSSCIEQTN  294

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + Y +VV +FD  +NA+++S + +   YCYK+ SEGLP IPS  
Sbjct  295  FKAIVDSGTSFTFLPDQIYDRVVKEFDREVNASKASFEGYPWQYCYKSSSEGLPKIPSFT  354

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    N +F++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENL L
Sbjct  355  LKFMTNSTFIVQDPVFVIYGSQGAVGFCLAVEPSGIDIGTIGQNFMTGYRMVFDRENLNL  414

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL D++++P+TP  G  S + LPT EQQ +PN
Sbjct  415  GWSLSDCQDLTDSNRLPMTPANGS-SPNSLPT-EQQNSPN  452



>ref|XP_009776921.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=537

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 153/220 (70%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V + FSL F +  SGRIFFGDQGP  Q+ T FLP +G +  Y+V VE  CV SSC++Q+ 
Sbjct  267  VRNCFSLCFKEDDSGRIFFGDQGPATQQITSFLPSDGQFVTYLVGVESCCVGSSCIEQTN  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SEGLP IPS  
Sbjct  327  FKAIVDSGTSFTFLPDQIYDRVVKEFDREVNATKASFEGYPWQYCYKSSSEGLPKIPSFT  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    N +F++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENLKL
Sbjct  387  LKFMTNSTFIVQDPVFVIYGSQGAVGFCLAVEPSGIDIGTIGQNFMTGYRMVFDRENLKL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL D++++P+TP  G  S + LPT +QQ +PN
Sbjct  447  GWSLSDCQDLTDSNRLPMTPANGS-SPNSLPT-DQQNSPN  484



>ref|XP_009776920.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Nicotiana 
sylvestris]
Length=544

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 153/220 (70%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V + FSL F +  SGRIFFGDQGP  Q+ T FLP +G +  Y+V VE  CV SSC++Q+ 
Sbjct  274  VRNCFSLCFKEDDSGRIFFGDQGPATQQITSFLPSDGQFVTYLVGVESCCVGSSCIEQTN  333

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SEGLP IPS  
Sbjct  334  FKAIVDSGTSFTFLPDQIYDRVVKEFDREVNATKASFEGYPWQYCYKSSSEGLPKIPSFT  393

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    N +F++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENLKL
Sbjct  394  LKFMTNSTFIVQDPVFVIYGSQGAVGFCLAVEPSGIDIGTIGQNFMTGYRMVFDRENLKL  453

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL D++++P+TP  G  S + LPT +QQ +PN
Sbjct  454  GWSLSDCQDLTDSNRLPMTPANGS-SPNSLPT-DQQNSPN  491



>ref|XP_009618452.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=537

 Score =   231 bits (589),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 154/220 (70%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F +  SGRIFFGDQGP +Q+ T FLP +G +  Y+V VE  CV SSC++Q+ 
Sbjct  267  VQNSFSLCFKEDDSGRIFFGDQGPASQQKTSFLPSDGQFVTYVVGVESCCVGSSCIEQTN  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + Y +VV +FD  +NA+++S + +   YCYK+ SEGLP IPS  
Sbjct  327  FKAIVDSGTSFTFLPDQIYDRVVKEFDREVNASKASFEGYPWQYCYKSSSEGLPKIPSFT  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    N +F++Q+P+F I   QG   +CL V P     G IGQNFMTGYRMVFD ENL L
Sbjct  387  LKFMTNSTFIVQDPVFVIYGSQGAVGFCLAVEPSGIDIGTIGQNFMTGYRMVFDRENLNL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL D++++P+TP  G  S + LPT EQQ +PN
Sbjct  447  GWSLSDCQDLTDSNRLPMTPANGS-SPNSLPT-EQQNSPN  484



>ref|XP_004237424.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Solanum 
lycopersicum]
Length=537

 Score =   231 bits (588),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 151/220 (69%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F +   GRIFFGDQGP  Q+ T FLP EG +  Y+V VE  C  SSC++Q+ 
Sbjct  267  VRNSFSLCFKEDDLGRIFFGDQGPAGQQTTSFLPSEGQFVTYVVGVESCCFGSSCIEQTS  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + Y +VV +FD  +NAT++S + +   YCYK+ SEGLP IPS  
Sbjct  327  FKAIVDSGTSFTFLPDQIYDRVVKEFDRKVNATKASFEGYPWQYCYKSSSEGLPKIPSFT  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  + N SF++Q+P+F I   QG   +CL V P     G IGQNFM+GYRMVFD EN+KL
Sbjct  387  LKFTMNSSFIVQDPVFMIYGSQGAVGFCLAVEPSGIDIGTIGQNFMSGYRMVFDRENMKL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+DL DN+++P+ P  G  S + LP  EQQ TPN
Sbjct  447  GWSRSDCEDLTDNNRLPLAPADGS-SPNSLPA-EQQNTPN  484



>ref|XP_012078113.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Jatropha 
curcas]
Length=422

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 147/220 (67%), Gaps = 2/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F+++ SGRI FGDQ   +Q+ TP L +EGNY  Y VEVE YCV  SCLKQSG
Sbjct  147  IQKSFSLCFNENDSGRILFGDQVHASQKSTPLLSIEGNYVTYFVEVESYCVGHSCLKQSG  206

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR--SSIDVFHYCYKARSEGLPNIPSMK  471
            F+A VD+G+SFT LP + Y K+V +FD+ +NA R  S    + YCY   S  L NIP+M+
Sbjct  207  FKALVDTGTSFTFLPRKVYNKIVLEFDKQVNAERISSQGGPWDYCYNTSSRELVNIPAMQ  266

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            +    NQSF++  P + +   Q    +CL +   +  YG+IG +F+TGYR+VFD ENLK 
Sbjct  267  IQFPMNQSFLVHKPTYSVPQNQEFTIFCLTLQQTDEDYGIIGHDFLTGYRVVFDMENLKF  326

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS+SNC+D+ DN +V V P P   S +PLPTNEQQ  PN
Sbjct  327  GWSSSNCQDISDNTEVRVAPPPDDKSPNPLPTNEQQSVPN  366



>ref|XP_007163626.1| hypothetical protein PHAVU_001G250200g [Phaseolus vulgaris]
 gb|ESW35620.1| hypothetical protein PHAVU_001G250200g [Phaseolus vulgaris]
Length=522

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 173/265 (65%), Gaps = 11/265 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL F++  SGR+FFGDQG   Q+ TPFLPL+G Y+ YIV VE  C+ ++CLK +G
Sbjct  260  IHNSFSLCFNEDDSGRMFFGDQGSTIQQSTPFLPLDGLYSTYIVGVESSCIGNTCLKMTG  319

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+AQVDSG+SFT LP   Y  +  +FD+ +N +RSS +   + YCY   S+ LP +PS+ 
Sbjct  320  FKAQVDSGTSFTFLPGHAYGAIAEQFDQQVNGSRSSFEGSPWEYCYVPSSQELPKVPSLT  379

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F     +GV  +CL + P EG  G IGQNFMTGYR+VFD EN KL
Sbjct  380  LMFQQNNSFVVYNPVFVFYGNEGVIGFCLAIQPTEGDMGTIGQNFMTGYRLVFDRENKKL  439

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapala-----grappr  126
             WS SNC+DL    ++P++P     S +PLP++EQQRT NGHAVAPA+A       +   
Sbjct  440  AWSRSNCQDLSIGKRMPLSPNE--TSPNPLPSDEQQRT-NGHAVAPAVAGRAPHKSSAAL  496

Query  125  psaasPCTIHYQHCTLILILLMLQS  51
                S C + Y HC L L+  ++ +
Sbjct  497  SRMISSCRV-YWHCYLFLLFQLVST  520



>ref|XP_003537508.1| PREDICTED: aspartic proteinase-like protein 1-like [Glycine max]
Length=521

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 153/222 (69%), Gaps = 5/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL F++  SGR+FFGDQGP +Q+ T FLPL+G Y+ YI+ VE  C+ +SCLK + 
Sbjct  259  IHYSFSLCFNEDDSGRMFFGDQGPTSQQSTSFLPLDGLYSTYIIGVESCCIGNSCLKMTS  318

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+AQVDSG+SFT LP   Y  +  +FD+ +N +RSS +   + YCY   S+ LP +PS  
Sbjct  319  FKAQVDSGTSFTFLPGHVYGAITEEFDQQVNGSRSSFEGSPWEYCYVPSSQDLPKVPSFT  378

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ +P+F     +GV  +CL +LP EG  G IGQNFMTGYR+VFD  N KL
Sbjct  379  LMFQRNNSFVVYDPVFVFYGNEGVIGFCLAILPTEGDMGTIGQNFMTGYRLVFDRGNKKL  438

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             WS SNC+DL    ++P++P     S++PLPT+EQQRT NGH
Sbjct  439  AWSRSNCQDLSLGKRMPLSPNE--TSSNPLPTDEQQRT-NGH  477



>ref|XP_011090459.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Sesamum 
indicum]
Length=413

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 152/222 (68%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL F +  SGR+FFGDQG  +Q+ TPFLPL+G    YI+ V+  C+ SSCL  + 
Sbjct  156  IRNSFSLCFSEDDSGRLFFGDQGVASQQTTPFLPLDGKNLTYIIGVDACCIGSSCLDNTN  215

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F   VDSG+SFT LP + Y++VV++FD  +NA++SS + +   YCYK+ S+G P IPS+ 
Sbjct  216  FEMLVDSGTSFTFLPDQIYERVVDEFDRQVNASKSSFEGYPWQYCYKSSSQGEPKIPSLT  275

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  + + SFV+++P+F I   QG   +CL + P +   G IGQNFMTGY++VFD EN KL
Sbjct  276  LKFATSNSFVVKDPVFVIYGTQGAVGFCLAIQPTDQTIGTIGQNFMTGYQIVFDRENFKL  335

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DLD  D+VP+  +    S + LPT EQQ  PNG+
Sbjct  336  GWSRSNCQDLDYGDRVPLNSSGNSNSPNSLPTAEQQSAPNGN  377



>ref|XP_011090458.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Sesamum 
indicum]
Length=418

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 152/222 (68%), Gaps = 2/222 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL F +  SGR+FFGDQG  +Q+ TPFLPL+G    YI+ V+  C+ SSCL  + 
Sbjct  161  IRNSFSLCFSEDDSGRLFFGDQGVASQQTTPFLPLDGKNLTYIIGVDACCIGSSCLDNTN  220

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F   VDSG+SFT LP + Y++VV++FD  +NA++SS + +   YCYK+ S+G P IPS+ 
Sbjct  221  FEMLVDSGTSFTFLPDQIYERVVDEFDRQVNASKSSFEGYPWQYCYKSSSQGEPKIPSLT  280

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  + + SFV+++P+F I   QG   +CL + P +   G IGQNFMTGY++VFD EN KL
Sbjct  281  LKFATSNSFVVKDPVFVIYGTQGAVGFCLAIQPTDQTIGTIGQNFMTGYQIVFDRENFKL  340

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DLD  D+VP+  +    S + LPT EQQ  PNG+
Sbjct  341  GWSRSNCQDLDYGDRVPLNSSGNSNSPNSLPTAEQQSAPNGN  382



>ref|XP_006382913.1| hypothetical protein POPTR_0005s08170g [Populus trichocarpa]
 gb|ERP60710.1| hypothetical protein POPTR_0005s08170g [Populus trichocarpa]
Length=347

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 144/222 (65%), Gaps = 14/222 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F++  SGRIFFGDQGP  Q+  PFL L GNY  YIV VE  CV +SCLKQS 
Sbjct  93   IQNSFSMCFNEDDSGRIFFGDQGPATQQSAPFLKLNGNYTTYIVGVEVCCVGTSCLKQSS  152

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP + ++ +  +FD  +NA+RSS + +   YCYK  S+ LP IPS++
Sbjct  153  FSALVDSGTSFTFLPDDVFEMIAEEFDTQVNASRSSFEGYSWKYCYKTSSQDLPKIPSLR  212

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI   N SF++QNP+F I   QGV  +CL + P +G  G IG           D ENLKL
Sbjct  213  LIFPQNNSFMVQNPVFMIYGIQGVIGFCLAIQPADGDIGTIG----------LDRENLKL  262

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC D  D   +P+TP+  G   +PLPTNEQQ TP GH
Sbjct  263  GWSRSNCGDEGDGKTLPLTPS--GTPQNPLPTNEQQSTPGGH  302



>ref|XP_012078112.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Jatropha 
curcas]
 gb|KDP32707.1| hypothetical protein JCGZ_11999 [Jatropha curcas]
Length=545

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 147/220 (67%), Gaps = 2/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F+++ SGRI FGDQ   +Q+ TP L +EGNY  Y VEVE YCV  SCLKQSG
Sbjct  270  IQKSFSLCFNENDSGRILFGDQVHASQKSTPLLSIEGNYVTYFVEVESYCVGHSCLKQSG  329

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR--SSIDVFHYCYKARSEGLPNIPSMK  471
            F+A VD+G+SFT LP + Y K+V +FD+ +NA R  S    + YCY   S  L NIP+M+
Sbjct  330  FKALVDTGTSFTFLPRKVYNKIVLEFDKQVNAERISSQGGPWDYCYNTSSRELVNIPAMQ  389

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            +    NQSF++  P + +   Q    +CL +   +  YG+IG +F+TGYR+VFD ENLK 
Sbjct  390  IQFPMNQSFLVHKPTYSVPQNQEFTIFCLTLQQTDEDYGIIGHDFLTGYRVVFDMENLKF  449

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS+SNC+D+ DN +V V P P   S +PLPTNEQQ  PN
Sbjct  450  GWSSSNCQDISDNTEVRVAPPPDDKSPNPLPTNEQQSVPN  489



>gb|KJB49159.1| hypothetical protein B456_008G103400 [Gossypium raimondii]
 gb|KJB49160.1| hypothetical protein B456_008G103400 [Gossypium raimondii]
Length=443

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 152/222 (68%), Gaps = 4/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD   SGRI+FGD+GP  Q  T FLP +G Y  YIV VE  C+ +SCLKQ G
Sbjct  165  IRNSFSMCFDDEDSGRIYFGDKGPPTQESTHFLPSDGKYETYIVGVEACCIGNSCLKQMG  224

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP E Y+++  +FD  +NAT +S   +   YCYK+ SE LP +P +K
Sbjct  225  FSAVVDSGTSFTFLPNEVYERIAKEFDRQINATITSYPGYPWKYCYKSSSEELPKVPHLK  284

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F +   QG+  +CL V P+EG  G IGQNFMTGYRMVFD E +KL
Sbjct  285  LVFPLNNSFVVFNPVFVVYGIQGISGFCLAVQPMEGDVGTIGQNFMTGYRMVFDREKMKL  344

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL D  ++ ++P   G  ++PLPTNEQQ TP G 
Sbjct  345  GWSPSNCQDLADGKRMSLSPN--GTPSNPLPTNEQQSTPGGR  384



>ref|XP_010905920.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Elaeis 
guineensis]
Length=398

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 171/263 (65%), Gaps = 3/263 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRI+FGDQG   Q+ TPF+P  G Y  YIVEVE +C+ S CL ++ 
Sbjct  135  VRNSFSICFQEEDSGRIYFGDQGVATQQSTPFIPSNGKYMTYIVEVESFCIGSQCLGKTI  194

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR--SSIDVFHYCYKARSEGLPNIPSMK  471
            F A VDSGSSFT LP   YK+V  KFD  +NA+R   S   + YCYKA    +P IP++ 
Sbjct  195  FHALVDSGSSFTSLPDNVYKRVTTKFDRQVNASRLVYSDSPWEYCYKASPLEMPEIPTLT  254

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L+ S N+SFV  +P+  +   +G +  +CL +       G+IGQNFMTGYR+VFD ENLK
Sbjct  255  LMFSVNKSFVANSPVHHVYGEEGDLAGFCLALQSSSDSMGIIGQNFMTGYRIVFDRENLK  314

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
            LGWS SNC DLD++  V +TP P     +PLPT+EQQ +P G AVAPA+AGR PP   +A
Sbjct  315  LGWSQSNCHDLDNSRSVHLTPPPQNRPENPLPTDEQQSSPKGRAVAPAVAGRTPPTNPSA  374

Query  113  sPCTIHYQHCTLILILLMLQSFV  45
            +   +  Q+C L+L+  +   F+
Sbjct  375  ASPQVVTQYCLLLLLTQVAVMFI  397



>ref|XP_010680590.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=429

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 151/224 (67%), Gaps = 4/224 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCV-ESSCLKQS  648
            +  SFSL F+++ SGRIFFGDQG    ++TP LPL+G Y+ Y+V V+  C+ +S+CLKQ+
Sbjct  156  IKDSFSLCFNENGSGRIFFGDQGLTTHQWTPILPLQGKYSTYLVGVDAVCIGKSTCLKQT  215

Query  647  GFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSM  474
             FRA VDSG+SFT +P + Y+KV  +FD  + A R S D +   YCY++  E   N PS+
Sbjct  216  SFRAVVDSGTSFTFIPNDVYRKVTQEFDREVKAARVSYDGYPWDYCYESSEEEPLNFPSV  275

Query  473  KLILSANQSFVIQNPMFPILNYQGVKC-YCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            +L+L +N+SFV+Q P FP+   +G    YCL + P +G    IGQNFMTGYRMVFD ENL
Sbjct  276  ELMLPSNESFVVQYPFFPVTGDKGNNLGYCLAIEPADGDIAFIGQNFMTGYRMVFDRENL  335

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            KLGWS S+C+DL + +K P  P+ G    + LP+NEQQ  P   
Sbjct  336  KLGWSRSDCQDLSNQNKTPSPPSAGDKPPNALPSNEQQSIPGAE  379



>gb|KHN31350.1| Aspartic proteinase-like protein 1 [Glycine soja]
Length=462

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 148/219 (68%), Gaps = 5/219 (2%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFSL F++  SGRIFFGDQGP  Q+ T FLPL+G Y+ YI+ VE  CV +SCLK + F+ 
Sbjct  203  SFSLCFNEDDSGRIFFGDQGPTIQQSTSFLPLDGLYSTYIIGVESCCVGNSCLKMTSFKV  262

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLIL  462
            QVDSG+SFT LP   Y  +  +FD+ +N +RSS +   + YCY   S+ LP +PS+ L  
Sbjct  263  QVDSGTSFTFLPGHVYGAIAEEFDQQVNGSRSSFEGSPWEYCYVPSSQELPKVPSLTLTF  322

Query  461  SANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWS  282
              N SFV+ +P+F     +GV  +CL + P EG  G IGQNFMTGYR+VFD  N KL WS
Sbjct  323  QQNNSFVVYDPVFVFYGNEGVIGFCLAIQPTEGDMGTIGQNFMTGYRLVFDRGNKKLAWS  382

Query  281  ASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             SNC+DL    ++P++P     S++PLPT+EQQRT NGH
Sbjct  383  RSNCQDLSLGKRMPLSPNE--TSSNPLPTDEQQRT-NGH  418



>ref|XP_006382912.1| hypothetical protein POPTR_0005s08170g [Populus trichocarpa]
 gb|ERP60709.1| hypothetical protein POPTR_0005s08170g [Populus trichocarpa]
Length=399

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 144/222 (65%), Gaps = 14/222 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F++  SGRIFFGDQGP  Q+  PFL L GNY  YIV VE  CV +SCLKQS 
Sbjct  145  IQNSFSMCFNEDDSGRIFFGDQGPATQQSAPFLKLNGNYTTYIVGVEVCCVGTSCLKQSS  204

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP + ++ +  +FD  +NA+RSS + +   YCYK  S+ LP IPS++
Sbjct  205  FSALVDSGTSFTFLPDDVFEMIAEEFDTQVNASRSSFEGYSWKYCYKTSSQDLPKIPSLR  264

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI   N SF++QNP+F I   QGV  +CL + P +G  G IG           D ENLKL
Sbjct  265  LIFPQNNSFMVQNPVFMIYGIQGVIGFCLAIQPADGDIGTIG----------LDRENLKL  314

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC D  D   +P+TP+  G   +PLPTNEQQ TP GH
Sbjct  315  GWSRSNCGDEGDGKTLPLTPS--GTPQNPLPTNEQQSTPGGH  354



>ref|XP_007018870.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16095.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=527

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 149/220 (68%), Gaps = 2/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+  D++ SGRI+FGD+G   Q+ TPFLP+ G Y KY V VEH CV SSCL++SG
Sbjct  267  IQNSFSICLDENGSGRIYFGDKGLATQQSTPFLPIGGKYEKYFVRVEHLCVGSSCLEKSG  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSS--IDVFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP E Y KVV +FD+ +NA R S   D + YCY   S+    IPSM+
Sbjct  327  FSALVDSGTSFTYLPPEIYDKVVLEFDKQVNARRISNQEDFWKYCYNVSSQEPFKIPSMR  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L  + NQSF I N ++     +G   +CL VL  +  +G+IGQNFMTG+ +VFD ENLKL
Sbjct  387  LKFAINQSFEIHNHIYSYTGIEGFTVFCLTVLRGKDDFGIIGQNFMTGHEIVFDRENLKL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            GWS S+C+D++D   V + P P G S  PLPTNEQQ T N
Sbjct  447  GWSHSSCQDVNDKSSVHLAPPPSGESPIPLPTNEQQNTNN  486



>ref|XP_010546403.1| PREDICTED: aspartic proteinase-like protein 1 [Tarenaya hassleriana]
Length=529

 Score =   226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 147/218 (67%), Gaps = 5/218 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F + HSGRI+FGD GP  Q+ T FLPL   Y  YIV V+  CV +SCLK S 
Sbjct  268  VRNSFSLCFREDHSGRIYFGDMGPSLQQSTRFLPLNNKYITYIVGVDTCCVGNSCLKGSN  327

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            FR  +DSGSSFT LP   Y+KV  +FD  +NAT SS D F   YCYK   E  P +P+MK
Sbjct  328  FRTLIDSGSSFTYLPEAIYQKVAYEFDRRINATISSFDGFPWEYCYKTSVE--PELPTMK  385

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+ S N SFVI++P+F I   Q +  +CL V P+E   G+IGQNFMTGYR+VFD EN+KL
Sbjct  386  LMFSPNNSFVIRDPIFRIYQDQELLGFCLAVQPVEEDLGIIGQNFMTGYRLVFDRENMKL  445

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRT  177
             WSAS C+DL  NDK+   P+P   S  PLPT+EQQ +
Sbjct  446  SWSASKCRDL-SNDKISPWPSPNKTSPYPLPTDEQQSS  482



>emb|CDP01409.1| unnamed protein product [Coffea canephora]
Length=535

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 146/220 (66%), Gaps = 5/220 (2%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFSL   +  +GRIFFGDQG  +Q  TPFLP + + N YIV VE  CVES CL+++ F+
Sbjct  272  NSFSLCLKE-DTGRIFFGDQGIPSQHTTPFLPFD-DINAYIVGVETSCVESYCLEKTNFK  329

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMKLI  465
            A VDSG+SFT LP   Y+K+  +FD  +NAT+ S   D + YCYK  SE LP  PS+ L 
Sbjct  330  ALVDSGTSFTFLPDAVYQKLAGEFDRQINATKFSFEGDQWQYCYKFSSEELPKTPSLSLK  389

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
             SAN SFV+ NP+F I   QG   +CL + P  G  G IGQNF  GYRMVFD EN+KLGW
Sbjct  390  FSANNSFVVINPVFAIYGSQGAVGFCLAIQPTNGDIGTIGQNFFIGYRMVFDRENMKLGW  449

Query  284  SASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            S SNC+DL D   +P+TP+ G  S  PLPT +QQ  PNG 
Sbjct  450  SHSNCEDLTDEKGMPMTPS-GSASPKPLPTTQQQSKPNGR  488



>gb|KJB49158.1| hypothetical protein B456_008G103400 [Gossypium raimondii]
Length=545

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 152/222 (68%), Gaps = 4/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD   SGRI+FGD+GP  Q  T FLP +G Y  YIV VE  C+ +SCLKQ G
Sbjct  267  IRNSFSMCFDDEDSGRIYFGDKGPPTQESTHFLPSDGKYETYIVGVEACCIGNSCLKQMG  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP E Y+++  +FD  +NAT +S   +   YCYK+ SE LP +P +K
Sbjct  327  FSAVVDSGTSFTFLPNEVYERIAKEFDRQINATITSYPGYPWKYCYKSSSEELPKVPHLK  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F +   QG+  +CL V P+EG  G IGQNFMTGYRMVFD E +KL
Sbjct  387  LVFPLNNSFVVFNPVFVVYGIQGISGFCLAVQPMEGDVGTIGQNFMTGYRMVFDREKMKL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL D  ++ ++P   G  ++PLPTNEQQ TP G 
Sbjct  447  GWSPSNCQDLADGKRMSLSPN--GTPSNPLPTNEQQSTPGGR  486



>ref|XP_010680589.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=532

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 151/224 (67%), Gaps = 4/224 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCV-ESSCLKQS  648
            +  SFSL F+++ SGRIFFGDQG    ++TP LPL+G Y+ Y+V V+  C+ +S+CLKQ+
Sbjct  259  IKDSFSLCFNENGSGRIFFGDQGLTTHQWTPILPLQGKYSTYLVGVDAVCIGKSTCLKQT  318

Query  647  GFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSM  474
             FRA VDSG+SFT +P + Y+KV  +FD  + A R S D +   YCY++  E   N PS+
Sbjct  319  SFRAVVDSGTSFTFIPNDVYRKVTQEFDREVKAARVSYDGYPWDYCYESSEEEPLNFPSV  378

Query  473  KLILSANQSFVIQNPMFPILNYQGVKC-YCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            +L+L +N+SFV+Q P FP+   +G    YCL + P +G    IGQNFMTGYRMVFD ENL
Sbjct  379  ELMLPSNESFVVQYPFFPVTGDKGNNLGYCLAIEPADGDIAFIGQNFMTGYRMVFDRENL  438

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            KLGWS S+C+DL + +K P  P+ G    + LP+NEQQ  P   
Sbjct  439  KLGWSRSDCQDLSNQNKTPSPPSAGDKPPNALPSNEQQSIPGAE  482



>gb|KEH35308.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=387

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 148/222 (67%), Gaps = 4/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F++  SGR+FFGDQG   Q+ TPFL ++G ++ YIV VE  C+ +SC K + 
Sbjct  122  IRDSFSLCFNEDDSGRLFFGDQGSTVQQSTPFLLVDGMFSTYIVGVETCCIGNSCPKVTS  181

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F AQ DSG+SFT LP   Y  +  +FD+ +NATRS+     + YCY   S+ LP IP++ 
Sbjct  182  FNAQFDSGTSFTFLPGHAYGAIAEEFDKQVNATRSTFQGSPWEYCYVPSSQQLPKIPTLT  241

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F   N QGV  +CL + P EG  G IGQNFMTGYR+VFD EN KL
Sbjct  242  LMFQQNNSFVVYNPVFVSYNEQGVDGFCLAIQPTEGGMGTIGQNFMTGYRLVFDRENKKL  301

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             WS SNC+DL    ++P++P P G S+S LP +EQQRT  GH
Sbjct  302  AWSHSNCQDLSLGKRMPLSP-PNGTSSSQLPADEQQRT-KGH  341



>ref|XP_010905919.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Elaeis 
guineensis]
Length=487

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 171/263 (65%), Gaps = 3/263 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRI+FGDQG   Q+ TPF+P  G Y  YIVEVE +C+ S CL ++ 
Sbjct  224  VRNSFSICFQEEDSGRIYFGDQGVATQQSTPFIPSNGKYMTYIVEVESFCIGSQCLGKTI  283

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR--SSIDVFHYCYKARSEGLPNIPSMK  471
            F A VDSGSSFT LP   YK+V  KFD  +NA+R   S   + YCYKA    +P IP++ 
Sbjct  284  FHALVDSGSSFTSLPDNVYKRVTTKFDRQVNASRLVYSDSPWEYCYKASPLEMPEIPTLT  343

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L+ S N+SFV  +P+  +   +G +  +CL +       G+IGQNFMTGYR+VFD ENLK
Sbjct  344  LMFSVNKSFVANSPVHHVYGEEGDLAGFCLALQSSSDSMGIIGQNFMTGYRIVFDRENLK  403

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
            LGWS SNC DLD++  V +TP P     +PLPT+EQQ +P G AVAPA+AGR PP   +A
Sbjct  404  LGWSQSNCHDLDNSRSVHLTPPPQNRPENPLPTDEQQSSPKGRAVAPAVAGRTPPTNPSA  463

Query  113  sPCTIHYQHCTLILILLMLQSFV  45
            +   +  Q+C L+L+  +   F+
Sbjct  464  ASPQVVTQYCLLLLLTQVAVMFI  486



>ref|XP_003552102.1| PREDICTED: aspartic proteinase-like protein 1-like [Glycine max]
Length=520

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 148/219 (68%), Gaps = 5/219 (2%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFSL F++  SGRIFFGDQGP  Q+ T FLPL+G Y+ YI+ VE  CV +SCLK + F+ 
Sbjct  261  SFSLCFNEDDSGRIFFGDQGPTIQQSTSFLPLDGLYSTYIIGVESCCVGNSCLKMTSFKV  320

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLIL  462
            QVDSG+SFT LP   Y  +  +FD+ +N +RSS +   + YCY   S+ LP +PS+ L  
Sbjct  321  QVDSGTSFTFLPGHVYGAIAEEFDQQVNGSRSSFEGSPWEYCYVPSSQELPKVPSLTLTF  380

Query  461  SANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWS  282
              N SFV+ +P+F     +GV  +CL + P EG  G IGQNFMTGYR+VFD  N KL WS
Sbjct  381  QQNNSFVVYDPVFVFYGNEGVIGFCLAIQPTEGDMGTIGQNFMTGYRLVFDRGNKKLAWS  440

Query  281  ASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             SNC+DL    ++P++P     S++PLPT+EQQRT NGH
Sbjct  441  RSNCQDLSLGKRMPLSPNE--TSSNPLPTDEQQRT-NGH  476



>gb|KEH35307.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=423

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 148/222 (67%), Gaps = 4/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F++  SGR+FFGDQG   Q+ TPFL ++G ++ YIV VE  C+ +SC K + 
Sbjct  158  IRDSFSLCFNEDDSGRLFFGDQGSTVQQSTPFLLVDGMFSTYIVGVETCCIGNSCPKVTS  217

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F AQ DSG+SFT LP   Y  +  +FD+ +NATRS+     + YCY   S+ LP IP++ 
Sbjct  218  FNAQFDSGTSFTFLPGHAYGAIAEEFDKQVNATRSTFQGSPWEYCYVPSSQQLPKIPTLT  277

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F   N QGV  +CL + P EG  G IGQNFMTGYR+VFD EN KL
Sbjct  278  LMFQQNNSFVVYNPVFVSYNEQGVDGFCLAIQPTEGGMGTIGQNFMTGYRLVFDRENKKL  337

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             WS SNC+DL    ++P++P P G S+S LP +EQQRT  GH
Sbjct  338  AWSHSNCQDLSLGKRMPLSP-PNGTSSSQLPADEQQRT-KGH  377



>ref|XP_004502449.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X2 
[Cicer arietinum]
Length=529

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 175/264 (66%), Gaps = 7/264 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F++  SGR+FFGDQG   Q+ TPFLPL+G ++ YI+ VE +C+ + C K + 
Sbjct  267  IRDSFSLCFNEDSSGRLFFGDQGSTVQQSTPFLPLDGMFSTYIIGVEAFCIGNYCPKVTS  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+AQ DSG+SFTLLP   Y+ +  +FD+ +N TRS+++  ++ YCY    + LP IP++ 
Sbjct  327  FKAQFDSGTSFTLLPGHAYRAITEEFDKQVNVTRSTLNDSLWEYCYALSLQQLPKIPTLT  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L    N SFV+ NP+    N Q +  +CL + P EG  G IGQNFM GYR+VFD EN KL
Sbjct  387  LTFQQNNSFVVYNPIVVFYNNQEIDGFCLAIQPTEGDIGTIGQNFMMGYRLVFDRENKKL  446

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaas  111
             WS SNC+DL    ++P +P   G S++PLP +EQQR+ NGHAV+PA+AGR P +PS AS
Sbjct  447  AWSHSNCQDLGLGKRIPFSPA-NGTSSNPLPADEQQRS-NGHAVSPAVAGRTPQKPSVAS  504

Query  110  PCTIHYQ---HCTLILILLMLQSF  48
               I Y+   HC  +L+  +L  F
Sbjct  505  SQMISYRKHLHCYCLLLFQLLSIF  528



>ref|XP_002307112.2| hypothetical protein POPTR_0005s08170g [Populus trichocarpa]
 gb|EEE94108.2| hypothetical protein POPTR_0005s08170g [Populus trichocarpa]
Length=521

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 144/222 (65%), Gaps = 14/222 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F++  SGRIFFGDQGP  Q+  PFL L GNY  YIV VE  CV +SCLKQS 
Sbjct  267  IQNSFSMCFNEDDSGRIFFGDQGPATQQSAPFLKLNGNYTTYIVGVEVCCVGTSCLKQSS  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP + ++ +  +FD  +NA+RSS +   + YCYK  S+ LP IPS++
Sbjct  327  FSALVDSGTSFTFLPDDVFEMIAEEFDTQVNASRSSFEGYSWKYCYKTSSQDLPKIPSLR  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI   N SF++QNP+F I   QGV  +CL + P +G  G IG           D ENLKL
Sbjct  387  LIFPQNNSFMVQNPVFMIYGIQGVIGFCLAIQPADGDIGTIG----------LDRENLKL  436

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC D  D   +P+TP+  G   +PLPTNEQQ TP GH
Sbjct  437  GWSRSNCGDEGDGKTLPLTPS--GTPQNPLPTNEQQSTPGGH  476



>ref|XP_006464279.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X2 
[Citrus sinensis]
Length=526

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 149/222 (67%), Gaps = 8/222 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ T FL   G Y  YI+ VE  C+ SSCLKQ+ 
Sbjct  266  IRNSFSMCFDEDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTI  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP + Y+ +  +FD  +N T +S + +   YCYK+ S+ LP +PS+K
Sbjct  326  FKAIVDSGSSFTFLPKDIYETIAAEFDRQVNDTITSFEGYPWKYCYKSSSQRLPKLPSVK  385

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV  NP+F I    GV  +CL + P +G  G IG+     YR+VFD ENLKL
Sbjct  386  LMFPQNNSFVANNPVFVIYGTPGVTGFCLAIQPADGDIGTIGR-----YRVVFDRENLKL  440

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS SNC+DL+D+ K P+TP PG  S +PLP N++Q +P GH
Sbjct  441  GWSHSNCQDLNDSTKSPLTPGPGTPS-NPLPANQEQSSPGGH  481



>ref|XP_004502450.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X3 
[Cicer arietinum]
 ref|XP_004502451.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X4 
[Cicer arietinum]
Length=424

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 175/265 (66%), Gaps = 8/265 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F++  SGR+FFGDQG   Q+ TPFLPL+G ++ YI+ VE +C+ + C K + 
Sbjct  161  IRDSFSLCFNEDSSGRLFFGDQGSTVQQSTPFLPLDGMFSTYIIGVEAFCIGNYCPKVTS  220

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+AQ DSG+SFTLLP   Y+ +  +FD+ +N TRS+++  ++ YCY    + LP IP++ 
Sbjct  221  FKAQFDSGTSFTLLPGHAYRAITEEFDKQVNVTRSTLNDSLWEYCYALSLQQLPKIPTLT  280

Query  470  LILSANQSFVIQNPMFPILNYQ-GVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L    N SFV+ NP+    N Q  +  +CL + P EG  G IGQNFM GYR+VFD EN K
Sbjct  281  LTFQQNNSFVVYNPIVVFYNNQVEIDGFCLAIQPTEGDIGTIGQNFMMGYRLVFDRENKK  340

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
            L WS SNC+DL    ++P +P   G S++PLP +EQQR+ NGHAV+PA+AGR P +PS A
Sbjct  341  LAWSHSNCQDLGLGKRIPFSPA-NGTSSNPLPADEQQRS-NGHAVSPAVAGRTPQKPSVA  398

Query  113  sPCTIHYQ---HCTLILILLMLQSF  48
            S   I Y+   HC  +L+  +L  F
Sbjct  399  SSQMISYRKHLHCYCLLLFQLLSIF  423



>ref|XP_011090460.1| PREDICTED: aspartic proteinase-like protein 1 isoform X3 [Sesamum 
indicum]
Length=371

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 145/212 (68%), Gaps = 2/212 (1%)
 Frame = -2

Query  794  QSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRAQVDSGSS  615
            +  SGR+FFGDQG  +Q+ TPFLPL+G    YI+ V+  C+ SSCL  + F   VDSG+S
Sbjct  124  EDDSGRLFFGDQGVASQQTTPFLPLDGKNLTYIIGVDACCIGSSCLDNTNFEMLVDSGTS  183

Query  614  FTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMKLILSANQSFV  441
            FT LP + Y++VV++FD  +NA++SS + +   YCYK+ S+G P IPS+ L  + + SFV
Sbjct  184  FTFLPDQIYERVVDEFDRQVNASKSSFEGYPWQYCYKSSSQGEPKIPSLTLKFATSNSFV  243

Query  440  IQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWSASNCKDL  261
            +++P+F I   QG   +CL + P +   G IGQNFMTGY++VFD EN KLGWS SNC+DL
Sbjct  244  VKDPVFVIYGTQGAVGFCLAIQPTDQTIGTIGQNFMTGYQIVFDRENFKLGWSRSNCQDL  303

Query  260  DDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            D  D+VP+  +    S + LPT EQQ  PNG+
Sbjct  304  DYGDRVPLNSSGNSNSPNSLPTAEQQSAPNGN  335



>ref|XP_003602006.1| Aspartic proteinase-like protein [Medicago truncatula]
 gb|AES72257.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=529

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 148/222 (67%), Gaps = 4/222 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F++  SGR+FFGDQG   Q+ TPFL ++G ++ YIV VE  C+ +SC K + 
Sbjct  264  IRDSFSLCFNEDDSGRLFFGDQGSTVQQSTPFLLVDGMFSTYIVGVETCCIGNSCPKVTS  323

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F AQ DSG+SFT LP   Y  +  +FD+ +NATRS+     + YCY   S+ LP IP++ 
Sbjct  324  FNAQFDSGTSFTFLPGHAYGAIAEEFDKQVNATRSTFQGSPWEYCYVPSSQQLPKIPTLT  383

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F   N QGV  +CL + P EG  G IGQNFMTGYR+VFD EN KL
Sbjct  384  LMFQQNNSFVVYNPVFVSYNEQGVDGFCLAIQPTEGGMGTIGQNFMTGYRLVFDRENKKL  443

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
             WS SNC+DL    ++P++P P G S+S LP +EQQRT  GH
Sbjct  444  AWSHSNCQDLSLGKRMPLSP-PNGTSSSQLPADEQQRT-KGH  483



>ref|XP_009347207.1| PREDICTED: aspartic proteinase-like protein 1 [Pyrus x bretschneideri]
Length=529

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 147/225 (65%), Gaps = 7/225 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL FD + SGRI FGDQG   Q+ TPFLP+E  Y  Y V VE  CV SSCLKQ+G
Sbjct  266  IQNSFSLCFDANGSGRILFGDQGHLAQQSTPFLPMEEKYVAYSVGVEQCCVASSCLKQTG  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV----FHYCYKARSEGLPNIPS  477
            F+A VDSGSSFT +P E Y+K+V +FD+ +NATR  ID+    + YCY   S  L NIP+
Sbjct  326  FQALVDSGSSFTYVPTEVYEKIVFEFDKQVNATR--IDLQQSPWKYCYNVSSLELLNIPT  383

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            MKL+   NQSF++  P+F     Q    +CL +L  +  YG+IGQNFM GYR+VFD ENL
Sbjct  384  MKLMFPLNQSFLVNKPIFSETVDQKYTIFCLTLLRTDDEYGIIGQNFMVGYRLVFDRENL  443

Query  296  KLGWSASNCK-DLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            K GWS +NC+ ++ D    P   T G  S  P+PTNEQQ   N H
Sbjct  444  KFGWSNANCENNIHDKKANPAPSTNGSTSQLPVPTNEQQNISNPH  488



>ref|XP_008812722.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase-like protein 
1 [Phoenix dactylifera]
Length=521

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 171/263 (65%), Gaps = 3/263 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F +  SGRI+FGDQG   Q+ TPF+P  G    YIVE E +C+ S CL ++ 
Sbjct  258  VRNSFSLCFQEEDSGRIYFGDQGVATQQSTPFIPSNGKXITYIVEAESFCIGSRCLGKNI  317

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV--FHYCYKARSEGLPNIPSMK  471
            F + VDSG+SFT LP   YK+V  +FD  +NA R + +V  + YCYKA    +P +P++ 
Sbjct  318  FHSLVDSGTSFTFLPDNVYKRVTTEFDRQVNAPRLAYNVSPWEYCYKASPLEMPVVPTVT  377

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            LI + N+SFV  +P++ I   +G +  +CL +       G+IGQN MTGYRMVFD ENLK
Sbjct  378  LIFAVNKSFVANSPVYHIYGEEGNLAGFCLALQSTADSMGIIGQNLMTGYRMVFDRENLK  437

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
            LGWS SNC+DLD++  V +TP P     +PLPT++QQ TP G AVAPA+AGR PP   +A
Sbjct  438  LGWSQSNCQDLDNSRPVHLTPPPQNRPENPLPTDQQQSTPRGRAVAPAVAGRTPPTNPSA  497

Query  113  sPCTIHYQHCTLILILLMLQSFV  45
            +   +  Q+C L+L+  +   F+
Sbjct  498  ASPLVVAQYCLLLLVTQVAVMFI  520



>ref|XP_004502448.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X1 
[Cicer arietinum]
Length=530

 Score =   218 bits (555),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 175/265 (66%), Gaps = 8/265 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F++  SGR+FFGDQG   Q+ TPFLPL+G ++ YI+ VE +C+ + C K + 
Sbjct  267  IRDSFSLCFNEDSSGRLFFGDQGSTVQQSTPFLPLDGMFSTYIIGVEAFCIGNYCPKVTS  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+AQ DSG+SFTLLP   Y+ +  +FD+ +N TRS+++  ++ YCY    + LP IP++ 
Sbjct  327  FKAQFDSGTSFTLLPGHAYRAITEEFDKQVNVTRSTLNDSLWEYCYALSLQQLPKIPTLT  386

Query  470  LILSANQSFVIQNPMFPILNYQ-GVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L    N SFV+ NP+    N Q  +  +CL + P EG  G IGQNFM GYR+VFD EN K
Sbjct  387  LTFQQNNSFVVYNPIVVFYNNQVEIDGFCLAIQPTEGDIGTIGQNFMMGYRLVFDRENKK  446

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
            L WS SNC+DL    ++P +P   G S++PLP +EQQR+ NGHAV+PA+AGR P +PS A
Sbjct  447  LAWSHSNCQDLGLGKRIPFSPA-NGTSSNPLPADEQQRS-NGHAVSPAVAGRTPQKPSVA  504

Query  113  sPCTIHYQ---HCTLILILLMLQSF  48
            S   I Y+   HC  +L+  +L  F
Sbjct  505  SSQMISYRKHLHCYCLLLFQLLSIF  529



>ref|XP_009401448.1| PREDICTED: aspartic proteinase-like protein 1 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 147/224 (66%), Gaps = 4/224 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL F   +SGR+ FGD+G  +Q+ TPF+PL+G Y  YI+ VE  C+ S C  ++ 
Sbjct  255  IQNSFSLCFRDDNSGRLLFGDEGLSSQQSTPFVPLDGKYITYIIAVESLCIGSQCPGKTS  314

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID---VFHYCYKARSEGLPNIPSM  474
            F A VDSGSSFT LP   YK+V  +FD  +N +R + D    + YCY+A   G+P +P++
Sbjct  315  FHALVDSGSSFTFLPDNVYKRVTMEFDTQVNVSRLATDNESPWEYCYEASPLGMPAVPTV  374

Query  473  KLILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            KLI   N+SF   NP+F + + +G +  +CL +   +   G IGQNFMTGY MVFD ENL
Sbjct  375  KLIFGGNKSFTAVNPIFLVYDNEGELTAFCLALQSSQETLGTIGQNFMTGYHMVFDRENL  434

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            KLGWS S+C+DLD+  ++P++  P     +PLPTNEQ  +PN H
Sbjct  435  KLGWSQSDCRDLDNTRRMPLSSPPHNRPENPLPTNEQHSSPNTH  478



>ref|XP_006593577.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X2 
[Glycine max]
 gb|KHN26064.1| Aspartic proteinase-like protein 1 [Glycine soja]
Length=529

 Score =   212 bits (540),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 168/267 (63%), Gaps = 8/267 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+  D++ SGRI FGDQG   Q  TPFLP+ G +  Y+V VE +CV S CLK++ 
Sbjct  268  IQNSFSICLDENESGRIIFGDQGHVTQHSTPFLPMYGKFIAYMVGVESFCVGSLCLKETR  327

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI-DVFHYCYKARSEGLPNIPSMKL  468
            F+A +DSGSSFT LP E Y+KVV +FD+ +NA+R  +   + YCY A S+ L NIP +KL
Sbjct  328  FQALIDSGSSFTFLPNEVYQKVVTEFDKQVNASRIVLQSSWEYCYNASSQELVNIPPLKL  387

Query  467  ILSANQSFVIQNPMF--PILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
              S NQ+F+IQNP+F  P    Q    +CL V P    Y  IGQNF+ GYR+VFD ENL+
Sbjct  388  AFSRNQTFLIQNPIFYDPASQEQEYTIFCLPVSPSADDYAAIGQNFLMGYRLVFDRENLR  447

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
             GWS  NC+     D+   T    G S +PLP N+QQ  PN   V PA+AG   P+PSAA
Sbjct  448  FGWSRWNCQ-----DRASFTSPSNGGSPNPLPANQQQTVPNARGVPPAIAGHTSPKPSAA  502

Query  113  sPCTIHYQHCTLILILLMLQSFVWLCC  33
            +P  +     +L  +LL+   ++WL C
Sbjct  503  TPGLVTTSRHSLASLLLICHLWLWLSC  529



>gb|KHN04699.1| Aspartic proteinase-like protein 1 [Glycine soja]
Length=528

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 127/267 (48%), Positives = 174/267 (65%), Gaps = 9/267 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F+++ SGRI FGDQG   Q  TPFLP++G +N YIV VE +CV S CLK++ 
Sbjct  268  IQNSFSICFEENESGRIIFGDQGHVTQHSTPFLPIDGKFNAYIVGVESFCVGSLCLKETR  327

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI-DVFHYCYKARSEGLPNIPSMKL  468
            F+A +DSGSSFT LP E Y+KVV +FD+ +NATR  + + + YCY A S+ L +IP + L
Sbjct  328  FQALIDSGSSFTFLPNEVYQKVVIEFDKQVNATRIVLQNSWEYCYNASSQELISIPPLNL  387

Query  467  ILSANQSFVIQNPMF--PILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
              S NQ+F+IQNP+F  P    Q    +CL V P +  Y  IGQNF+ GYRMVFD ENL+
Sbjct  388  AFSRNQTFLIQNPIFIDPASQEQEYTIFCLPVSPSDDDYAAIGQNFLMGYRMVFDRENLR  447

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
              WS  NC+D         +P   G S +PLP ++QQ  PN H + PA+AG    +PSAA
Sbjct  448  FSWSRWNCQDRASFS----SPYSVG-SPNPLPVDQQQSFPNAHGIPPAIAGHTSSKPSAA  502

Query  113  sPCTIHYQHCTLILILLMLQSFVWLCC  33
            +P  I  +H +L+ +LL+   ++WL C
Sbjct  503  TPELITSRH-SLVSLLLICHLWLWLFC  528



>ref|XP_006596325.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X2 
[Glycine max]
Length=428

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 174/267 (65%), Gaps = 9/267 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F+++ SGRI FGDQG   Q  TPFLP++G +N YIV VE +CV S CLK++ 
Sbjct  168  IQNSFSICFEENESGRIIFGDQGHVTQHSTPFLPIDGKFNAYIVGVESFCVGSLCLKETR  227

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI-DVFHYCYKARSEGLPNIPSMKL  468
            F+A +DSGSSFT LP E Y+KVV +FD+ +NAT   + + + YCY A S+ L +IP + L
Sbjct  228  FQALIDSGSSFTFLPNEVYQKVVIEFDKQVNATSIVLQNSWEYCYNASSQELISIPPLNL  287

Query  467  ILSANQSFVIQNPMF--PILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
              S NQ+++IQNP+F  P    Q    +CL V P +  Y  IGQNF+ GYRMVFD ENL+
Sbjct  288  AFSRNQTYLIQNPIFIDPASQEQEYTIFCLPVSPSDDDYAAIGQNFLMGYRMVFDRENLR  347

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
              WS  NC+D         +P   G S +PLP ++QQ  PN H + PA+AG   P+PSAA
Sbjct  348  FSWSRWNCQDRASFS----SPYSVG-SPNPLPVDQQQSFPNAHGIPPAIAGHTSPKPSAA  402

Query  113  sPCTIHYQHCTLILILLMLQSFVWLCC  33
            +P  I  +H +L+ +LL+   ++WL C
Sbjct  403  TPELITSRH-SLVSLLLICHLWLWLFC  428



>gb|KDO80881.1| hypothetical protein CISIN_1g0092712mg, partial [Citrus sinensis]
Length=342

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 131/185 (71%), Gaps = 2/185 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD++ SG +FFGDQGP  Q+ T FLP+   Y+ Y V VE YC+ +SCL QSG
Sbjct  157  IQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPIGEKYDAYFVGVESYCIGNSCLTQSG  216

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP E Y +VV KFD+L+++ R S+  + + YCY A SE +  +P M+
Sbjct  217  FQALVDSGASFTFLPTEIYAEVVVKFDKLVSSKRISLQGNSWKYCYNASSEEMLKVPDMR  276

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI S NQSFV++N +F     +G   +CL V+  +G YG+IGQNFM G+R+VFD ENLKL
Sbjct  277  LIFSKNQSFVVRNHIFSFPENEGFTVFCLTVMSTDGDYGIIGQNFMMGHRIVFDRENLKL  336

Query  290  GWSAS  276
             WS S
Sbjct  337  AWSHS  341



>ref|XP_007223258.1| hypothetical protein PRUPE_ppa004428mg [Prunus persica]
 gb|EMJ24457.1| hypothetical protein PRUPE_ppa004428mg [Prunus persica]
Length=510

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 140/222 (63%), Gaps = 22/222 (10%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL FD + SGRI FGDQG   Q +TPFLP  G Y  Y V VE +CV SSCLKQ+G
Sbjct  266  IQNSFSLCFDDNGSGRILFGDQGNLAQHYTPFLPAAGKYVNYFVGVERFCVGSSCLKQTG  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV--FHYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT +P E YKK+V +FD+ +NATR +I    + YCY   S  L +IP++K
Sbjct  326  FQALVDSGSSFTYVPTEVYKKIVFEFDKQVNATRINIQQSPWKYCYNVSSWELLSIPTIK  385

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   NQSF++  P+F     Q                    +NFM GYRMVFDWENLKL
Sbjct  386  LMFPLNQSFLVHKPVFSESLNQ-------------------AKNFMVGYRMVFDWENLKL  426

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            GWS +NC+D  +  +V  TP+  G S S LPT+EQQ  PN H
Sbjct  427  GWSIANCEDNGNGKRVNHTPSNNG-STSQLPTSEQQSIPNAH  467



>ref|XP_006596324.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X1 
[Glycine max]
Length=528

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 174/267 (65%), Gaps = 9/267 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F+++ SGRI FGDQG   Q  TPFLP++G +N YIV VE +CV S CLK++ 
Sbjct  268  IQNSFSICFEENESGRIIFGDQGHVTQHSTPFLPIDGKFNAYIVGVESFCVGSLCLKETR  327

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI-DVFHYCYKARSEGLPNIPSMKL  468
            F+A +DSGSSFT LP E Y+KVV +FD+ +NAT   + + + YCY A S+ L +IP + L
Sbjct  328  FQALIDSGSSFTFLPNEVYQKVVIEFDKQVNATSIVLQNSWEYCYNASSQELISIPPLNL  387

Query  467  ILSANQSFVIQNPMF--PILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
              S NQ+++IQNP+F  P    Q    +CL V P +  Y  IGQNF+ GYRMVFD ENL+
Sbjct  388  AFSRNQTYLIQNPIFIDPASQEQEYTIFCLPVSPSDDDYAAIGQNFLMGYRMVFDRENLR  447

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
              WS  NC+D         +P   G S +PLP ++QQ  PN H + PA+AG   P+PSAA
Sbjct  448  FSWSRWNCQDRASFS----SPYSVG-SPNPLPVDQQQSFPNAHGIPPAIAGHTSPKPSAA  502

Query  113  sPCTIHYQHCTLILILLMLQSFVWLCC  33
            +P  I  +H +L+ +LL+   ++WL C
Sbjct  503  TPELITSRH-SLVSLLLICHLWLWLFC  528



>ref|XP_009381525.1| PREDICTED: aspartic proteinase-like protein 1 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 146/223 (65%), Gaps = 5/223 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL F    SGRI FGD+G   Q+ TPF+PL+G Y+ Y++ VE +C+ SSC  ++ 
Sbjct  262  IRNSFSLCFRDDDSGRILFGDRGLPTQQSTPFVPLDGKYDTYVIAVESFCMGSSCPGKTS  321

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID---VFHYCYKARSEGLPNIPSM  474
            F A +DSGSSFT LP + YK+V  +FD  +N ++ + +    + YCY+A   G+P +P +
Sbjct  322  FHALIDSGSSFTFLPNDIYKRVTLEFDRQVNVSKRATNNESPWEYCYEASPLGMPGLPKV  381

Query  473  KLILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            KLI   N+SF++ NP++P  N +G +  +CL +   +   G IGQNFMTGY +VFD ENL
Sbjct  382  KLIFGGNKSFMVINPIYPFFNTEGELAVFCLALQSSQESLGTIGQNFMTGYHLVFDRENL  441

Query  296  KLGWSASNC-KDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            KL WS S+C  DLD++ ++P+   P     +PLPTNEQ   PN
Sbjct  442  KLRWSRSDCHHDLDNSRRMPLGSPPRNRPENPLPTNEQHSFPN  484



>ref|XP_008681163.1| PREDICTED: pepsin A isoform X1 [Zea mays]
Length=426

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 142/220 (65%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG  +Q+ TPF+PL G    Y V V+  C+   CL+ S 
Sbjct  166  VRNSFSMCFKEDSSGRIFFGDQGVSSQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEGSS  225

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + YK    +FD+ +NA+R   +   + YCY A    +P++P++ 
Sbjct  226  FQALVDSGTSFTSLPPDVYKAFTTEFDKQINASRVPYEDSTWKYCYSASPLEMPDVPTII  285

Query  470  LILSANQSFVIQNPMFPILNYQGVKC-YCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +AN+SF   NP+ P  + QG    +CL VLP     G+IGQNF+ GY +VFD E++K
Sbjct  286  LAFAANKSFQAVNPILPFNDEQGALARFCLAVLPSTEPIGIIGQNFLVGYHVVFDRESMK  345

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C+D+D++  VP+ P+  G S  PLP+NEQQ +P
Sbjct  346  LGWYRSECRDVDNSTTVPLGPSQHGSSEDPLPSNEQQTSP  385



>ref|XP_004953938.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X2 
[Setaria italica]
Length=426

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 141/220 (64%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F + +SGRIFFGDQG   Q+ TPF+PL G    Y V V+  C+   CL+ +G
Sbjct  166  VRNSFSMCFKEDNSGRIFFGDQGVSTQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEDTG  225

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP + YK V  +FD+ MNA+R   +   + YCY A    +P++P++ 
Sbjct  226  FEALVDSGTSFTSLPPDVYKAVTVEFDKQMNASRVPFEDSTWKYCYSASPLEMPDVPTIT  285

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +AN+SF   +P+ P  + QG +  +CL VLP     G+I QNF+ GY +VFD EN+K
Sbjct  286  LTFAANKSFQAVSPILPFNDKQGALAGFCLAVLPSPEPIGIIAQNFLVGYHVVFDRENMK  345

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C+D+D++  VP+ P+       PLP+NEQQ +P
Sbjct  346  LGWYRSECRDVDNSTTVPLGPSQHNSPEDPLPSNEQQTSP  385



>ref|XP_003542587.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X1 
[Glycine max]
Length=525

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 166/267 (62%), Gaps = 12/267 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+  D++ SGRI FGDQG   Q  TPFLP+      Y+V VE +CV S CLK++ 
Sbjct  268  IQNSFSICLDENESGRIIFGDQGHVTQHSTPFLPIIA----YMVGVESFCVGSLCLKETR  323

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI-DVFHYCYKARSEGLPNIPSMKL  468
            F+A +DSGSSFT LP E Y+KVV +FD+ +NA+R  +   + YCY A S+ L NIP +KL
Sbjct  324  FQALIDSGSSFTFLPNEVYQKVVTEFDKQVNASRIVLQSSWEYCYNASSQELVNIPPLKL  383

Query  467  ILSANQSFVIQNPMF--PILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
              S NQ+F+IQNP+F  P    Q    +CL V P    Y  IGQNF+ GYR+VFD ENL+
Sbjct  384  AFSRNQTFLIQNPIFYDPASQEQEYTIFCLPVSPSADDYAAIGQNFLMGYRLVFDRENLR  443

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaa  114
             GWS  NC+     D+   T    G S +PLP N+QQ  PN   V PA+AG   P+PSAA
Sbjct  444  FGWSRWNCQ-----DRASFTSPSNGGSPNPLPANQQQTVPNARGVPPAIAGHTSPKPSAA  498

Query  113  sPCTIHYQHCTLILILLMLQSFVWLCC  33
            +P  +     +L  +LL+   ++WL C
Sbjct  499  TPGLVTTSRHSLASLLLICHLWLWLSC  525



>gb|KDO80878.1| hypothetical protein CISIN_1g0092712mg, partial [Citrus sinensis]
Length=458

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 131/185 (71%), Gaps = 2/185 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD++ SG +FFGDQGP  Q+ T FLP+   Y+ Y V VE YC+ +SCL QSG
Sbjct  273  IQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPIGEKYDAYFVGVESYCIGNSCLTQSG  332

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP E Y +VV KFD+L+++ R S+  + + YCY A SE +  +P M+
Sbjct  333  FQALVDSGASFTFLPTEIYAEVVVKFDKLVSSKRISLQGNSWKYCYNASSEEMLKVPDMR  392

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            LI S NQSFV++N +F     +G   +CL V+  +G YG+IGQNFM G+R+VFD ENLKL
Sbjct  393  LIFSKNQSFVVRNHIFSFPENEGFTVFCLTVMSTDGDYGIIGQNFMMGHRIVFDRENLKL  452

Query  290  GWSAS  276
             WS S
Sbjct  453  AWSHS  457



>ref|XP_007141134.1| hypothetical protein PHAVU_008G170200g [Phaseolus vulgaris]
 gb|ESW13128.1| hypothetical protein PHAVU_008G170200g [Phaseolus vulgaris]
Length=532

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 139/221 (63%), Gaps = 8/221 (4%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+   ++ SGRI FGDQG   Q  TPFLP+ G +  Y+V  E +CV S CLK++ F+
Sbjct  270  NSFSICLGENESGRIIFGDQGHATQHSTPFLPINGEFTAYMVGAESFCVGSLCLKETRFQ  329

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI-DVFHYCYKARSEGLPNIPSMKLIL  462
              +DSGSSFT LP E Y+KVV +FD+ +NA R  +   + YCY A S+ L NIP +KL  
Sbjct  330  LLIDSGSSFTYLPNEVYQKVVMEFDKQVNAARIILPHTWDYCYNASSQELINIPPLKLAF  389

Query  461  SANQSFVIQNPMF--PILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
            S NQ+ + QNP++  P    Q    +CL + P +  Y +IGQN++ GYRMVFD ENL+ G
Sbjct  390  SRNQTLLFQNPIYTGPASQEQDYTLFCLPITPTDEDYAIIGQNYLIGYRMVFDRENLRFG  449

Query  287  WSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            WS  NC+     D+  +T    G S +PLP N+QQ  PN H
Sbjct  450  WSRWNCQ-----DRASLTSPSNGGSPNPLPANQQQSVPNAH  485



>ref|NP_001048134.1| Os02g0751100 [Oryza sativa Japonica Group]
 dbj|BAD15642.1| aspartyl protease-like [Oryza sativa Japonica Group]
 dbj|BAF10048.1| Os02g0751100 [Oryza sativa Japonica Group]
 gb|EEE57813.1| hypothetical protein OsJ_08401 [Oryza sativa Japonica Group]
Length=520

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 139/220 (63%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG   Q+ TPF+P+ G    Y V V+ YC+   C + +G
Sbjct  261  VRNSFSMCFKKDDSGRIFFGDQGVPTQQSTPFVPMNGKLQTYAVNVDKYCIGHKCTEGAG  320

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VD+G+SFT LP + YK +  +FD+ +NA+R+S D   F YCY      +P++P++ 
Sbjct  321  FQALVDTGTSFTSLPLDAYKSITMEFDKQINASRASSDDYSFEYCYSTGPLEMPDVPTIT  380

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  + N+SF   NP+ P  + QG    +CL VLP     G+IGQNFM GY +VFD EN+K
Sbjct  381  LTFAENKSFQAVNPILPFNDRQGEFAVFCLAVLPSPEPVGIIGQNFMVGYHVVFDRENMK  440

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C DLD++  V + P+       PLP+NEQQ +P
Sbjct  441  LGWYRSECHDLDNSTTVSLGPSQHNSPEDPLPSNEQQTSP  480



>ref|NP_001132197.1| pepsin A precursor [Zea mays]
 gb|ACF80949.1| unknown [Zea mays]
 gb|ACG24576.1| pepsin A [Zea mays]
 gb|AFW73465.1| pepsin A [Zea mays]
Length=519

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 142/220 (65%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG  +Q+ TPF+PL G    Y V V+  C+   CL+ S 
Sbjct  259  VRNSFSMCFKEDSSGRIFFGDQGVSSQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEGSS  318

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + YK    +FD+ +NA+R   +   + YCY A    +P++P++ 
Sbjct  319  FQALVDSGTSFTSLPPDVYKAFTTEFDKQINASRVPYEDSTWKYCYSASPLEMPDVPTII  378

Query  470  LILSANQSFVIQNPMFPILNYQGVKC-YCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +AN+SF   NP+ P  + QG    +CL VLP     G+IGQNF+ GY +VFD E++K
Sbjct  379  LAFAANKSFQAVNPILPFNDEQGALARFCLAVLPSTEPIGIIGQNFLVGYHVVFDRESMK  438

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C+D+D++  VP+ P+  G S  PLP+NEQQ +P
Sbjct  439  LGWYRSECRDVDNSTTVPLGPSQHGSSEDPLPSNEQQTSP  478



>gb|EEC74016.1| hypothetical protein OsI_08957 [Oryza sativa Indica Group]
Length=520

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 139/220 (63%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG   Q+ TPF+P+ G    Y V V+ YC+   C + +G
Sbjct  261  VRNSFSMCFKKDDSGRIFFGDQGVPTQQSTPFVPMNGKLQTYAVNVDKYCIGHKCTEGAG  320

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VD+G+SFT LP + YK +  +FD+ +NA+R+S D   F YCY      +P++P++ 
Sbjct  321  FQALVDTGTSFTSLPLDAYKSITMEFDKQINASRASSDDYSFEYCYSTGPLEMPDVPTIT  380

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  + N+SF   NP+ P  + QG    +CL VLP     G+IGQNFM GY +VFD EN+K
Sbjct  381  LTFAENKSFQAVNPILPFNDRQGEFAVFCLAVLPSPEPVGIIGQNFMVGYHVVFDRENMK  440

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C DLD++  V + P+       PLP+NEQQ +P
Sbjct  441  LGWYRSECHDLDNSTMVSLGPSQHNSPEDPLPSNEQQTSP  480



>ref|XP_004953937.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X1 
[Setaria italica]
Length=519

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 141/220 (64%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F + +SGRIFFGDQG   Q+ TPF+PL G    Y V V+  C+   CL+ +G
Sbjct  259  VRNSFSMCFKEDNSGRIFFGDQGVSTQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEDTG  318

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP + YK V  +FD+ MNA+R   +   + YCY A    +P++P++ 
Sbjct  319  FEALVDSGTSFTSLPPDVYKAVTVEFDKQMNASRVPFEDSTWKYCYSASPLEMPDVPTIT  378

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +AN+SF   +P+ P  + QG +  +CL VLP     G+I QNF+ GY +VFD EN+K
Sbjct  379  LTFAANKSFQAVSPILPFNDKQGALAGFCLAVLPSPEPIGIIAQNFLVGYHVVFDRENMK  438

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C+D+D++  VP+ P+       PLP+NEQQ +P
Sbjct  439  LGWYRSECRDVDNSTTVPLGPSQHNSPEDPLPSNEQQTSP  478



>gb|AGV54159.1| aspartic proteinase-like protein [Phaseolus vulgaris]
Length=532

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 137/219 (63%), Gaps = 8/219 (4%)
 Frame = -2

Query  812  FSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRAQ  633
            FS+   ++ SGRI FGDQG   Q  TPFLP+ G +  Y+V  E +CV S CLK++ F+  
Sbjct  272  FSICLGENESGRIIFGDQGHATQHSTPFLPINGEFTAYMVGAESFCVGSLCLKETRFQLL  331

Query  632  VDSGSSFTLLPYETYKKVVNKFDELMNATRSSI-DVFHYCYKARSEGLPNIPSMKLILSA  456
            +DSGSSFT LP E Y+KVV +FD+ +NA R  +   + YCY A S+ L NIP +KL  S 
Sbjct  332  IDSGSSFTYLPNEVYQKVVMEFDKQVNAARIILPHTWDYCYNASSQELINIPPLKLAFSR  391

Query  455  NQSFVIQNPMF--PILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWS  282
            NQ+ + QNP++  P    Q    +CL + P +  Y +IGQN++ GYRMVFD ENL+ GWS
Sbjct  392  NQTLLFQNPIYTGPASQEQDYTLFCLPITPTDEDYAIIGQNYLIGYRMVFDRENLRFGWS  451

Query  281  ASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
              NC+     D+  +T    G S +PLP N+QQ  PN H
Sbjct  452  RWNCQ-----DRASLTSPSNGGSPNPLPANQQQSVPNAH  485



>ref|XP_008339224.1| PREDICTED: aspartic proteinase-like protein 1 [Malus domestica]
 ref|XP_008344287.1| PREDICTED: aspartic proteinase-like protein 1 [Malus domestica]
Length=465

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 130/192 (68%), Gaps = 6/192 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL FD + SGRI FGDQG   Q+ TPFLP+E  Y  Y V VE  CV  SCLKQ+G
Sbjct  266  IQNSFSLCFDANGSGRILFGDQGHLAQQSTPFLPMEEKYVAYSVGVEQCCVARSCLKQTG  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV----FHYCYKARSEGLPNIPS  477
            F+A VDSGSSFT +P E Y+K+V +FD+ +NATR  ID+    + YCY   S  L NIP+
Sbjct  326  FQALVDSGSSFTYVPTEVYEKIVFEFDKQVNATR--IDLQQSPWKYCYNVSSLELLNIPT  383

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            MKL+   NQSF++  P+F     Q    +CL +L  +  YG+IGQNFM GYR+VFD ENL
Sbjct  384  MKLMFPLNQSFLVNKPIFSETLDQKYTIFCLTLLRTDDEYGIIGQNFMVGYRLVFDRENL  443

Query  296  KLGWSASNCKDL  261
            K GWS +NCK L
Sbjct  444  KFGWSNANCKYL  455



>gb|KJB49161.1| hypothetical protein B456_008G103400 [Gossypium raimondii]
Length=354

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 130/188 (69%), Gaps = 2/188 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD   SGRI+FGD+GP  Q  T FLP +G Y  YIV VE  C+ +SCLKQ G
Sbjct  165  IRNSFSMCFDDEDSGRIYFGDKGPPTQESTHFLPSDGKYETYIVGVEACCIGNSCLKQMG  224

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP E Y+++  +FD  +NAT +S   +   YCYK+ SE LP +P +K
Sbjct  225  FSAVVDSGTSFTFLPNEVYERIAKEFDRQINATITSYPGYPWKYCYKSSSEELPKVPHLK  284

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L+   N SFV+ NP+F +   QG+  +CL V P+EG  G IGQNFMTGYRMVFD E +KL
Sbjct  285  LVFPLNNSFVVFNPVFVVYGIQGISGFCLAVQPMEGDVGTIGQNFMTGYRMVFDREKMKL  344

Query  290  GWSASNCK  267
            GWS SNCK
Sbjct  345  GWSPSNCK  352



>gb|ACN27411.1| unknown [Zea mays]
Length=378

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 139/220 (63%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG  +Q+ TPF+PL G    Y V V+  C+   CL+ + 
Sbjct  118  VQNSFSMCFKEDSSGRIFFGDQGVPSQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEGTS  177

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP++ YK    +FD+ MNATR   +   + YCY A    +P++P++ 
Sbjct  178  FKALVDSGTSFTSLPFDVYKAFTMEFDKQMNATRVPYEDTTWKYCYSASPLEMPDVPTIT  237

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +A++S    NP+ P  + QG +  +CL VLP     G+I QNF+ GY +VFD E++K
Sbjct  238  LTFAADKSLQAVNPILPFNDKQGALAGFCLAVLPSTEPIGIIAQNFLVGYHVVFDRESMK  297

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C+ ++D+  VP+ P+       PLP+NEQQ +P
Sbjct  298  LGWYRSECRYVEDSTTVPLGPSQHDSPEDPLPSNEQQTSP  337



>dbj|BAE98882.1| predicted GPI-anchored protein [Arabidopsis thaliana]
Length=313

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 148/225 (66%), Gaps = 15/225 (7%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGN-YNKYIVEVEHYCVESSCLKQSGF  642
            +SFSL FD+  SGRI+FGD GP  Q+ TPFL L+ N Y+ YIV VE  C+ +SCLKQ+ F
Sbjct  54   NSFSLCFDEEDSGRIYFGDMGPSIQQSTPFLQLDNNKYSGYIVGVEACCIGNSCLKQTSF  113

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKL  468
               +DSG SFT LP E Y+KV  + D  +NAT  + +   + YCY++ +E  P +P++KL
Sbjct  114  TTFIDSGQSFTYLPEEIYRKVALEIDRHINATSKNFEGVSWEYCYESSAE--PKVPAIKL  171

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPI--EGIYGLIGQNFMTGYRMVFDWENLK  294
              S N +FVI  P+F     QG+  +CL + P   EGI G IGQN+M GYRMVFD EN+K
Sbjct  172  KFSHNNTFVIHKPLFVFQQSQGLVQFCLPISPSGQEGI-GSIGQNYMRGYRMVFDRENMK  230

Query  293  LGWSASNCKDLDDNDKV-PVTPTPGGLSA-SPLPTNEQQRTPNGH  165
            LGWS S C++    DK+ P   +PG  S+ +PLPT+EQQ +  GH
Sbjct  231  LGWSPSKCQE----DKIEPPQASPGSTSSPNPLPTDEQQ-SRGGH  270



>gb|EYU31043.1| hypothetical protein MIMGU_mgv1a018151mg, partial [Erythranthe 
guttata]
Length=503

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/262 (42%), Positives = 156/262 (60%), Gaps = 21/262 (8%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFSL F++  SGR+FFGDQG   Q+ TPFLPL+G    YIV V+  CV SSCL ++ 
Sbjct  260  IKNSFSLCFNEDDSGRLFFGDQGIAEQQTTPFLPLDGKNLTYIVGVDECCVGSSCLDKTS  319

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+  VDSG+SFT LP + Y KVV++FD  +NA++S    +   YCYK+ S G+P IPS+ 
Sbjct  320  FKILVDSGTSFTFLPDQVYGKVVDEFDRQVNASKSMFQGYPWQYCYKSSSHGVPKIPSLT  379

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L   A+ +FV+ NP+F I   QG   +CL + P +G  G IG+            EN KL
Sbjct  380  LKFGASNTFVVSNPVFVIYGTQGAVGFCLAIQPTDGDVGTIGRK-----------ENFKL  428

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagrapprpsaas  111
            GWS SNC++       P+ P+  G S + LPT EQQ +PNGH  A A A        +++
Sbjct  429  GWSRSNCQE------EPLNPSANGNSPNSLPTTEQQSSPNGH--AVAPAVAGRTPSKSSA  480

Query  110  PCTIHYQHCTLILILLMLQSFV  45
             C + +   + +L+L +  SF+
Sbjct  481  KCRLSFLANSFLLLLTVHISFI  502



>gb|ACG31680.1| pepsin A [Zea mays]
Length=485

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 138/220 (63%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG  +Q+ TPF+PL G    Y V V+  C+   CL+ + 
Sbjct  225  VQNSFSMCFKEDSSGRIFFGDQGVPSQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEGTS  284

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + YK    +FD+ MNATR   +   + YCY A    +P++P++ 
Sbjct  285  FKALVDSGTSFTSLPLDVYKAFTMEFDKQMNATRVPYEDTTWKYCYSASPLEMPDVPTIT  344

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +A++S    NP+ P  + QG +  +CL VLP     G+I QNF+ GY +VFD E++K
Sbjct  345  LTFAADKSLQAVNPILPFNDKQGALAGFCLAVLPSTEPIGIIAQNFLVGYHVVFDRESMK  404

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C D++D+  VP+ P+       PLP+NEQQ +P
Sbjct  405  LGWYRSECHDVEDSTTVPLGPSQRDSPEDPLPSNEQQTSP  444



>ref|XP_006647899.1| PREDICTED: aspartic proteinase-like protein 1-like [Oryza brachyantha]
Length=514

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 135/220 (61%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG   Q  TPF+PL G    Y V V+  C+   C   + 
Sbjct  254  VRNSFSMCFKKDDSGRIFFGDQGVPTQLSTPFVPLNGKLQTYAVNVDKSCIGHKCPDGAS  313

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR--SSIDVFHYCYKARSEGLPNIPSMK  471
            F A VD+G+SFT LP   YK +  +FD+ +NATR  S  +   +CY AR   +P++P++ 
Sbjct  314  FLALVDTGTSFTSLPLVAYKTITMEFDKQINATRAASGDNPLEFCYSARPLEMPDVPTIT  373

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  + N++F   NP+ P  + QG +  +CL VLP     G+IGQNF+ GY +VFD EN+K
Sbjct  374  LTFAENKTFQAINPILPFNDRQGELAVFCLAVLPSSDPVGIIGQNFLVGYHVVFDRENMK  433

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C DLD++  VP+ P+       PLP+NEQQ +P
Sbjct  434  LGWYRSECHDLDNSTTVPLGPSQHNNPEDPLPSNEQQTSP  473



>ref|XP_008460494.1| PREDICTED: aspartic proteinase-like protein 1 [Cucumis melo]
 ref|XP_008460495.1| PREDICTED: aspartic proteinase-like protein 1 [Cucumis melo]
Length=523

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 143/227 (63%), Gaps = 9/227 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V ++FSL FD + SGRI FGD GP  Q+ T FLPL G +  Y + VE +CV SSCL++SG
Sbjct  266  VRNTFSLCFDNNGSGRIIFGDDGPATQQTTQFLPLFGEFAAYFIGVESFCVGSSCLQRSG  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELM--NATRSSIDV--FHYCYKARSEGLPNIPS  477
            F+A VDSGSSFT LP E YKK+V +FD+ +  NATR  +    ++YCY   +    NIPS
Sbjct  326  FQALVDSGSSFTYLPAEVYKKIVFEFDKQVKFNATRIVLQELPWNYCYNLSTLVSFNIPS  385

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            MKL+   NQ F I +P++ +   QG K +CL +   +  YG+IGQN M GYRMVFD ENL
Sbjct  386  MKLVFPLNQIF-IHDPVYILPANQGYKVFCLTLEETDEDYGVIGQNLMVGYRMVFDRENL  444

Query  296  KLGWSASNCKDLDDNDKVPVT-PTPGGLSASPL---PTNEQQRTPNG  168
            KLGWS S C D++ +       P+  G + SP+   PTN Q   P  
Sbjct  445  KLGWSKSKCLDINSSTTEHAKPPSNNGNAKSPIALPPTNRQAIAPTA  491



>gb|ACL54367.1| unknown [Zea mays]
Length=515

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 139/220 (63%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG  +Q+ TPF+PL G    Y V V+  C+   CL+ + 
Sbjct  255  VQNSFSMCFKEDSSGRIFFGDQGVPSQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEGTS  314

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP++ YK    +FD+ MNATR   +   + YCY A    +P++P++ 
Sbjct  315  FKALVDSGTSFTSLPFDVYKAFTMEFDKQMNATRVPYEDTTWKYCYSASPLEMPDVPTIT  374

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +A++S    NP+ P  + QG +  +CL VLP     G+I QNF+ GY +VFD E++K
Sbjct  375  LTFAADKSLQAVNPILPFNDKQGALAGFCLAVLPSTEPIGIIAQNFLVGYHVVFDRESMK  434

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C+ ++D+  VP+ P+       PLP+NEQQ +P
Sbjct  435  LGWYRSECRYVEDSTTVPLGPSQHDSPEDPLPSNEQQTSP  474



>ref|NP_001141522.1| uncharacterized protein LOC100273634 precursor [Zea mays]
 gb|ACF86544.1| unknown [Zea mays]
 gb|ACN28806.1| unknown [Zea mays]
 gb|AFW64463.1| pepsin A [Zea mays]
Length=515

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 139/220 (63%), Gaps = 3/220 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG  +Q+ TPF+PL G    Y V V+  C+   CL+ + 
Sbjct  255  VQNSFSMCFKEDSSGRIFFGDQGVPSQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEGTS  314

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP++ YK    +FD+ MNATR   +   + YCY A    +P++P++ 
Sbjct  315  FKALVDSGTSFTSLPFDVYKAFTMEFDKQMNATRVPYEDTTWKYCYSASPLEMPDVPTIT  374

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +A++S    NP+ P  + QG +  +CL VLP     G+I QNF+ GY +VFD E++K
Sbjct  375  LTFAADKSLQAVNPILPFNDKQGALAGFCLAVLPSTEPIGIIAQNFLVGYHVVFDRESMK  434

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C+ ++D+  VP+ P+       PLP+NEQQ +P
Sbjct  435  LGWYRSECRYVEDSTTVPLGPSQHDSPEDPLPSNEQQTSP  474



>ref|XP_004140314.1| PREDICTED: aspartic proteinase-like protein 1 [Cucumis sativus]
 gb|KGN51015.1| hypothetical protein Csa_5G407090 [Cucumis sativus]
Length=523

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 143/227 (63%), Gaps = 9/227 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V ++FSL FD + SGRI FGD GP  Q+ T FLPL G +  Y + VE +CV SSCL++SG
Sbjct  266  VRNTFSLCFDNNGSGRILFGDDGPATQQTTQFLPLFGEFAAYFIGVESFCVGSSCLQRSG  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDEL--MNATRSSIDV--FHYCYKARSEGLPNIPS  477
            F+A VDSGSSFT LP E YKK+V +FD+   +NATR  +    ++YCY   +    NIPS
Sbjct  326  FQALVDSGSSFTYLPAEVYKKIVFEFDKQVKVNATRIVLRELPWNYCYNISTLVSFNIPS  385

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            M+L+   NQ F I +P++ +   QG K +CL +   +  YG+IGQN M GYRMVFD ENL
Sbjct  386  MQLVFPLNQIF-IHDPVYVLPANQGYKVFCLTLEETDEDYGVIGQNLMVGYRMVFDRENL  444

Query  296  KLGWSASNCKDLDDNDKVPVT-PTPGGLSASPL---PTNEQQRTPNG  168
            KLGWS S C D++ +       P+  G + SP+   PTN Q   P  
Sbjct  445  KLGWSKSKCLDINSSTTEHAKPPSNNGNAKSPIALPPTNRQAIAPTA  491



>ref|XP_006368037.1| PREDICTED: aspartic proteinase-like protein 1-like [Solanum tuberosum]
Length=408

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            VPHSFSL F +S+SG IFFGD+GP NQR + F+ L+GNYN Y+VEV+HYCV  +C KQSG
Sbjct  266  VPHSFSLCFGKSNSGTIFFGDKGPENQRRSSFVSLDGNYNTYVVEVQHYCVGGTCPKQSG  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
            F+A VDSGSSFT LP E + KVV +F++ MNATR +I+ F  CYKA S+GL NIPSMKL+
Sbjct  326  FQALVDSGSSFTFLPSEIFTKVVTEFEKQMNATRLAIEDFPCCYKASSQGLLNIPSMKLL  385

Query  464  LSANQSFVIQNPMFPILNYQ  405
            L+ANQSFVIQNPMF I + Q
Sbjct  386  LAANQSFVIQNPMFTISSGQ  405



>ref|NP_196570.1| aspartyl protease family protein [Arabidopsis thaliana]
 sp|Q9LX20.1|ASPL1_ARATH RecName: Full=Aspartic proteinase-like protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB92049.1| putative protein [Arabidopsis thaliana]
 gb|AED91491.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=528

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 148/225 (66%), Gaps = 15/225 (7%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGN-YNKYIVEVEHYCVESSCLKQSGF  642
            +SFSL FD+  SGRI+FGD GP  Q+ TPFL L+ N Y+ YIV VE  C+ +SCLKQ+ F
Sbjct  269  NSFSLCFDEEDSGRIYFGDMGPSIQQSTPFLQLDNNKYSGYIVGVEACCIGNSCLKQTSF  328

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKL  468
               +DSG SFT LP E Y+KV  + D  +NAT  + +   + YCY++ +E  P +P++KL
Sbjct  329  TTFIDSGQSFTYLPEEIYRKVALEIDRHINATSKNFEGVSWEYCYESSAE--PKVPAIKL  386

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPI--EGIYGLIGQNFMTGYRMVFDWENLK  294
              S N +FVI  P+F     QG+  +CL + P   EGI G IGQN+M GYRMVFD EN+K
Sbjct  387  KFSHNNTFVIHKPLFVFQQSQGLVQFCLPISPSGQEGI-GSIGQNYMRGYRMVFDRENMK  445

Query  293  LGWSASNCKDLDDNDKV-PVTPTPGGLSA-SPLPTNEQQRTPNGH  165
            LGWS S C++    DK+ P   +PG  S+ +PLPT+EQQ +  GH
Sbjct  446  LGWSPSKCQE----DKIEPPQASPGSTSSPNPLPTDEQQ-SRGGH  485



>ref|XP_006399498.1| hypothetical protein EUTSA_v10013235mg [Eutrema salsugineum]
 gb|ESQ40951.1| hypothetical protein EUTSA_v10013235mg [Eutrema salsugineum]
Length=528

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 140/221 (63%), Gaps = 19/221 (9%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGRI+FGD GP  Q+ T FLPL   Y  YIV VE  C+ +SCLKQ+ FR
Sbjct  269  NSFSMCFDEEDSGRIYFGDMGPSMQQSTKFLPLNNEYVAYIVGVEACCIGNSCLKQTSFR  328

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNAT--RSSIDVFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y++V  + D  +NAT  R     + YCY+   E  PN+P++KL 
Sbjct  329  TLIDSGQSFTFLPEEIYREVALEIDSHINATIKRVKDGPWDYCYETSVE--PNVPAIKLK  386

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPI-----EGIYGLIGQNFMTGYRMVFDWEN  300
             S N +FVI  P+F +   +GV  +C   LPI     EGI G IGQN+M GYRMVFD EN
Sbjct  387  FSYNNTFVIHKPLFGLEQSEGVVQFC---LPINSSGQEGI-GSIGQNYMRGYRMVFDREN  442

Query  299  LKLGWSASNCKDLDDNDKV-PVTPTPGGLSAS-PLPTNEQQ  183
            +KLGWSAS C++    DK+ P   +P   S+  PLPT EQQ
Sbjct  443  MKLGWSASKCQE----DKIAPPQASPESTSSPYPLPTEEQQ  479



>gb|EMT00913.1| Aspartic proteinase-like protein 1 [Aegilops tauschii]
Length=478

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 136/221 (62%), Gaps = 4/221 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F + +SGRIFFGDQG   Q+ TPF+PL G +  Y V V+  CV   C + + 
Sbjct  217  VRNSFSMCFKE-YSGRIFFGDQGVSTQQSTPFVPLYGKFQTYAVNVDKSCVGHKCFEGTN  275

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR--SSIDVFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP   YK V  +FD  +NA+R     D F YCY A    +P++P++ 
Sbjct  276  FEAIVDSGTSFTALPLNVYKAVTVEFDRQVNASRITQEDDSFEYCYSASPLEMPDVPTVT  335

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +AN+SF + NP     + +G +  +CL V       G+IGQNF+TGY +VFD EN+K
Sbjct  336  LNFAANKSFQVVNPTIVRKDGEGSIAGFCLAVQKSPEAIGIIGQNFLTGYHIVFDKENMK  395

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            LGW  S C DLD++  VP+ P+       PLP++EQQ +P 
Sbjct  396  LGWYRSECHDLDNSTTVPLGPSQHHSPGDPLPSSEQQTSPT  436



>ref|XP_009122092.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Brassica 
rapa]
Length=517

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 138/216 (64%), Gaps = 8/216 (4%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGRI+FGD GP  Q+ T FLP +  +  Y V VE  CV +SCLKQS F 
Sbjct  261  NSFSMCFDEEDSGRIYFGDVGPSTQQSTRFLPYKNEFVAYFVGVEVCCVGNSCLKQSSFT  320

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y++V  + D  +NAT   I+   + YCY+   E  P +P++KL 
Sbjct  321  TLIDSGQSFTFLPEEIYREVALEIDSHINATVKKIEGGPWEYCYETSFE--PKVPAIKLK  378

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGV-LPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             S+N +FVI  P+F +   +G+  +CL +    EG  G+IGQN+M GYR+VFD EN+KLG
Sbjct  379  FSSNNTFVIHKPLFVLQRSEGLVQFCLPISASEEGTGGVIGQNYMAGYRIVFDRENMKLG  438

Query  287  WSASNCKDLDDNDKVPVTPTPGGLSA-SPLPTNEQQ  183
            WSAS C+  +D    P   +PG  S+ +PLPT EQQ
Sbjct  439  WSASKCQ--EDKIAPPQEASPGSTSSPNPLPTEEQQ  472



>emb|CDX69862.1| BnaA10g22110D [Brassica napus]
Length=517

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 138/216 (64%), Gaps = 8/216 (4%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGRI+FGD GP  Q+ T FLP +  +  Y V VE  CV +SCLKQS F 
Sbjct  261  NSFSMCFDEEDSGRIYFGDVGPSTQQSTRFLPYKNEFVAYFVGVEVCCVGNSCLKQSSFT  320

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y++V  + D  +NAT   I+   + YCY+   E  P +P++KL 
Sbjct  321  TLIDSGQSFTFLPEEIYREVALEIDSHINATVKKIEGGPWEYCYETSFE--PKVPAIKLK  378

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGV-LPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             S+N +FVI  P+F +   +G+  +CL +    EG  G+IGQN+M GYR+VFD EN+KLG
Sbjct  379  FSSNNTFVIHKPLFVLQRSEGLVQFCLPISASEEGTGGVIGQNYMAGYRIVFDRENMKLG  438

Query  287  WSASNCKDLDDNDKVPVTPTPGGLSA-SPLPTNEQQ  183
            WSAS C+  +D    P   +PG  S+ +PLPT EQQ
Sbjct  439  WSASKCQ--EDKIAPPQEASPGSTSSPNPLPTEEQQ  472



>gb|AFK40902.1| unknown [Lotus japonicus]
Length=207

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 136/207 (66%), Gaps = 8/207 (4%)
 Frame = -2

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPS  477
            + F+AQVDSG+SFT LP   Y  +  +FD+ +NA+RSS +   + YCY + SE LP +PS
Sbjct  2    TSFKAQVDSGTSFTFLPGHAYGAITEEFDKQVNASRSSFEGSPWEYCYPSSSEQLPKVPS  61

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L+   N SFV+ NP+F   + QGV  +CL + P EG  G IGQNFMTGYR+VFD EN 
Sbjct  62   LTLMFQQNNSFVVYNPVFTFYDNQGVVGFCLAIQPTEGDMGTIGQNFMTGYRLVFDRENK  121

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagra----pp  129
             L WS SNC+DL    ++P++P P   S++PLPT+EQQRT NGHAVAPA+AGRA      
Sbjct  122  NLAWSPSNCQDLSLGKRMPLSP-PNKTSSAPLPTDEQQRT-NGHAVAPAIAGRASPKPSA  179

Query  128  rpsaasPCTIHYQHCTLILILLMLQSF  48
             PS    C +HY H    L+  +L +F
Sbjct  180  APSRIISCQVHYWHSYWFLLFQLLSAF  206



>ref|XP_010491661.1| PREDICTED: aspartic proteinase-like protein 1 [Camelina sativa]
Length=526

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 140/220 (64%), Gaps = 20/220 (9%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFSL FD+  SGRI+FGD GP  Q+ T FLP++   NKYIV VE  CV +SCLKQ+ FR
Sbjct  268  NSFSLCFDEEDSGRIYFGDMGPSVQQSTQFLPVD---NKYIVGVETCCVGNSCLKQTSFR  324

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y+KV  + D  +NAT  S +   + YCY++  E  P +P++KL 
Sbjct  325  TYIDSGQSFTYLPEEIYRKVAVEMDRHINATMKSFEDVSWEYCYESSVE--PKVPAIKLR  382

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPI-----EGIYGLIGQNFMTGYRMVFDWEN  300
             S N +FVI  P+F     QG+  +C   LPI     EGI   IGQN+M G RMVFD EN
Sbjct  383  FSHNNTFVIHKPLFVFQQSQGLVQFC---LPISSSGEEGIRS-IGQNYMRGNRMVFDREN  438

Query  299  LKLGWSASNCKDLDDNDKVPVTPTPGGLSAS-PLPTNEQQ  183
            +KLGWSAS C+   +N+  P   +PG  SA  PLPT EQQ
Sbjct  439  MKLGWSASKCQ---ENEIEPPQVSPGSTSAPYPLPTEEQQ  475



>ref|XP_010530170.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=516

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 142/215 (66%), Gaps = 9/215 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ +D+  SGR  FGDQGP +Q++TP L  +G Y  YIV VE  CV ++C+KQSG
Sbjct  262  IRNSFSICYDEDDSGRFLFGDQGPQSQQYTPLLTKDGKYEAYIVRVESCCVGTTCIKQSG  321

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID-VFHYCYKARSEGLPNIPSMKL  468
            +RA VD+GSSFT LP + + KVV + D+ ++  R+    +F  CY+A S+ L   P+++L
Sbjct  322  YRANVDTGSSFTSLPKDVHDKVVAELDKRLDIKRTGQQGIFDNCYRASSKDLAKFPTIRL  381

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
            + + NQSF + +  + I +  G+   CL ++P +  YG+IGQN M G+ MVFD ENL+LG
Sbjct  382  MFTNNQSFSVGD--YTISSGTGI--VCLTMMPWDRDYGVIGQNSMIGHLMVFDRENLRLG  437

Query  287  WSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQ  183
            WS S+C+D      V ++P+    S SPLP +++Q
Sbjct  438  WSRSDCQDPSRRAGVSISPS----SQSPLPASKRQ  468



>gb|ACK44517.1| AT5G10080-like protein [Arabidopsis arenosa]
Length=506

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 143/224 (64%), Gaps = 16/224 (7%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFSL FD+  SGRI+FGD GP  Q+ TPFL LE N + YIV VE  C+ +SCLKQ+ F 
Sbjct  269  NSFSLCFDEEDSGRIYFGDMGPSIQQSTPFLQLENN-SGYIVGVEACCIGNSCLKQTSFT  327

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y+KV  + D  +NAT  S +   + YCY++  E  P +P++KL 
Sbjct  328  TFIDSGQSFTYLPEEIYRKVALEIDRHINATSKSFEGVSWEYCYESSVE--PKVPAIKLK  385

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPI--EGIYGLIGQNFMTGYRMVFDWENLKL  291
             S N +FVI  P+F     QG+  +CL + P   EGI G IGQN+M GYRMVFD EN+KL
Sbjct  386  FSHNNTFVIHKPLFVFQQSQGLVQFCLPISPSGQEGI-GSIGQNYMRGYRMVFDRENMKL  444

Query  290  GWSASNCKDLDDNDKV-PVTPTPGGLSAS-PLPTNEQQRTPNGH  165
             WSAS C++    +K+ P   +PG  S+  PLPT EQQ    GH
Sbjct  445  RWSASKCQE----EKIEPPQASPGSTSSPYPLPTEEQQS--RGH  482



>gb|AAZ67590.1| 80A08_5 [Brassica rapa subsp. pekinensis]
Length=632

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 138/216 (64%), Gaps = 8/216 (4%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGRI+FGD GP  Q+ T FLP +  +  Y V VE  CV +SCLKQS F 
Sbjct  261  NSFSMCFDEEDSGRIYFGDVGPSTQQSTRFLPYKNEFVAYFVGVEVCCVGNSCLKQSSFT  320

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y++V  + D  +NAT   I+   + YCY+   E  P +P++KL 
Sbjct  321  TLIDSGQSFTFLPEEIYREVALEIDSHINATVKKIEGGPWEYCYETSFE--PKVPAIKLK  378

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGV-LPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             S+N +FVI  P+F +   +G+  +CL +    EG  G+IGQN+M GYR+VFD EN+KLG
Sbjct  379  FSSNNTFVIHKPLFVLQRSEGLVQFCLPISASEEGTGGVIGQNYMAGYRIVFDRENMKLG  438

Query  287  WSASNCKDLDDNDKVPVTPTPGGLSA-SPLPTNEQQ  183
            WSAS C+  +D    P   +PG  S+ +PLPT EQQ
Sbjct  439  WSASKCQ--EDKIAPPQEASPGSTSSPNPLPTEEQQ  472



>ref|XP_010422895.1| PREDICTED: aspartic proteinase-like protein 1 [Camelina sativa]
Length=527

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 138/217 (64%), Gaps = 14/217 (6%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFSL FD+  SGRI+FGD GP  Q+ T FLP +   NKYIV VE  C+ +SCLKQ+ FR
Sbjct  268  NSFSLCFDEEDSGRIYFGDMGPSVQQSTQFLPAD---NKYIVGVETCCIGNSCLKQTNFR  324

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y+KV  + D  +NAT  S +   + YCY++  E  P +P++KL 
Sbjct  325  TYIDSGQSFTYLPEEIYRKVALEMDRHINATMKSFEDVSWEYCYESSVE--PKVPAIKLR  382

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPI--EGIYGLIGQNFMTGYRMVFDWENLKL  291
             S N +FVI  P+F     QG+  +CL +     EGI G IGQN+M G RMVFD EN+KL
Sbjct  383  FSHNNTFVIHKPLFVFQQSQGLVQFCLPISSSGEEGI-GSIGQNYMRGNRMVFDRENMKL  441

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSAS-PLPTNEQQ  183
            GWS S C+   +N+  P   +PG  SA  PLPT EQQ
Sbjct  442  GWSPSKCQ---ENEIEPPQASPGSTSAPYPLPTEEQQ  475



>ref|XP_002871403.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47662.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=529

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 140/223 (63%), Gaps = 14/223 (6%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFSL FD+  SGRI+FGD GP  Q+  PFL LE N + YIV VE  C+ +SCLKQ+ F 
Sbjct  269  NSFSLCFDEEDSGRIYFGDMGPSIQQSAPFLQLENN-SGYIVGVEACCIGNSCLKQTSFT  327

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y+KV  + D  +NAT  S +   + YCY++  E  P +P++KL 
Sbjct  328  TFIDSGQSFTYLPEEIYRKVALEIDRHINATSKSFEGVSWEYCYESSVE--PKVPAIKLK  385

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPI--EGIYGLIGQNFMTGYRMVFDWENLKL  291
             S N +FVI  P+F     QG+  +CL + P   EGI G IGQN+M GYRMVFD EN+KL
Sbjct  386  FSHNNTFVIHKPLFVFQQSQGLVQFCLPISPSEQEGI-GSIGQNYMRGYRMVFDRENMKL  444

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSAS-PLPTNEQQRTPNGH  165
            GWS S C+   ++   P   +PG  S+  PLPT EQQ    GH
Sbjct  445  GWSPSKCQ---EDKTEPPQASPGSTSSPYPLPTEEQQS--RGH  482



>ref|XP_010236110.1| PREDICTED: aspartic proteinase-like protein 1 [Brachypodium distachyon]
Length=516

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 135/220 (61%), Gaps = 4/220 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG   Q+ TPF+PL G    Y V V+  CV   C + + 
Sbjct  256  VRNSFSMCFTKD-SGRIFFGDQGVSTQQSTPFVPLYGKLQTYTVNVDKSCVGHKCFESTS  314

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR--SSIDVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP + YK V  +FD+ +NA+R       F YCY A    +P++P++ 
Sbjct  315  FQAIVDSGTSFTALPLDIYKAVAIEFDKQVNASRLPQEATSFDYCYSASPLVMPDVPTVT  374

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  + N+SF   NP F + + +G V  +CL V+      G+I QNF+ GY +VFD EN+K
Sbjct  375  LTFAGNKSFQPVNPTFLLHDEEGAVAGFCLAVVQSPEPIGIIAQNFLLGYHVVFDRENMK  434

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTP  174
            LGW  S C DLD++  VP+ P+       PLP+NEQQ +P
Sbjct  435  LGWYRSECHDLDNSTTVPLGPSQHNSPEDPLPSNEQQTSP  474



>gb|EMS50313.1| Aspartic proteinase-like protein 1 [Triticum urartu]
Length=445

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 138/229 (60%), Gaps = 12/229 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F + +SGRIFFGDQG   Q+ TPF+PL G +  Y V V+  CV   C + + 
Sbjct  176  VRNSFSMCFKE-YSGRIFFGDQGVSTQQSTPFVPLYGKFQTYAVNVDKSCVGHKCFEGTN  234

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR--SSIDVFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP   YK V  +FD+ +NA+R     D F YCY A    +P++P++ 
Sbjct  235  FEAIVDSGTSFTALPLNVYKAVTVEFDKQVNASRITQEDDSFEYCYSASPLEMPDVPTVT  294

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIG--------QNFMTGYRM  318
            L LSAN+SF + NP     N +G +  +CL V       G+IG        +NF+TGY +
Sbjct  295  LNLSANKSFQVVNPTIVRKNGEGSIAGFCLAVQKSPEPIGIIGPYLVSVDAENFLTGYHI  354

Query  317  VFDWENLKLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            VFD EN+KLGW  S C DLD++  VP+ P+       PLP++EQQ +P 
Sbjct  355  VFDKENMKLGWYRSECHDLDNSTTVPLGPSQHHSPGDPLPSSEQQTSPT  403



>ref|XP_010453028.1| PREDICTED: aspartic proteinase-like protein 1 [Camelina sativa]
Length=526

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 137/217 (63%), Gaps = 14/217 (6%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFSL FD+  SGRI+FGD GP  Q+ T FLP +   NKYIV VE  C+ +SCLKQ+ FR
Sbjct  268  NSFSLCFDEEDSGRIYFGDIGPSMQQSTQFLPAD---NKYIVGVETCCIGNSCLKQTSFR  324

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y+KV  + D  +NAT  S +   + YCY++  E  P +P++KL 
Sbjct  325  TYIDSGQSFTYLPEEIYRKVAVEMDRHINATMKSFEDVSWEYCYESSVE--PKVPAIKLR  382

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPI--EGIYGLIGQNFMTGYRMVFDWENLKL  291
             S N +FVI  P+F     Q +  +CL +     EGI G IGQN+M G RMVFD EN+KL
Sbjct  383  FSHNNTFVIHKPLFVFQQSQELVQFCLPISSSGEEGI-GSIGQNYMRGNRMVFDRENMKL  441

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSAS-PLPTNEQQ  183
            GWSAS C+    N+  P   +PG  SA  PLPT EQQ
Sbjct  442  GWSASKCQ---GNEIEPPQASPGSTSAPYPLPTEEQQ  475



>emb|CDY21629.1| BnaC09g46630D [Brassica napus]
Length=518

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGRI+FGD GP  Q+ T FLP   ++  Y V VE  CV +SCLKQ+ F 
Sbjct  262  NSFSMCFDEEDSGRIYFGDMGPSTQQSTRFLPYNNDFVAYFVGVEACCVGNSCLKQTNFT  321

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP   Y++V  + D  +NAT    +   + YCY+   E  P +P++KL 
Sbjct  322  TLIDSGQSFTFLPEVIYREVAVEIDSHINATVKKFEGAPWEYCYETSFE--PKVPAIKLK  379

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGV-LPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             S+N +FVI  P+F +   +G+  +CL +    EG  G+IGQN+M GYR+VF+ EN+KLG
Sbjct  380  FSSNNTFVIHKPLFVLQRSEGLVQFCLPISASEEGTGGVIGQNYMAGYRIVFNRENMKLG  439

Query  287  WSASNCKDLDDNDKVPVTPTPGGLSAS-PLPTNEQQ  183
            WSAS C+  +D    P   +PG  S+  PLPT EQQ
Sbjct  440  WSASKCQ--EDKIAPPQEASPGSTSSPIPLPTEEQQ  473



>dbj|BAK05106.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 135/221 (61%), Gaps = 4/221 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG   Q+ TPF+PL G Y  Y V V+  CV   C + + 
Sbjct  302  VRNSFSMCFKED-SGRIFFGDQGVSIQQSTPFVPLYGKYQTYAVNVDKSCVGHKCFEATS  360

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP   YK V  +FD+ ++A R + +   F YCY A    +P++P++ 
Sbjct  361  FEALVDSGTSFTALPLNVYKAVAVEFDKQVHAPRITQEDASFEYCYSASPLKMPDVPTVT  420

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +AN+SF   NP   + + +G V  +CL +       G+IGQNF+TGY +VFD EN+K
Sbjct  421  LTFAANKSFQAVNPTIVLKDGEGSVAGFCLALQKSPEPIGIIGQNFLTGYHIVFDKENMK  480

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            LGW  S C D D++  VP+ P+       PLP++EQQ +P 
Sbjct  481  LGWYRSECHDPDNSTTVPLGPSQHNSPGVPLPSSEQQTSPT  521



>ref|XP_008676833.1| PREDICTED: uncharacterized protein LOC100273634 isoform X1 [Zea 
mays]
Length=626

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 95/246 (39%), Positives = 139/246 (57%), Gaps = 29/246 (12%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG  +Q+ TPF+PL G    Y V V+  C+   CL+ + 
Sbjct  340  VQNSFSMCFKEDSSGRIFFGDQGVPSQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEGTS  399

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP++ YK    +FD+ MNATR   +   + YCY A    +P++P++ 
Sbjct  400  FKALVDSGTSFTSLPFDVYKAFTMEFDKQMNATRVPYEDTTWKYCYSASPLEMPDVPTIT  459

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLI------------------  348
            L  +A++S    NP+ P  + QG +  +CL VLP     G+I                  
Sbjct  460  LTFAADKSLQAVNPILPFNDKQGALAGFCLAVLPSTEPIGIIARKSPNVTTRFVLLVFSV  519

Query  347  --------GQNFMTGYRMVFDWENLKLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTN  192
                     +NF+ GY +VFD E++KLGW  S C+ ++D+  VP+ P+       PLP+N
Sbjct  520  HTYCKFPNAENFLVGYHVVFDRESMKLGWYRSECRYVEDSTTVPLGPSQHDSPEDPLPSN  579

Query  191  EQQRTP  174
            EQQ +P
Sbjct  580  EQQTSP  585



>ref|XP_006827007.1| PREDICTED: aspartic proteinase-like protein 1 [Amborella trichopoda]
 gb|ERM94244.1| hypothetical protein AMTR_s00010p00215300 [Amborella trichopoda]
Length=533

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 134/223 (60%), Gaps = 15/223 (7%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFSL F++  SGRIFFGDQG  NQ+ TPFLPLEG Y  YIV V   C+ + CL+Q+G
Sbjct  270  VRNSFSLCFEEDDSGRIFFGDQGIPNQQTTPFLPLEGKYETYIVGVGGICIGTVCLEQTG  329

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRS--SIDVFHYCYKARSEGLPNIPSMK  471
            F + VD+G SFT  P + YK V  +FD  +NA+R      +F YCYK R    P IP+  
Sbjct  330  FTSLVDTGFSFTFFPDDVYKTVTTEFDRQINASRHLYKESIFEYCYKVRGSQHPEIPTFT  389

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIE----GIYGLIGQNFMTGYRMVFDW  306
            L  S+N SFV+ +P+F      G ++  CL +   E     + G IG NFM GYR+VFD 
Sbjct  390  LTFSSNSSFVVSSPIFEFRGEDGELEGICLALQSEEENSANVLGTIGHNFMMGYRLVFDR  449

Query  305  ENLKLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRT  177
             NL+LGWS S C  +   +        GG+  +PLPTN+QQ +
Sbjct  450  GNLRLGWSPSTCDKMSKEN--------GGVPENPLPTNQQQSS  484



>emb|CDY21633.1| BnaC09g46590D [Brassica napus]
Length=408

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 122/188 (65%), Gaps = 5/188 (3%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGRI+FGD GP  Q+ T FLP   ++  YIV VE  C+ +SCLKQ+ F 
Sbjct  170  NSFSMCFDEEDSGRIYFGDMGPSTQQSTRFLPYNNDFVAYIVGVEACCIGNSCLKQTNFT  229

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP   Y++V  + D  +NAT   ID   + YCY+   +  P +P++KL 
Sbjct  230  TLIDSGQSFTFLPEVIYREVALEIDSHINATVKKIDGGPWEYCYETSVK--PKVPAIKLK  287

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPI-EGIYGLIGQNFMTGYRMVFDWENLKLG  288
             S+N SF+I  P+F +   QG+   CL +    EG  G+IGQN+M GYR+VFD EN+KLG
Sbjct  288  FSSNNSFLIHKPLFVLQRSQGLVQCCLPISATEEGTGGVIGQNYMRGYRIVFDRENMKLG  347

Query  287  WSASNCKD  264
            WS+S C++
Sbjct  348  WSSSKCQE  355



>gb|KFK25303.1| hypothetical protein AALP_AA8G094900 [Arabis alpina]
Length=530

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 122/189 (65%), Gaps = 7/189 (4%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGRI+FGD GP  Q+ T FLPL+  Y  YIV VE  C+ +SCLKQS F+
Sbjct  270  NSFSMCFDEEDSGRIYFGDMGPSIQQSTQFLPLDNKYVTYIVGVEACCIGNSCLKQSSFK  329

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV--FHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT L  E Y+K+  + D  +N T   ++   + YCY+A  E  P +P++KL 
Sbjct  330  TLIDSGQSFTFLSEEIYRKIALEIDRYINTTSKRVEGGPWDYCYEASVE--PKVPAIKLK  387

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPI--EGIYGLIGQNFMTGYRMVFDWENLKL  291
             S N +FVI  P+F +   QG+  +CL +     E I G IGQN+M GY+MVFD EN+KL
Sbjct  388  FSHNNTFVIHKPLFVLQQTQGLVQFCLPISSSGQESI-GSIGQNYMRGYQMVFDRENMKL  446

Query  290  GWSASNCKD  264
            GWS S C++
Sbjct  447  GWSTSKCQE  455



>gb|AFW64462.1| hypothetical protein ZEAMMB73_591827, partial [Zea mays]
Length=469

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 120/189 (63%), Gaps = 3/189 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V +SFS+ F +  SGRIFFGDQG  +Q+ TPF+PL G    Y V V+  C+   CL+ + 
Sbjct  255  VQNSFSMCFKEDSSGRIFFGDQGVPSQQSTPFVPLYGKLQTYAVNVDKSCIGHKCLEGTS  314

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP++ YK    +FD+ MNATR   +   + YCY A    +P++P++ 
Sbjct  315  FKALVDSGTSFTSLPFDVYKAFTMEFDKQMNATRVPYEDTTWKYCYSASPLEMPDVPTIT  374

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L  +A++S    NP+ P  + QG +  +CL VLP     G+I QNF+ GY +VFD E++K
Sbjct  375  LTFAADKSLQAVNPILPFNDKQGALAGFCLAVLPSTEPIGIIAQNFLVGYHVVFDRESMK  434

Query  293  LGWSASNCK  267
            LGW  S CK
Sbjct  435  LGWYRSECK  443



>gb|KEH28058.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=384

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 130/222 (59%), Gaps = 7/222 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRF-TPFLPLEGNYNKYIVEVEHYCVESSCLKQS  648
            + +S S+  ++  SGRI FGDQG   QR  TPFL  +G    Y V VE +CV S C K++
Sbjct  124  IRNSISICLNEKGSGRILFGDQGHATQRRSTPFLLDDGELLNYFVGVERFCVGSFCYKET  183

Query  647  GFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPS  477
             F+A +D+G+SFT LP   Y+ VV +F++ ++ATR +  +   F+ CY A S    N P 
Sbjct  184  EFKAFIDTGTSFTYLPKGVYETVVAEFEKQVHATRITSQIQSDFNCCYNASSRESNNFPP  243

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            MK   S NQSF+IQNP   +   Q     CL V+  +     IGQNF+ GY MVFD ENL
Sbjct  244  MKFTFSKNQSFIIQNPFISM--DQEDTTICLAVVQSDDELITIGQNFLMGYDMVFDRENL  301

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            + GW  SNC+D         +P+ GG S   +P+N+QQR PN
Sbjct  302  RFGWFRSNCQDSMGESANFTSPSIGG-SPDSIPSNQQQRVPN  342



>gb|KHN44321.1| Aspartic proteinase-like protein 1 [Glycine soja]
Length=206

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = -2

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPS  477
            + F+AQVDSG+SFT LP   Y  +  +FD+ +N +RSS +   + YCY   S+ LP +PS
Sbjct  2    TSFKAQVDSGTSFTFLPGHVYGAITEEFDQQVNGSRSSFEGSPWEYCYVPSSQDLPKVPS  61

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
              L+   N SFV+ +P+F     +GV  +CL +LP EG  G IGQNFMTGYR+VFD  N 
Sbjct  62   FTLMFQHNNSFVVYDPVFVFYGNEGVIGFCLAILPTEGDMGTIGQNFMTGYRLVFDRGNK  121

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPNGH  165
            KL WS SNC+DL    ++P++P     S++PLPT+EQQRT NGH
Sbjct  122  KLAWSRSNCQDLSLGKRMPLSPNE--TSSNPLPTDEQQRT-NGH  162



>ref|XP_009122093.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Brassica 
rapa]
Length=442

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 118/182 (65%), Gaps = 5/182 (3%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ FD+  SGRI+FGD GP  Q+ T FLP +  +  Y V VE  CV +SCLKQS F 
Sbjct  261  NSFSMCFDEEDSGRIYFGDVGPSTQQSTRFLPYKNEFVAYFVGVEVCCVGNSCLKQSSFT  320

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLI  465
              +DSG SFT LP E Y++V  + D  +NAT   I+   + YCY+   E  P +P++KL 
Sbjct  321  TLIDSGQSFTFLPEEIYREVALEIDSHINATVKKIEGGPWEYCYETSFE--PKVPAIKLK  378

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGV-LPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             S+N +FVI  P+F +   +G+  +CL +    EG  G+IGQN+M GYR+VFD EN+KLG
Sbjct  379  FSSNNTFVIHKPLFVLQRSEGLVQFCLPISASEEGTGGVIGQNYMAGYRIVFDRENMKLG  438

Query  287  WS  282
            WS
Sbjct  439  WS  440



>gb|AES97910.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=523

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 130/222 (59%), Gaps = 7/222 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRF-TPFLPLEGNYNKYIVEVEHYCVESSCLKQS  648
            + +S S+  ++  SGRI FGDQG   QR  TPFL  +G    Y V VE +CV S C K++
Sbjct  263  IRNSISICLNEKGSGRILFGDQGHATQRRSTPFLLDDGELLNYFVGVERFCVGSFCYKET  322

Query  647  GFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPS  477
             F+A +D+G+SFT LP   Y+ VV +F++ ++ATR +  +   F+ CY A S    N P 
Sbjct  323  EFKAFIDTGTSFTYLPKGVYETVVAEFEKQVHATRITSQIQSDFNCCYNASSRESNNFPP  382

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            MK   S NQSF+IQNP   +   Q     CL V+  +     IGQNF+ GY MVFD ENL
Sbjct  383  MKFTFSKNQSFIIQNPFISM--DQEDTTICLAVVQSDDELITIGQNFLMGYDMVFDRENL  440

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            + GW  SNC+D         +P+ GG S   +P+N+QQR PN
Sbjct  441  RFGWFRSNCQDSMGESANFTSPSIGG-SPDSIPSNQQQRVPN  481



>ref|XP_003614952.1| Aspartic proteinase-like protein [Medicago truncatula]
Length=530

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 129/227 (57%), Gaps = 10/227 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRF-TPFLPLEGNYNKYIVEVEHYCVESSCLKQS  648
            + +S S+  ++  SGRI FGDQG   QR  TPFL  +G    Y V VE +CV S C K++
Sbjct  263  IRNSISICLNEKGSGRILFGDQGHATQRRSTPFLLDDGELLNYFVGVERFCVGSFCYKET  322

Query  647  GFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPS  477
             F+A +D+G+SFT LP   Y+ VV +F++ ++ATR +  +   F+ CY A S    N P 
Sbjct  323  EFKAFIDTGTSFTYLPKGVYETVVAEFEKQVHATRITSQIQSDFNCCYNASSRESNNFPP  382

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCL-----GVLPIEGIYGLIGQNFMTGYRMVF  312
            MK   S NQSF+IQNP   +       C  +      ++ I   Y +  QNF+ GY MVF
Sbjct  383  MKFTFSKNQSFIIQNPFISMDQEDTTICLAVVQSDDELITIGRKYTIACQNFLMGYDMVF  442

Query  311  DWENLKLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRTPN  171
            D ENL+ GW  SNC+D         +P+ GG S   +P+N+QQR PN
Sbjct  443  DRENLRFGWFRSNCQDSMGESANFTSPSIGG-SPDSIPSNQQQRVPN  488



>ref|XP_006434047.1| hypothetical protein CICLE_v10000815mg [Citrus clementina]
 gb|ESR47287.1| hypothetical protein CICLE_v10000815mg [Citrus clementina]
Length=322

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 98/136 (72%), Gaps = 2/136 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD++ SG +FFGDQGP  Q+ T FLP+   Y+ Y V VE YC+ +SCL QSG
Sbjct  157  IQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPIGEKYDAYFVGVESYCIGNSCLTQSG  216

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP E Y +VV KFD+L+++ R S+  + + YCY A SE +  +P M+
Sbjct  217  FQALVDSGASFTFLPTEIYAEVVMKFDKLVSSRRISLQGNSWKYCYNASSEEMLKVPDMR  276

Query  470  LILSANQSFVIQNPMF  423
            LI S NQSFV++N +F
Sbjct  277  LIFSKNQSFVVRNHIF  292



>gb|KDO80879.1| hypothetical protein CISIN_1g0092712mg [Citrus sinensis]
Length=438

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 98/136 (72%), Gaps = 2/136 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD++ SG +FFGDQGP  Q+ T FLP+   Y+ Y V VE YC+ +SCL QSG
Sbjct  273  IQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPIGEKYDAYFVGVESYCIGNSCLTQSG  332

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKARSEGLPNIPSMK  471
            F+A VDSG+SFT LP E Y +VV KFD+L+++ R S+  + + YCY A SE +  +P M+
Sbjct  333  FQALVDSGASFTFLPTEIYAEVVVKFDKLVSSKRISLQGNSWKYCYNASSEEMLKVPDMR  392

Query  470  LILSANQSFVIQNPMF  423
            LI S NQSFV++N +F
Sbjct  393  LIFSKNQSFVVRNHIF  408



>gb|KDO43756.1| hypothetical protein CISIN_1g0095931mg, partial [Citrus sinensis]
Length=264

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 95/142 (67%), Gaps = 2/142 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ T FL   G Y  YI+ VE  C+ SSCLKQ+ 
Sbjct  119  IRNSFSMCFDKDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTS  178

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHY--CYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP E Y+ +  +FD  +N T +S + + +  CYK+ S+ LP +PS+K
Sbjct  179  FKAIVDSGSSFTFLPKEVYETIAAEFDRQVNDTITSFEGYPWKCCYKSSSQRLPKLPSVK  238

Query  470  LILSANQSFVIQNPMFPILNYQ  405
            L+   N SFV+ NP+F I   Q
Sbjct  239  LMFPQNNSFVVNNPVFVIYGTQ  260



>ref|XP_006428132.1| hypothetical protein CICLE_v10025730mg [Citrus clementina]
 gb|ESR41372.1| hypothetical protein CICLE_v10025730mg [Citrus clementina]
Length=388

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ T FL   G Y  YI+ VE  C+ SSCLKQ+ 
Sbjct  243  IRNSFSMCFDEDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTI  302

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP + Y+ +  +FD  +N T +S + +   YCYK+ S+ LP +PS+K
Sbjct  303  FKAIVDSGSSFTFLPKDIYETIAAEFDRQVNDTITSFEGYPWKYCYKSSSQRLPKLPSVK  362

Query  470  LILSANQSFVIQNPMFPI  417
            L+   N SFV  NP+F I
Sbjct  363  LMFPQNNSFVANNPVFVI  380



>ref|XP_006428131.1| hypothetical protein CICLE_v10025730mg [Citrus clementina]
 gb|ESR41371.1| hypothetical protein CICLE_v10025730mg [Citrus clementina]
Length=411

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD+  SGRIFFGDQGP  Q+ T FL   G Y  YI+ VE  C+ SSCLKQ+ 
Sbjct  266  IRNSFSMCFDEDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTI  325

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVF--HYCYKARSEGLPNIPSMK  471
            F+A VDSGSSFT LP + Y+ +  +FD  +N T +S + +   YCYK+ S+ LP +PS+K
Sbjct  326  FKAIVDSGSSFTFLPKDIYETIAAEFDRQVNDTITSFEGYPWKYCYKSSSQRLPKLPSVK  385

Query  470  LILSANQSFVIQNPMFPI  417
            L+   N SFV  NP+F I
Sbjct  386  LMFPQNNSFVANNPVFVI  403



>ref|XP_007018872.1| Eukaryotic aspartyl protease family protein isoform 3 [Theobroma 
cacao]
 gb|EOY16097.1| Eukaryotic aspartyl protease family protein isoform 3 [Theobroma 
cacao]
Length=426

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 99/149 (66%), Gaps = 5/149 (3%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+  D++ SGRI+FGD+G   Q+ TPFLP+ G Y KY V VEH CV SSCL++SG
Sbjct  267  IQNSFSICLDENGSGRIYFGDKGLATQQSTPFLPIGGKYEKYFVRVEHLCVGSSCLEKSG  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSS--IDVFHYCYKARSEGLPNIPSMK  471
            F A VDSG+SFT LP E Y KVV +FD+ +NA R S   D + YCY   S+    IPSM+
Sbjct  327  FSALVDSGTSFTYLPPEIYDKVVLEFDKQVNARRISNQEDFWKYCYNVSSQEPFKIPSMR  386

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCL  384
            L  + NQSF I N ++   +Y G++   L
Sbjct  387  LKFAINQSFEIHNHIY---SYTGIEVILL  412



>ref|XP_010530171.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=418

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ +D+  SGR  FGDQGP +Q++TP L  +G Y  YIV VE  CV ++C+KQSG
Sbjct  262  IRNSFSICYDEDDSGRFLFGDQGPQSQQYTPLLTKDGKYEAYIVRVESCCVGTTCIKQSG  321

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSID-VFHYCYKARSEGLPNIPSMKL  468
            +RA VD+GSSFT LP + + KVV + D+ ++  R+    +F  CY+A S+ L   P+++L
Sbjct  322  YRANVDTGSSFTSLPKDVHDKVVAELDKRLDIKRTGQQGIFDNCYRASSKDLAKFPTIRL  381

Query  467  ILSANQSFVI  438
            + + NQSF +
Sbjct  382  MFTNNQSFSV  391



>ref|XP_006828808.1| PREDICTED: aspartic proteinase-like protein 1 [Amborella trichopoda]
 gb|ERM96224.1| hypothetical protein AMTR_s00001p00126200 [Amborella trichopoda]
Length=522

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 107/198 (54%), Gaps = 7/198 (4%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F Q   GRI FGD G  +Q  TPF  L+ +Y  Y + +    V SS +K +GF A
Sbjct  266  SFSMCFGQDGIGRIRFGDNGSSDQEETPF-NLDQSYPTYNISITDIQVGSSSIK-TGFSA  323

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMKLI  465
              DSG+SFT L    Y ++   FD  +   R   D    F YCY A S    NIP + L+
Sbjct  324  LFDSGTSFTYLADPIYTRLAKSFDIQVPDKRHQPDSRLPFEYCYNASSNVNSNIPDVSLL  383

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
            +     F I +P+    + QG   YCL V+  EG+  +IGQNFMTG R+VFD E L LGW
Sbjct  384  MQGGSRFPIYDPIIS-FSTQGHIVYCLAVVKGEGM-NIIGQNFMTGLRIVFDREKLVLGW  441

Query  284  SASNCKDLDDNDKVPVTP  231
               NC D+++   + + P
Sbjct  442  KKFNCYDVENTSTLDIKP  459



>ref|XP_010680395.1| PREDICTED: aspartic proteinase-like protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=527

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/266 (33%), Positives = 132/266 (50%), Gaps = 19/266 (7%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPF--LPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +SFS+ F     GRI FGD+G  +Q  T F    L  +YN   V +    V ++      
Sbjct  274  NSFSMCFGDDGLGRITFGDKGSSDQSETSFNLRKLNPHYN---VSISRINVGTNVSHVDD  330

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYK-ARSEGLPNIPS  477
            F A  DSG+SFT L    Y  +  +FD  +  +R + D    F YCY  + S+ +PN P 
Sbjct  331  FYAIFDSGTSFTYLNDPAYSLIGERFDAQVKDSRHTSDSDIPFEYCYDLSSSQSVPNTPP  390

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L +     F +  P+ P+    G   YCLG++  E +  +IGQNFMTGYR+VFD E +
Sbjct  391  INLTMEGGDHFYVNAPIVPVTTTAG-DMYCLGIVKSEDV-NIIGQNFMTGYRVVFDREKM  448

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRT-PNGHavapalagrapprps  120
             LGW AS+C +  ++  +P++P   G    P+ + E Q    NG  ++ A +        
Sbjct  449  VLGWKASDCNEAVESSMLPISPQSTG-QVPPISSIEPQAVQQNGSHISGASSALRHNSSH  507

Query  119  aasPCTIHYQHCTLILILLMLQSFVW  42
                  ++   CT+I+  L L S +W
Sbjct  508  ------LNLWTCTVIISFLHLLSILW  527



>gb|KDO80880.1| hypothetical protein CISIN_1g0092712mg [Citrus sinensis]
Length=385

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ FD++ SG +FFGDQGP  Q+ T FLP+   Y+ Y V VE YC+ +SCL QSG
Sbjct  273  IQNSFSICFDENDSGSVFFGDQGPATQQSTSFLPIGEKYDAYFVGVESYCIGNSCLTQSG  332

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSI--DVFHYCYKAR  504
            F+A VDSG+SFT LP E Y +VV KFD+L+++ R S+  + + YCY AR
Sbjct  333  FQALVDSGASFTFLPTEIYAEVVVKFDKLVSSKRISLQGNSWKYCYNAR  381



>ref|XP_007018871.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY16096.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=411

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+  D++ SGRI+FGD+G   Q+ TPFLP+ G Y KY V VEH CV SSCL++SG
Sbjct  267  IQNSFSICLDENGSGRIYFGDKGLATQQSTPFLPIGGKYEKYFVRVEHLCVGSSCLEKSG  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSS--IDVFHYCYKAR  504
            F A VDSG+SFT LP E Y KVV +FD+ +NA R S   D + YCY  R
Sbjct  327  FSALVDSGTSFTYLPPEIYDKVVLEFDKQVNARRISNQEDFWKYCYNVR  375



>emb|CBI25840.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 106/205 (52%), Gaps = 12/205 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGN--YNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F    +GRI FGD+G   Q  TPF P +    YN  I ++      +     
Sbjct  50   VADSFSMCFGNDGTGRISFGDEGSSGQEETPFNPSKSQLLYNISITQISVGGTSADL---  106

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYK-ARSEGLPNI  483
              F A  DSG+SFT L    Y  +   F+      RSS D    F YCY  +  +     
Sbjct  107  -NFDAIFDSGTSFTYLNDPAYTSISESFNLRAKDKRSSSDSDLPFEYCYDISEQQTTVEY  165

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            P + L +    +F + +P+  I++ QG   YCLGV+   G   +IGQNFMTGYR++FD E
Sbjct  166  PIVNLTMKGGDNFFVTDPIV-IVSIQGGYVYCLGVVK-SGDINIIGQNFMTGYRIIFDRE  223

Query  302  NLKLGWSASNCKDLDDNDKVPVTPT  228
             + LGW+ SNC D ++++ +P+ P 
Sbjct  224  KMVLGWTKSNCYDTEESNTLPINPA  248



>ref|XP_006354023.1| PREDICTED: aspartic proteinase-like protein 1-like [Solanum tuberosum]
Length=161

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  407  QGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWSASNCKDLDDNDKVPVTPT  228
            QG   YC+G+LPIEG+ G+IGQNFM GYR+VFDWEN+KLGWS S C+D+    KV  TP 
Sbjct  38   QGDNFYCVGLLPIEGMIGIIGQNFMEGYRLVFDWENMKLGWSHSKCQDIGGTAKVSPTPP  97

Query  227  PGGLSASPLPTNEQQRTPNGH  165
            P GL+++PLPT EQQR   GH
Sbjct  98   PSGLTSNPLPTTEQQRNSGGH  118



>ref|XP_007018873.1| Eukaryotic aspartyl protease family protein isoform 4 [Theobroma 
cacao]
 gb|EOY16098.1| Eukaryotic aspartyl protease family protein isoform 4 [Theobroma 
cacao]
Length=447

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+  D++ SGRI+FGD+G   Q+ TPFLP+ G Y KY V VEH CV SSCL++SG
Sbjct  267  IQNSFSICLDENGSGRIYFGDKGLATQQSTPFLPIGGKYEKYFVRVEHLCVGSSCLEKSG  326

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSS--IDVFHYCY  513
            F A VDSG+SFT LP E Y KVV +FD+ +NA R S   D + YCY
Sbjct  327  FSALVDSGTSFTYLPPEIYDKVVLEFDKQVNARRISNQEDFWKYCY  372



>ref|XP_008671078.1| PREDICTED: aspartic proteinase-like protein 1 [Zea mays]
Length=134

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 2/131 (2%)
 Frame = -2

Query  806  LXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRAQVD  627
            + F +  SGRIFFGDQG  +Q+ T F+PL G    Y V V+  C+   CL+ + F+A VD
Sbjct  1    MCFKEDSSGRIFFGDQGVPSQQSTLFVPLYGKLQTYAVNVDKSCIGHKCLEGTSFKALVD  60

Query  626  SGSSFTLLPYETYKKVVNKFDELMNATRSSID--VFHYCYKARSEGLPNIPSMKLILSAN  453
            SG+SFT LP + YK    +FD+ MNATR   +   + YCY A    +P++P++ L  +AN
Sbjct  61   SGTSFTSLPLDVYKAFTMEFDKQMNATRVPYEDTTWKYCYSASPLEMPDVPTITLTFAAN  120

Query  452  QSFVIQNPMFP  420
            +S    NP+ P
Sbjct  121  KSLQAVNPILP  131



>ref|XP_002269916.3| PREDICTED: aspartic proteinase-like protein 1 [Vitis vinifera]
Length=519

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 106/205 (52%), Gaps = 12/205 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGN--YNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F    +GRI FGD+G   Q  TPF P +    YN  I ++      +     
Sbjct  263  VADSFSMCFGNDGTGRISFGDEGSSGQEETPFNPSKSQLLYNISITQISVGGTSADL---  319

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYK-ARSEGLPNI  483
              F A  DSG+SFT L    Y  +   F+      RSS D    F YCY  +  +     
Sbjct  320  -NFDAIFDSGTSFTYLNDPAYTSISESFNLRAKDKRSSSDSDLPFEYCYDISEQQTTVEY  378

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            P + L +    +F + +P+  I++ QG   YCLGV+   G   +IGQNFMTGYR++FD E
Sbjct  379  PIVNLTMKGGDNFFVTDPIV-IVSIQGGYVYCLGVVK-SGDINIIGQNFMTGYRIIFDRE  436

Query  302  NLKLGWSASNCKDLDDNDKVPVTPT  228
             + LGW+ SNC D ++++ +P+ P 
Sbjct  437  KMVLGWTKSNCYDTEESNTLPINPA  461



>dbj|BAJ95388.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 116/229 (51%), Gaps = 18/229 (8%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGN--YNKYIVEVEHYCVESSCLKQSG  645
            +SFS+ F +   GRI FGD G  +Q  TP    + N  YN  IV      +       + 
Sbjct  269  NSFSMCFGEDGHGRINFGDTGSADQLETPLNIYKHNPYYNISIVGA----MAGGKTFSTK  324

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSM  474
            F A VDSG+SFT L    Y ++ + FD+ +   R+  D    F YCY   S+G  + P++
Sbjct  325  FSAVVDSGTSFTALSDPMYTEITSAFDKQVKEKRNPADSSLPFEYCYTISSKGAVSPPNI  384

Query  473  KLILSANQSFVIQNPMFPILNYQGVKC-YCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
             L       F +++P+  I +       YCL ++  EG+  LIG+NFM+G ++VFD E L
Sbjct  385  SLTAKGGSVFPVKDPIITITDISSSPVGYCLAIMKSEGV-NLIGENFMSGLKVVFDRERL  443

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASPL-------PTNEQQRTPN  171
             LGW + NC  +D + K+PV+P    +   P+       P   ++ +PN
Sbjct  444  VLGWKSFNCYSVDHSTKLPVSPNSSAIPPKPVSGPGSSNPEAAKRPSPN  492



>dbj|BAD46595.1| aspartic proteinase nepenthesin II -like [Oryza sativa Japonica 
Group]
Length=476

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 117/228 (51%), Gaps = 15/228 (7%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FGD G  +Q+ TP    + N   Y + +    V S  +    F 
Sbjct  223  NSFSMCFGDDGHGRINFGDTGSSDQKETPLNVYKQN-PYYNITITGITVGSKSISTE-FS  280

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMKL  468
            A VDSG+SFT L    Y ++ + FD  + ++R+ +D    F +CY   + G+ + P++ L
Sbjct  281  AIVDSGTSFTALSDPMYTQITSSFDAQIRSSRNMLDSSMPFEFCYSVSANGIVH-PNVSL  339

Query  467  ILSANQSFVIQNPMFPIL-NYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
                   F + +P+  I  N      YCL ++  EG+  LIG+NFM+G ++VFD E + L
Sbjct  340  TAKGGSIFPVNDPIITITDNAFNPVGYCLAIMKSEGV-NLIGENFMSGLKVVFDRERMVL  398

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASP-------LPTNEQQRTPNG  168
            GW   NC + D++ ++PV P+P  + + P        P   +   PNG
Sbjct  399  GWKNFNCYNFDESSRLPVNPSPSAVPSKPGLGPSSYTPEAAKGALPNG  446



>ref|NP_001063819.1| Os09g0542100 [Oryza sativa Japonica Group]
 dbj|BAF25733.1| Os09g0542100, partial [Oryza sativa Japonica Group]
Length=490

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 117/228 (51%), Gaps = 15/228 (7%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FGD G  +Q+ TP    + N   Y + +    V S  +    F 
Sbjct  237  NSFSMCFGDDGHGRINFGDTGSSDQKETPLNVYKQN-PYYNITITGITVGSKSISTE-FS  294

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMKL  468
            A VDSG+SFT L    Y ++ + FD  + ++R+ +D    F +CY   + G+ + P++ L
Sbjct  295  AIVDSGTSFTALSDPMYTQITSSFDAQIRSSRNMLDSSMPFEFCYSVSANGIVH-PNVSL  353

Query  467  ILSANQSFVIQNPMFPIL-NYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
                   F + +P+  I  N      YCL ++  EG+  LIG+NFM+G ++VFD E + L
Sbjct  354  TAKGGSIFPVNDPIITITDNAFNPVGYCLAIMKSEGV-NLIGENFMSGLKVVFDRERMVL  412

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASP-------LPTNEQQRTPNG  168
            GW   NC + D++ ++PV P+P  + + P        P   +   PNG
Sbjct  413  GWKNFNCYNFDESSRLPVNPSPSAVPSKPGLGPSSYTPEAAKGALPNG  460



>ref|XP_010113296.1| Aspartic proteinase-like protein 1 [Morus notabilis]
 gb|EXC35303.1| Aspartic proteinase-like protein 1 [Morus notabilis]
Length=497

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 107/202 (53%), Gaps = 8/202 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F Q   GRI FGD+G  +Q  TPF  L  ++  Y + V    V +S L  + 
Sbjct  272  IANSFSMCFGQDGIGRISFGDKGSPDQDETPF-NLNPSHPTYNITVTQIRVGTS-LFDAD  329

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPS  477
            F A  DSG+SFT L    Y ++   F   +  +R   D    F YCY    E   + IPS
Sbjct  330  FSALFDSGTSFTYLVEPIYTRLSESFHSQVQDSRRPTDSRIPFEYCYDMSPEANSSLIPS  389

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L +     F + +P+  +++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L
Sbjct  390  LSLTMKGGCQFAVYDPII-VISTQNEIVYCLAVVKSAEL-NIIGQNFMTGYRVVFDREKL  447

Query  296  KLGWSASNCKDLDDNDKVPVTP  231
             LGW  S+C D++D +  P  P
Sbjct  448  VLGWKKSDCYDIEDYNNFPAKP  469



>gb|EMS49647.1| Aspartic proteinase-like protein 1 [Triticum urartu]
Length=490

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 109/211 (52%), Gaps = 11/211 (5%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGN--YNKYIVEVEHYCVESSCLKQSG  645
            +SFS+ F +   GRI FGD G  +Q  TP    + N  YN  I+  +      S    + 
Sbjct  231  NSFSMCFGEDGHGRINFGDTGSADQLETPLNIYKHNPYYNISIIGAKAGGKTFS----TK  286

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSM  474
            F A VDSG+SFT L    Y ++ + F + +   R+  D    F YCY   ++G  + P++
Sbjct  287  FSAVVDSGTSFTALSDPMYTEITSAFHKQVKEKRNQADSSLPFEYCYTISAKGALSHPNI  346

Query  473  KLILSANQSFVIQNPMFPILNYQGVKC-YCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
             L       F + +P+  I +       YCL ++  EG+  LIG+NFM+G ++VFD E L
Sbjct  347  SLTAKGGSIFPVNDPIITITDISSTPVGYCLAIMKSEGV-NLIGENFMSGLKVVFDRERL  405

Query  296  KLGWSASNCKDLDDNDKVPVTPTPGGLSASP  204
             LGW + NC  +D + K+PV+P P  +   P
Sbjct  406  VLGWKSFNCYSVDHSSKLPVSPNPSAVPPKP  436



>gb|EEC84974.1| hypothetical protein OsI_32231 [Oryza sativa Indica Group]
Length=513

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 116/228 (51%), Gaps = 15/228 (7%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FGD G  +Q+ TP    + N   Y + +    V S  +    F 
Sbjct  260  NSFSMCFGDDGHGRINFGDTGSSDQKETPLNVYKQN-PYYNITITGITVGSKSISTE-FS  317

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMKL  468
            A VDSG+SFT L    Y ++ + FD  + ++R+ +D    F +CY   + G+ + P++ L
Sbjct  318  AIVDSGTSFTALSDPMYTQITSSFDAQIRSSRNMLDSSMPFEFCYSVSANGIVH-PNVSL  376

Query  467  ILSANQSFVIQNPMFPIL-NYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
                   F + +P+  I  N      YCL ++  EG+  LIG+NFM+G ++VFD E + L
Sbjct  377  TAKGGSIFPVNDPIITITDNAFNPVGYCLAIMKSEGV-NLIGENFMSGLKVVFDRERMVL  435

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASP-------LPTNEQQRTPNG  168
            GW   NC + D++ ++PV P+P  +   P        P   +   PNG
Sbjct  436  GWKNFNCYNFDESSRLPVNPSPSAVPPKPGLGPSSYTPEAAKGALPNG  483



>gb|AIU50177.1| aspartyl protease family protein, partial [Phaseolus vulgaris]
Length=414

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 104/199 (52%), Gaps = 15/199 (8%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVE---HYCVESSCLKQSG  645
            SFS+ F +   GRI FGD+G  +Q  TPF  L   YN  + +V     + VE        
Sbjct  209  SFSMCFGRDGIGRISFGDKGSFDQDETPF-NLNPTYNVTVTQVRVGTTFDVE--------  259

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKL  468
            F A  DSG+SFT L   TY ++   F   +   R S   F YCY    +   + IPS+ L
Sbjct  260  FTALFDSGTSFTYLVDPTYTRLTESFHSHVQDRRDSRIPFEYCYDMSPDANTSLIPSVSL  319

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F + +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L LG
Sbjct  320  TMGGGSHFAVYDPII-IISTQSELVYCLAVVKSSEL-SIIGQNFMTGYRVVFDREKLVLG  377

Query  287  WSASNCKDLDDNDKVPVTP  231
            W   +C D++D + +P+ P
Sbjct  378  WKKFDCYDMEDRNVIPIRP  396



>ref|XP_004509400.1| PREDICTED: aspartic proteinase-like protein 1-like [Cicer arietinum]
Length=520

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 107/204 (52%), Gaps = 15/204 (7%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F+   SGRI FGD G  +Q  TPF  +E     Y + V    V    + Q  
Sbjct  270  ISNSFSMCFESDGSGRITFGDTGSSDQGKTPFNLMEL-LPTYNITVTQIIVGGYAVDQE-  327

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR-------SSIDV-FHYCYKARSEGLP  489
            F A  DSG+SFT L    Y  + +KF+ L+ A R       S  DV F YCY    +   
Sbjct  328  FHAIFDSGTSFTYLNDPAYTLISDKFNSLVKANRHSPLSPNSDSDVPFEYCYDISPDETI  387

Query  488  NIPSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFD  309
             +P + L +    ++ + +P+ PI   +G    CLG+   + +  +IGQNFMTGYR+VFD
Sbjct  388  EVPFLNLTMKGGDNYYVTDPIEPI---EG-NLLCLGIQKSDNV-NIIGQNFMTGYRIVFD  442

Query  308  WENLKLGWSASNCKDLDDNDKVPV  237
             EN+ LGW  SNC D   ++ VP 
Sbjct  443  RENMNLGWKESNCTDEVLSNTVPT  466



>gb|AIU50160.1| aspartyl protease family protein, partial [Glycine max]
Length=415

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 101/197 (51%), Gaps = 10/197 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F +   GRI FGD+G  +Q  TPF  L   YN  + +V              F A
Sbjct  209  SFSMCFGRDGIGRISFGDKGSFDQDETPF-NLNPTYNITVTQVR-----VGTTIDVEFTA  262

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKLILS  459
              DSG+SFT L   TY ++   F   +   R S   F YCY    +   + IPS+ L + 
Sbjct  263  LFDSGTSFTYLVDPTYTRLTESFHSQVQDRRDSRIPFEYCYDMSPDANTSLIPSVSLTMG  322

Query  458  ANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWSA  279
                F + +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L LGW  
Sbjct  323  GGSHFAVYDPII-IISTQSELVYCLAVVKTAEL-NIIGQNFMTGYRVVFDREKLVLGWKK  380

Query  278  SNCKDLDD-NDKVPVTP  231
             +C D++D ND +P  P
Sbjct  381  FDCYDIEDHNDAIPTRP  397



>dbj|BAC79194.1| chloroplast nucleoid DNA-binding protein -like protein [Oryza 
sativa Japonica Group]
Length=732

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 117/228 (51%), Gaps = 15/228 (7%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FGD G  +Q+ TP    + N   Y + +    V S  +    F 
Sbjct  260  NSFSMCFGDDGHGRINFGDTGSSDQKETPLNVYKQN-PYYNITITGITVGSKSISTE-FS  317

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMKL  468
            A VDSG+SFT L    Y ++ + FD  + ++R+ +D    F +CY   + G+ + P++ L
Sbjct  318  AIVDSGTSFTALSDPMYTQITSSFDAQIRSSRNMLDSSMPFEFCYSVSANGIVH-PNVSL  376

Query  467  ILSANQSFVIQNPMFPIL-NYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
                   F + +P+  I  N      YCL ++  EG+  LIG+NFM+G ++VFD E + L
Sbjct  377  TAKGGSIFPVNDPIITITDNAFNPVGYCLAIMKSEGV-NLIGENFMSGLKVVFDRERMVL  435

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASP-------LPTNEQQRTPNG  168
            GW   NC + D++ ++PV P+P  + + P        P   +   PNG
Sbjct  436  GWKNFNCYNFDESSRLPVNPSPSAVPSKPGLGPSSYTPEAAKGALPNG  483



>ref|XP_010680394.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=520

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 101/194 (52%), Gaps = 12/194 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            +  SFS+ F     GRI FGD+G   Q+ TPF   PL  +YN  I ++       + L +
Sbjct  268  IADSFSMCFGHDGVGRISFGDKGSPEQKETPFNVNPLHPSYNITITQIR----VGTALNE  323

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  DSG+SFT +   +Y K+   FD  +   R   D    F YCY  R +   + I
Sbjct  324  VDFTALFDSGTSFTYMVDPSYTKLAGNFDSQIKDKRRPADSRIPFEYCYDMRPDANTSLI  383

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            P++ L +     F + +P+  +++ Q    YCL V+    +  +IGQNFMTGYR+VFD E
Sbjct  384  PTVSLSMQGGSQFTVDDPII-VISTQSELVYCLAVVKSTEL-NIIGQNFMTGYRIVFDRE  441

Query  302  NLKLGWSASNCKDL  261
             L LGW  S+C D 
Sbjct  442  KLILGWEKSDCYDF  455



>ref|XP_007156197.1| hypothetical protein PHAVU_003G266500g [Phaseolus vulgaris]
 gb|ESW28191.1| hypothetical protein PHAVU_003G266500g [Phaseolus vulgaris]
Length=508

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 112/228 (49%), Gaps = 14/228 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F    SGRI FGD G  +QR TPF  L+ +Y  Y + +    VE   +    
Sbjct  260  ISNSFSMCFGSRGSGRITFGDSGSPDQRKTPF-NLDTSYPTYNITITQIVVEDR-VADLE  317

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV------FHYCYKARSEGLPNI  483
            F A  DSG+SFT +    Y ++   F   + A R S         F YCY         +
Sbjct  318  FHAIFDSGTSFTYINDPAYTRLGEMFSSRIKANRHSSQSPESKINFEYCYDISLNQTIEV  377

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            P + L +     + + +P+  +L+ +     CLG+L    +  +IGQNFM+GY++VFD +
Sbjct  378  PFVNLTMKGGDDYYVMDPIILVLSEKEGNFLCLGILKSNSV-NIIGQNFMSGYKIVFDRD  436

Query  302  NLKLGWSASNCKDLDDNDKVPVTPTPG-----GLSASPLPTNEQQRTP  174
            N+ LGW  SNC +   +D  P+ P+        ++ +P+ T+     P
Sbjct  437  NMNLGWKESNCSEYVLSDTPPLNPSHAPAVSPAIAVNPVATSNPSTIP  484



>ref|XP_010113297.1| Aspartic proteinase-like protein 1 [Morus notabilis]
 gb|EXC35304.1| Aspartic proteinase-like protein 1 [Morus notabilis]
Length=940

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 107/202 (53%), Gaps = 8/202 (4%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F Q   GRI FGD+G  +Q  TPF  L  ++  Y + V    V +S L  + 
Sbjct  229  IANSFSMCFGQDGIGRISFGDKGSPDQDETPF-NLNPSHPTYNITVTQIRVGTS-LFDAD  286

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPS  477
            F A  DSG+SFT L    Y ++   F   +  +R   D    F YCY    E   + IPS
Sbjct  287  FSALFDSGTSFTYLVEPIYTRLSESFHSQVQDSRRPTDSRIPFEYCYDMSPEANSSLIPS  346

Query  476  MKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            + L +     F + +P+  +++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L
Sbjct  347  LSLTMKGGCQFAVYDPII-VISTQNEIVYCLAVVKSAEL-NIIGQNFMTGYRVVFDREKL  404

Query  296  KLGWSASNCKDLDDNDKVPVTP  231
             LGW  S+C D++D +  P  P
Sbjct  405  VLGWKKSDCYDIEDYNNFPAKP  426


 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 108/213 (51%), Gaps = 9/213 (4%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FGD G  +Q  TPF  L  ++  Y + +    V  + +    F 
Sbjct  691  NSFSMCFGSDDLGRIRFGDNGSADQSETPF-NLRQSHPSYNITITQITVGGT-VADLEFH  748

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARS-EGLPNIPSMK  471
            A  D+G+SFT L    Y ++   F+ L    R + +    F YCY  RS +     P + 
Sbjct  749  AIFDTGTSFTYLNDPAYTQITESFNYLATEDRHTNESEIPFEYCYNLRSNQKSYEYPPIN  808

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L +   + + + +P+       G + YCLGV+   G   +IGQNFMTGY +VFD E L L
Sbjct  809  LTMKGGKQYSVIDPIVETSTMGGGRVYCLGVVK-SGDVNIIGQNFMTGYTVVFDREKLVL  867

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPLPTN  192
            GW  SNC D  +   +PV P+    +ASP P+N
Sbjct  868  GWKESNCYDERETATLPVKPS-NSPAASP-PSN  898



>gb|AIU50181.1| aspartyl protease family protein, partial [Solanum lycopersicum]
Length=414

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 109/218 (50%), Gaps = 13/218 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYN-KYIVEVEHYCVESSCLKQS  648
            +  SFS+ F    +GRI FGD+G  +Q  TPF     N N  Y + V+   V ++    S
Sbjct  206  MADSFSMCFGSDGAGRISFGDKGSFDQEETPF-----NINPTYNISVDQIRVGTTV--DS  258

Query  647  GFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKAR-SEGLPNIPSMK  471
            GF A  D+G+SFT L   +Y K+   F   +   R     F YCY     E    IPS+ 
Sbjct  259  GFTALFDTGTSFTYLADLSYTKLSESFHSQVRDKRDPRIPFEYCYDMSPDENTSLIPSLS  318

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L +S      + +P+  +++ Q    YCL ++  + +  +IGQNFMTGYR VFD E + L
Sbjct  319  LTMSGGGQLAVNDPII-VISTQNQLMYCLAIVKSDAL-NIIGQNFMTGYRFVFDREKIIL  376

Query  290  GWSASNCKDLDDNDKVPVTP--TPGGLSASPLPTNEQQ  183
            GW   +C D++  D  P  P  TP   +  P   N ++
Sbjct  377  GWKKFDCYDIEKIDHFPSQPVNTPPAFAVVPGNDNAEK  414



>gb|KHN35548.1| Aspartic proteinase-like protein 1 [Glycine soja]
Length=474

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 103/202 (51%), Gaps = 13/202 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F +   GRI FGD+G  +Q  TPF   P    YN  + +V       + L    F
Sbjct  218  SFSMCFGRDGIGRISFGDKGSFDQDETPFNLNPSHPTYNITVTQVR----VGTTLIDVEF  273

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT L   TY ++   F   +   R   D    F YCY    +   + IPS+
Sbjct  274  TALFDSGTSFTYLVDPTYTRLTESFHSQVQDRRHRSDSRIPFEYCYDMSPDANTSLIPSV  333

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  334  SLTMGGGSHFAVYDPII-IISTQSELVYCLAVVKTAEL-NIIGQNFMTGYRVVFDREKLV  391

Query  293  LGWSASNCKDLDD-NDKVPVTP  231
            LGW   +C D++D ND +P  P
Sbjct  392  LGWKKFDCYDIEDHNDAIPTRP  413



>ref|XP_007156199.1| hypothetical protein PHAVU_003G266600g [Phaseolus vulgaris]
 gb|ESW28193.1| hypothetical protein PHAVU_003G266600g [Phaseolus vulgaris]
Length=409

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 103/201 (51%), Gaps = 12/201 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F +   GRI FGD+G  +Q  TPF   P    YN  + +V       + L    F
Sbjct  154  SFSMCFGRDGIGRISFGDKGSFDQDETPFNLNPSHPTYNVTVTQVR----VGTTLFDVEF  209

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT L   TY ++   F   +   R   D    F YCY    +   + IPS+
Sbjct  210  TALFDSGTSFTYLVDPTYTRLTESFHSHVQDRRRPSDSRIPFEYCYDMSPDANTSLIPSV  269

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  270  SLTMGGGSHFAVYDPII-IISTQSELVYCLAVVKSSEL-SIIGQNFMTGYRVVFDREKLV  327

Query  293  LGWSASNCKDLDDNDKVPVTP  231
            LGW   +C D++D + +P+ P
Sbjct  328  LGWKKFDCYDMEDRNVIPIRP  348



>gb|KDP23963.1| hypothetical protein JCGZ_25351 [Jatropha curcas]
Length=482

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 109/230 (47%), Gaps = 16/230 (7%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            +  SFS+ F     GRI FGD+G  +Q  TPF   P    YN  + ++       + L  
Sbjct  227  IADSFSMCFGYDGVGRISFGDKGSPDQDETPFNLNPSHPTYNITVTQIR----VGTTLID  282

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  DSG+SFT L    Y  V + F           D    F YCY        + I
Sbjct  283  VDFTALFDSGTSFTYLVDPAYAMVSDNFHAQAKDRLRPPDPRIPFEYCYDMSPNANASLI  342

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PSM+L +     F I +P+  +++ Q    YCL V+    +  +IGQNFMTGYR+VFD E
Sbjct  343  PSMRLTMQGGGQFAISDPVI-VISTQNELVYCLAVVKSTEL-NIIGQNFMTGYRIVFDRE  400

Query  302  NLKLGWSASNCKDLDDNDKVPVTP----TPGGLSASPLPTNEQQRTPNGH  165
            N  LGW  +NC D++D  K P+ P     P  ++A     + QQ T  G 
Sbjct  401  NYVLGWKKTNCYDMEDYSKFPMEPHASSVPPAVAAGQRNYSSQQSTKEGR  450



>ref|XP_006425378.1| hypothetical protein CICLE_v10025361mg [Citrus clementina]
 gb|ESR38618.1| hypothetical protein CICLE_v10025361mg [Citrus clementina]
Length=378

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 100/201 (50%), Gaps = 11/201 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F     GRI FGD+G   Q+ T F   P   +YN  + ++       + L     
Sbjct  125  SFSMCFGNDGIGRISFGDKGSPYQQETSFNVNPSHPSYNITVTQIR----VGTTLIDVDI  180

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT +   TY +++  F   +   R   D    F YCY    +   + IPSM
Sbjct  181  TALFDSGTSFTYMVEPTYTRLLENFHSQVQDKRRQHDSRIPFEYCYDMSPDANASLIPSM  240

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + NP+  I   QG   YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  241  SLRMKGGSHFTVYNPIIVISTQQGELVYCLAVVKSMEL-NIIGQNFMTGYRVVFDRERLV  299

Query  293  LGWSASNCKDLDDNDKVPVTP  231
            LGW   NC D++D+   PV P
Sbjct  300  LGWEKFNCYDIEDSYTFPVKP  320



>ref|XP_012088469.1| PREDICTED: aspartic proteinase-like protein 1 [Jatropha curcas]
Length=512

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 109/230 (47%), Gaps = 16/230 (7%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            +  SFS+ F     GRI FGD+G  +Q  TPF   P    YN  + ++       + L  
Sbjct  257  IADSFSMCFGYDGVGRISFGDKGSPDQDETPFNLNPSHPTYNITVTQIR----VGTTLID  312

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  DSG+SFT L    Y  V + F           D    F YCY        + I
Sbjct  313  VDFTALFDSGTSFTYLVDPAYAMVSDNFHAQAKDRLRPPDPRIPFEYCYDMSPNANASLI  372

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PSM+L +     F I +P+  +++ Q    YCL V+    +  +IGQNFMTGYR+VFD E
Sbjct  373  PSMRLTMQGGGQFAISDPVI-VISTQNELVYCLAVVKSTEL-NIIGQNFMTGYRIVFDRE  430

Query  302  NLKLGWSASNCKDLDDNDKVPVTP----TPGGLSASPLPTNEQQRTPNGH  165
            N  LGW  +NC D++D  K P+ P     P  ++A     + QQ T  G 
Sbjct  431  NYVLGWKKTNCYDMEDYSKFPMEPHASSVPPAVAAGQRNYSSQQSTKEGR  480



>ref|XP_002462757.1| hypothetical protein SORBIDRAFT_02g031460 [Sorghum bicolor]
 gb|EER99278.1| hypothetical protein SORBIDRAFT_02g031460 [Sorghum bicolor]
Length=523

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 112/228 (49%), Gaps = 14/228 (6%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FGD G  +Q+ TP    + N   Y + +    V S     + F 
Sbjct  265  NSFSMCFGDDGRGRINFGDTGSSDQQETPLNIYKQN-PYYNISITGAMVGSKSF-NTNFN  322

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMKL  468
            A VDSG+SFT L    Y ++ + F+  +    + +D    F +CY    +G  N P++ L
Sbjct  323  AIVDSGTSFTALSDPMYSEITSSFNSQVQDKPTQLDSSLPFEFCYSISPKGSVNPPNISL  382

Query  467  ILSANQSFVIQNPMFPILN-YQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            +      F + +P+  I +       YCL V+  EG+  LIG+NFM+G ++VFD E   L
Sbjct  383  MAKGGSIFPVNDPIITITDDASNPMAYCLAVMKSEGV-NLIGENFMSGLKVVFDRERKVL  441

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASPL-------PTNEQQRTPNG  168
            GW   NC  +D++  +PV P P G+   P        P   +  +PNG
Sbjct  442  GWKKFNCYSVDNSSNLPVNPNPSGVPPKPALGPNSYTPEATKGTSPNG  489



>gb|KJB43278.1| hypothetical protein B456_007G191400 [Gossypium raimondii]
Length=515

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 112/224 (50%), Gaps = 12/224 (5%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FGD+G   Q  TPF  L  ++  Y V +    V  +      F 
Sbjct  263  NSFSMCFGVDGVGRITFGDRGSSGQGETPF-NLRQSHPTYNVSITQVNVGGNTADLD-FN  320

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATR----SSIDVFHYCYKARSEGLP-NIPSM  474
            A  DSG+SFT L    Y  +   F+      R    SS   F YCY   +     N P +
Sbjct  321  AIFDSGTSFTYLNDPAYTLISENFNNFATEKRHTSNSSGLPFEYCYDLSANQTSFNYPIV  380

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + +P+  +++ QG   YCLG++  + +  +IGQNFMTGYR+VFD E + 
Sbjct  381  NLTMKGGDYFFVNDPII-VISLQGGDVYCLGIVKSDNV-NIIGQNFMTGYRIVFDRERMV  438

Query  293  LGWSASNCKDLDDNDKVPVTP---TPGGLSASPLPTNEQQRTPN  171
            LGW AS+C D++ ++ +PV P    P  ++ +P  T+      N
Sbjct  439  LGWKASDCYDIEASNTLPVNPPTAVPPAIAVNPEATSGNANNTN  482



>ref|XP_006599302.1| PREDICTED: aspartic proteinase-like protein 1-like [Glycine max]
Length=519

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 103/202 (51%), Gaps = 13/202 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F +   GRI FGD+G  +Q  TPF   P    YN  + +V       + L    F
Sbjct  263  SFSMCFGRDGIGRISFGDKGSFDQDETPFNLNPSHPTYNITVTQVR----VGTTLIDVEF  318

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT L   TY ++   F   +   R   D    F YCY    +   + IPS+
Sbjct  319  TALFDSGTSFTYLVDPTYTRLTESFHSQVQDRRHRSDSRIPFEYCYDMSPDANTSLIPSV  378

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  379  SLTMGGGSHFAVYDPII-IISTQSELVYCLAVVKTAEL-NIIGQNFMTGYRVVFDREKLV  436

Query  293  LGWSASNCKDLDD-NDKVPVTP  231
            LGW   +C D++D ND +P  P
Sbjct  437  LGWKKFDCYDIEDHNDAIPTRP  458



>ref|XP_003578546.1| PREDICTED: aspartic proteinase-like protein 1 [Brachypodium distachyon]
Length=530

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 103/202 (51%), Gaps = 7/202 (3%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F +   GRI FGD G  +Q  TP    + N   Y + +    V       + F 
Sbjct  260  NSFSMCFGEDGHGRINFGDTGSSDQLETPLNIYKQN-PYYNISITGAMVGGKSF-DTKFS  317

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMKL  468
            A VDSG+SFT L    Y ++ + F+  +  +R  +D    F YCY   ++G  N P++ L
Sbjct  318  AVVDSGTSFTALSDPMYTEITSTFNAQVKESRKHLDASMPFEYCYSISAQGAVNPPNISL  377

Query  467  ILSANQSFVIQNPMFPILNYQGVK-CYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
                   F +  P+  I +       YCL ++  EG+  LIG+NFM+G ++VFD E L L
Sbjct  378  TAKGGSIFPVNGPIITITDTSSRPIAYCLAIMKSEGV-NLIGENFMSGLKIVFDRERLVL  436

Query  290  GWSASNCKDLDDNDKVPVTPTP  225
            GW   NC + D++ K+PV   P
Sbjct  437  GWKTFNCYNFDNSSKLPVNRNP  458



>gb|AIU50171.1| aspartyl protease family protein, partial [Medicago truncatula]
Length=416

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 106/196 (54%), Gaps = 12/196 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYN-KYIVEVEHYCVESSCLKQSGFR  639
            SFS+ F +   GRI FGD+G  +Q  TPF     N N  Y + +    V ++   +  F 
Sbjct  209  SFSMCFGRDGIGRISFGDKGSLDQDETPF-----NVNPTYNITINQVRVGTTIDVE--FT  261

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKLIL  462
            A  DSG+SFT L   TY ++   F   +   R S   F YCY    +   + IPSM L +
Sbjct  262  ALFDSGTSFTYLVDPTYSRLSESFHSQVEDRRDSRIPFDYCYDMSPDSNTSLIPSMSLTM  321

Query  461  SANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWS  282
                 FV+ +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L LGW 
Sbjct  322  GGGSRFVVYDPII-IISTQSELVYCLAVVKSAEL-NIIGQNFMTGYRVVFDREKLILGWK  379

Query  281  ASNCKDLDD-NDKVPV  237
             S+C D++D N+ +P+
Sbjct  380  KSDCYDIEDHNNAIPI  395



>gb|KFK30223.1| hypothetical protein AALP_AA7G233600 [Arabis alpina]
Length=521

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 101/200 (51%), Gaps = 12/200 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLP--LEGNYNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F Q   GRI FGD+G  +Q  TPF    L  NYN  +  V       + +  
Sbjct  262  VADSFSMCFGQDGVGRISFGDKGSSDQEETPFNVNLLHPNYNITVTRVR----VGTTITD  317

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
            + F A  D+G+SFT L    Y  V   F       R S D    F YCY   SE   + I
Sbjct  318  NEFTALFDTGTSFTYLVDPMYTTVSESFHSQAQDKRHSPDSRIPFEYCYDMSSEANASLI  377

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PS+ L +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E
Sbjct  378  PSLSLTMKGNSHFTINDPII-VISTEGELVYCLAIVKSSEL-NIIGQNYMTGYRVVFDRE  435

Query  302  NLKLGWSASNCKDLDDNDKV  243
             L L W   +C D+++  K 
Sbjct  436  KLILAWKKFDCYDIEETTKT  455



>ref|XP_007156198.1| hypothetical protein PHAVU_003G266600g [Phaseolus vulgaris]
 gb|ESW28192.1| hypothetical protein PHAVU_003G266600g [Phaseolus vulgaris]
Length=522

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 103/201 (51%), Gaps = 12/201 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F +   GRI FGD+G  +Q  TPF   P    YN  + +V       + L    F
Sbjct  267  SFSMCFGRDGIGRISFGDKGSFDQDETPFNLNPSHPTYNVTVTQVR----VGTTLFDVEF  322

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT L   TY ++   F   +   R   D    F YCY    +   + IPS+
Sbjct  323  TALFDSGTSFTYLVDPTYTRLTESFHSHVQDRRRPSDSRIPFEYCYDMSPDANTSLIPSV  382

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  383  SLTMGGGSHFAVYDPII-IISTQSELVYCLAVVKSSEL-SIIGQNFMTGYRVVFDREKLV  440

Query  293  LGWSASNCKDLDDNDKVPVTP  231
            LGW   +C D++D + +P+ P
Sbjct  441  LGWKKFDCYDMEDRNVIPIRP  461



>ref|XP_008242027.1| PREDICTED: aspartic proteinase-like protein 1 [Prunus mume]
Length=517

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/219 (36%), Positives = 111/219 (51%), Gaps = 13/219 (6%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPF-LPLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            +SFS+ F     GRI FGD G  +Q  TPF L     Y  Y + +    +  S      F
Sbjct  271  NSFSMCFRLDGYGRISFGDNGSLDQAETPFNLKNRSAYPTYNITITQIAIGESATDLE-F  329

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMK  471
             A  DSG+SFT L    Y K+   F+  +   R S D    F YCY  R    PN  ++ 
Sbjct  330  YAIFDSGTSFTYLNDPAYTKITENFNSALKNKRQSKDSSIPFEYCYDIR----PN-QTVN  384

Query  470  LILSANQSFVIQNPMFPILNYQG-VKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L L   + + + +P+  + N  G +  YCLG++   G   +IGQNFMTGYR++FD E + 
Sbjct  385  LTLKGGKQYSLLDPLVVLANEDGTLMFYCLGIVK-SGDVNIIGQNFMTGYRVIFDRERMV  443

Query  293  LGWSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQRT  177
            LGW  S+C +++D   +PVT +    +ASP  T   + T
Sbjct  444  LGWKESDCYNVEDTVTLPVTKSKSP-AASPSATINPEAT  481



>ref|XP_004232518.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Solanum 
lycopersicum]
Length=521

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 105/204 (51%), Gaps = 12/204 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            +  SFS+ F    +GRI FGD+G  +Q  TPF   PL   YN   + V+   V ++ L  
Sbjct  265  MADSFSMCFGSDGAGRISFGDKGSFDQEETPFNINPLHPTYN---ISVDQIRVGTT-LVD  320

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKAR-SEGLPNI  483
            SGF A  D+G+SFT L   +Y K+   F   +   R   D    F YCY     E    I
Sbjct  321  SGFTALFDTGTSFTYLADLSYTKLSESFHSQVRDKRRPPDPRIPFEYCYDMSPDENTSLI  380

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PS+ L +S      + +P+  +++ Q    YCL ++  + +  +IGQNFMTGYR VFD E
Sbjct  381  PSLSLTMSGGGQLAVNDPII-VISTQNQLMYCLAIVKSDAL-NIIGQNFMTGYRFVFDRE  438

Query  302  NLKLGWSASNCKDLDDNDKVPVTP  231
             + LGW   +C D++  D  P  P
Sbjct  439  KIILGWKKFDCYDIEKIDHFPSQP  462



>ref|XP_002310698.2| hypothetical protein POPTR_0007s08610g [Populus trichocarpa]
 gb|EEE91148.2| hypothetical protein POPTR_0007s08610g [Populus trichocarpa]
Length=483

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 102/204 (50%), Gaps = 12/204 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            +  SFS+ F     GRI FGD+G  +Q  TPF   P    YN  + +        + L  
Sbjct  228  IADSFSMCFGHDGIGRISFGDKGSPDQEETPFNVNPAHPTYNVTVTQAR----VGTMLID  283

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  DSG+SFT +    Y +V  KF  L    R   D    F YCY    +   + +
Sbjct  284  VEFTALFDSGTSFTYMVDPAYSRVSEKFHSLARDKRRPPDPRIPFEYCYDMSPDANASLV  343

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PSM L +   + F + +P+  +++ Q    YCL V+    +  +IGQNFMTGYR+VFD E
Sbjct  344  PSMSLTMKGGRHFTVYDPII-VISTQNEIVYCLAVVKSTEL-NIIGQNFMTGYRVVFDRE  401

Query  302  NLKLGWSASNCKDLDDNDKVPVTP  231
             L LGW   +C D++D +  P+ P
Sbjct  402  KLVLGWKKFDCYDVEDYNNFPLQP  425



>ref|XP_004957514.1| PREDICTED: aspartic proteinase-like protein 1-like [Setaria italica]
Length=515

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 113/228 (50%), Gaps = 14/228 (6%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F +   GRI FGD G  +Q+ TP    + N   Y + +    V S  +  S F 
Sbjct  257  NSFSMCFGEDGHGRINFGDTGSSDQQETPLNIYKQN-PYYNISITGAMVGSKSI-NSKFS  314

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMKL  468
            A VDSG+SFT L    Y ++ + FD  +    S +D    F +CY   S+G  N P++ L
Sbjct  315  AIVDSGTSFTALSDPMYTEITSSFDSQVEDKPSQLDSSLPFEFCYSVSSKGSINPPNISL  374

Query  467  ILSANQSFVIQNPMFPILNYQGVKC-YCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
                   F + +P+  I +       YCL ++  EG+  LIG+NFM+G ++VFD E   L
Sbjct  375  TAIGGSVFPVNDPIITITDTASNPLGYCLAMMKSEGV-NLIGENFMSGLKIVFDRERKVL  433

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASP-------LPTNEQQRTPNG  168
            GW   +C  +D++ ++P  P P  +   P        P   +  +PNG
Sbjct  434  GWKFFDCYSVDNSSRLPANPNPSAVPPKPPMGPNSYTPEAAKGASPNG  481



>ref|XP_006425377.1| hypothetical protein CICLE_v10025361mg [Citrus clementina]
 gb|ESR38617.1| hypothetical protein CICLE_v10025361mg [Citrus clementina]
Length=523

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 100/201 (50%), Gaps = 11/201 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F     GRI FGD+G   Q+ T F   P   +YN  + ++       + L     
Sbjct  270  SFSMCFGNDGIGRISFGDKGSPYQQETSFNVNPSHPSYNITVTQIR----VGTTLIDVDI  325

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT +   TY +++  F   +   R   D    F YCY    +   + IPSM
Sbjct  326  TALFDSGTSFTYMVEPTYTRLLENFHSQVQDKRRQHDSRIPFEYCYDMSPDANASLIPSM  385

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + NP+  I   QG   YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  386  SLRMKGGSHFTVYNPIIVISTQQGELVYCLAVVKSMEL-NIIGQNFMTGYRVVFDRERLV  444

Query  293  LGWSASNCKDLDDNDKVPVTP  231
            LGW   NC D++D+   PV P
Sbjct  445  LGWEKFNCYDIEDSYTFPVKP  465



>ref|XP_006467010.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X1 
[Citrus sinensis]
 ref|XP_006467014.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X1 
[Citrus sinensis]
Length=523

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 100/201 (50%), Gaps = 11/201 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F     GRI FGD+G   Q+ T F   P   +YN  + ++       + L     
Sbjct  270  SFSMCFGNDGIGRISFGDKGSPYQQETSFNVNPSHPSYNITVTQIR----VGTTLIDVDI  325

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT +   TY +++  F   +   R   D    F YCY    +   + IPSM
Sbjct  326  TALFDSGTSFTYMVEPTYTRLLENFHSQVQDKRRQHDSRIPFEYCYDMSPDANASLIPSM  385

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + NP+  I   QG   YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  386  SLRMKGGSHFTVYNPIIVISTQQGELVYCLAVVKSMEL-NIIGQNFMTGYRVVFDRERLV  444

Query  293  LGWSASNCKDLDDNDKVPVTP  231
            LGW   NC D++D+   PV P
Sbjct  445  LGWEKFNCYDIEDSYTFPVKP  465



>gb|AIU50184.1| aspartyl protease family protein, partial [Lactuca sativa]
Length=404

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 103/202 (51%), Gaps = 12/202 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F    +GRI FGD+G   Q  TPF  L+  YN  + EV    V SS    S F A
Sbjct  209  SFSMCFGHDGTGRITFGDKGNPEQDVTPF-NLDPTYNITVTEVR---VGSSI--DSSFSA  262

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKLILS  459
              DSG+SFT L    Y ++  +F      +R     F YCY        + IPS+ L + 
Sbjct  263  LFDSGTSFTYLIDPHYTRLTQRFHVQTKDSRDQRIPFEYCYDMSPYANTSLIPSISLTMK  322

Query  458  ANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWSA  279
                F I +P+  I   + V  YCL V+    +  +IGQNFMTGYR+VFD E L LGW  
Sbjct  323  GEGQFFIYDPVIVISTNREV-VYCLAVIKSTEL-NIIGQNFMTGYRIVFDREELILGWRK  380

Query  278  SNCKDLD---DNDKVPVTPTPG  222
            S+C D++   D+   P+ P P 
Sbjct  381  SDCYDIENSTDSSSKPLNPPPA  402



>gb|AET03725.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=527

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 105/200 (53%), Gaps = 13/200 (7%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F +   GRI FGD+G  +Q  TPF   P    YN  I +V       + L    F
Sbjct  268  SFSMCFGRDGIGRISFGDKGSLDQDETPFNVNPSHPTYNITINQVR----VGTTLIDVEF  323

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT L   TY ++   F   +   R   D    F YCY    +   + IPSM
Sbjct  324  TALFDSGTSFTYLVDPTYSRLSESFHSQVEDRRRPPDSRIPFDYCYDMSPDSNTSLIPSM  383

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     FV+ +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  384  SLTMGGGSRFVVYDPII-IISTQSELVYCLAVVKSAEL-NIIGQNFMTGYRVVFDREKLI  441

Query  293  LGWSASNCKDLDD-NDKVPV  237
            LGW  S+C D++D N+ +P+
Sbjct  442  LGWKKSDCYDIEDHNNAIPI  461



>ref|XP_006660917.1| PREDICTED: aspartic proteinase-like protein 1-like [Oryza brachyantha]
Length=298

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 113/228 (50%), Gaps = 15/228 (7%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FGD G  +Q+ TP L +      Y + +    V S  +    F 
Sbjct  43   NSFSMCFGDDGHGRINFGDTGTSDQKETP-LNIYKQNPYYNITITGITVGSKSVNTE-FS  100

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMKL  468
            A VDSG+SFT L    Y ++ + FD  + + R+ +D    F +CY   + G  + P++ L
Sbjct  101  AIVDSGTSFTALSDPMYTQITSSFDAQVRSRRNQLDSSMPFEFCYSVSANGDVH-PNVSL  159

Query  467  ILSANQSFVIQNPMFPILNYQGVKC-YCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
                   F + +P+  I N       +CL V+  EG+  LIG+NFM+G ++VFD E + L
Sbjct  160  TAKGGSIFPVNDPIITITNNAFTPIGFCLAVMKSEGV-NLIGENFMSGLKVVFDRERMVL  218

Query  290  GWSASNCKDLDDNDKVPVTPTPGGLSASP-------LPTNEQQRTPNG  168
            GW   NC + D++ ++PV  +P  +   P        P   +   PNG
Sbjct  219  GWKNFNCYNFDESSRLPVNTSPSAVPPKPGLGPSSYTPEAAKGALPNG  266



>gb|KEH20366.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=467

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 97/192 (51%), Gaps = 9/192 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFS+ F    SGRI FGD G  +Q  TPF  L  ++  Y V +    V         
Sbjct  272  ISDSFSMCFGSDGSGRITFGDTGSSDQGKTPF-NLRESHPTYNVTITQIIVGGYAADHE-  329

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSS-----IDV-FHYCYKARSEGLPNI  483
            F A  DSG+SFT L    Y  +  KF+ L+ A R S      D+ F YCY    +    +
Sbjct  330  FHAIFDSGTSFTYLNDPAYTLISEKFNSLVKANRHSPLSPDSDLPFEYCYDMSPDQTIEV  389

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            P + L +     + + +P+ P+ +       CLG+   + +  +IGQNFMTGYR+VFD E
Sbjct  390  PFLNLTMKGGDDYYVTDPIVPVSSEVEGNLLCLGIQKSDNL-NIIGQNFMTGYRIVFDRE  448

Query  302  NLKLGWSASNCK  267
            N+ LGW  SNC+
Sbjct  449  NMNLGWKESNCE  460



>ref|XP_006574660.1| PREDICTED: aspartic proteinase-like protein 1-like [Glycine max]
Length=524

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 105/200 (53%), Gaps = 9/200 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F +   GRI FGD+G  +Q  TPF  L  ++  Y + V    V ++ +    F A
Sbjct  268  SFSMCFGRDGIGRISFGDKGSFDQDETPF-NLNPSHPTYNITVTQVRVGTTVIDVE-FTA  325

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSMKL  468
              DSG+SFT L   TY ++   F   +   R   D    F YCY    +   + IPS+ L
Sbjct  326  LFDSGTSFTYLVDPTYTRLTESFHSQVQDRRHRSDSRIPFEYCYDMSPDANTSLIPSVSL  385

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F + +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L LG
Sbjct  386  TMGGGSHFAVYDPII-IISTQSELVYCLAVVKSAEL-NIIGQNFMTGYRVVFDREKLVLG  443

Query  287  WSASNCKDLDD-NDKVPVTP  231
            W   +C D++D ND +P  P
Sbjct  444  WKKFDCYDIEDHNDAIPTRP  463



>gb|AIU50174.1| aspartyl protease family protein, partial [Solanum tuberosum]
Length=412

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 111/218 (51%), Gaps = 13/218 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYN-KYIVEVEHYCVESSCLKQS  648
            +  SFS+ F    +GRI FGD+G  +Q  TPF     N N  Y + V+   V ++    S
Sbjct  204  MADSFSMCFGSDGAGRISFGDKGSFDQEETPF-----NINPTYNISVDQIRVGTTV--DS  256

Query  647  GFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMK  471
            GF A  D+G+SFT L   +Y K+   F   +   +     F YCY    +   + IPS+ 
Sbjct  257  GFTALFDTGTSFTYLADLSYTKLSESFHSQVRDKQDPRIPFEYCYDMSPDANTSLIPSLS  316

Query  470  LILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKL  291
            L +S      + +P+  +++ Q    YCL ++  + +  +IGQNFMTGYR VFD E + L
Sbjct  317  LTMSGGGQLAVNDPII-VISTQNQLMYCLAIVKSDAL-NIIGQNFMTGYRFVFDREKIIL  374

Query  290  GWSASNCKDLDDNDKVPVTP--TPGGLSASPLPTNEQQ  183
            GW   +C D++  D  P  P  TP  ++  P   N ++
Sbjct  375  GWKKFDCYDIEKIDHFPSQPVNTPPAVAVVPGNDNAER  412



>ref|XP_010029640.1| PREDICTED: aspartic proteinase-like protein 1 [Eucalyptus grandis]
 gb|KCW56586.1| hypothetical protein EUGRSUZ_I02313 [Eucalyptus grandis]
Length=538

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 105/202 (52%), Gaps = 12/202 (6%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FG +G  NQ  TPF+ +  ++  Y + V    V    ++   F 
Sbjct  287  NSFSMCFGHDGIGRISFGGKGSSNQGETPFI-VNQSHPSYNITVTQVIVGEE-IRDLEFS  344

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYK-ARSEGLPNIPSMK  471
            A  DSG+SFT L    Y  +   FD  +   R   D    F YCY  +++  L ++P + 
Sbjct  345  AIFDSGTSFTYLNDPAYTLISKTFDSSVQEKRHLSDSTIPFEYCYNISKNRSLSHVPVLN  404

Query  470  LILSANQSFVIQNP--MFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENL  297
            L +    +F +  P  + P+L   G   YCL V+   G   +IGQNFMTGYR+VFD E +
Sbjct  405  LTMKGGDNFHVTEPVELIPVL---GGYVYCLAVVK-SGNVNIIGQNFMTGYRVVFDRERM  460

Query  296  KLGWSASNCKDLDDNDKVPVTP  231
             LGW  SNC +++D   +PV P
Sbjct  461  VLGWKPSNCYEVNDASMLPVDP  482



>gb|AIU50186.1| aspartyl protease family protein, partial [Cinnamomum camphora]
Length=235

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 98/197 (50%), Gaps = 10/197 (5%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
             SFS+ F     GRI FGDQG  +Q  TPF     N+  Y V V    V +S    + F 
Sbjct  45   DSFSMCFGSDGVGRILFGDQGSPDQAVTPF-----NHPTYNVNVTGLLVGTSI--DTTFS  97

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCY-KARSEGLPNIPSMKLIL  462
            A  D+G+SFT L    YK +   F+      R S   F YCY ++  E    IPS+ L +
Sbjct  98   ALFDTGTSFTYLADPAYKLLSESFNSQARDKRDSRIPFEYCYFRSPVENDSVIPSISLTM  157

Query  461  SANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWS  282
                 F +  P+  I     V  YCL V+    +  +IGQN+MTG R+VFD E L LGW 
Sbjct  158  KGGGLFSVSEPVIVISTRVEV-VYCLAVIKSSSL-NIIGQNYMTGQRIVFDREKLVLGWK  215

Query  281  ASNCKDLDDNDKVPVTP  231
              +C  ++D+  +P+ P
Sbjct  216  KFDCYAMEDSSTLPMNP  232



>gb|KHG06656.1| hypothetical protein F383_03930 [Gossypium arboreum]
Length=515

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 113/224 (50%), Gaps = 12/224 (5%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFR  639
            +SFS+ F     GRI FGD+G  +Q  TPF  L  ++  Y V +    V  +      F 
Sbjct  263  NSFSMCFGPDGVGRITFGDRGSSDQGETPF-NLRQSHPTYNVSITQVNVGGNTADLD-FN  320

Query  638  AQVDSGSSFTLLPYETYKKVVNKFDELMNATR----SSIDVFHYCYKARSEGLP-NIPSM  474
            A  DSG+SFT L    Y  +   F+ L    R    SS   F YCY   +       P +
Sbjct  321  AIFDSGTSFTYLNDPAYTLISENFNNLAIEKRHTSNSSGLPFEYCYDLSANQTNFKYPIV  380

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + +P+  +++ QG   YCLG++  + +  +IGQNFMTGYR+VFD E + 
Sbjct  381  NLTMKGGDYFFVNDPII-VISLQGGDVYCLGIVKSDNV-NIIGQNFMTGYRIVFDRERMV  438

Query  293  LGWSASNCKDLDDNDKVPVTP---TPGGLSASPLPTNEQQRTPN  171
            LGW AS+C D++ ++ +PV P    P  ++ +P  T+      N
Sbjct  439  LGWKASDCYDIEASNTLPVNPPTAVPPAIAVNPEATSGNANNTN  482



>ref|XP_004509401.1| PREDICTED: aspartic proteinase-like protein 1-like [Cicer arietinum]
Length=523

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 88/277 (32%), Positives = 128/277 (46%), Gaps = 33/277 (12%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F +   GRI FGD+G  +Q  TPF  L  ++  Y + V    V ++ +    F A
Sbjct  265  SFSMCFGRDGVGRISFGDKGSIDQDETPF-NLNPSHPTYNITVNQVRVGTTLIDVE-FTA  322

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSMKL  468
              DSG+SFT L   TY ++   F   +   R   D    F YCY    +   + IPSM L
Sbjct  323  LFDSGTSFTYLVDPTYSRLSESFHSQVEDRRRPFDSRIPFEYCYDMSPDANTSVIPSMSL  382

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F + +P+  I++ Q    YCL V+    +  +IGQNFMTGYR+VFD E L LG
Sbjct  383  TMGGGSRFPVYDPII-IISTQSDLVYCLAVVKSAEL-NIIGQNFMTGYRVVFDREKLTLG  440

Query  287  WSASNCKDLDD----------NDKVPVTPTPGGLSASPLPTNEQQRTPNGHavapalagr  138
            W  S+C D++D          +D VP      GL   P P + ++   N    + + +  
Sbjct  441  WKKSDCYDIEDHNNAVSTRRHSDTVP-PAVAVGLGHYPAPDSSKRSKYNSQQSSASPSPL  499

Query  137  apprpsaasPCTIHYQHCTLILILLMLQSFVWLCCLV  27
                          Y H +L+     L S +W+C  V
Sbjct  500  --------------YSHTSLLSFFGSLVSCIWVCLHV  522



>gb|AIU50147.1| aspartyl protease family protein, partial [Aquilegia coerulea]
Length=409

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 115/207 (56%), Gaps = 11/207 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F +   GRI FGD+G  +Q  TPF  +   YN  I ++    V S+   Q  F A
Sbjct  209  SFSMCFGRDGFGRISFGDKGSSDQDETPF-SISPTYNITITQIR---VGSNIDTQ--FSA  262

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKLILS  459
              DSG+SFT +    Y ++   F+      R +   F YCY+  S+   + IPS+ L ++
Sbjct  263  LFDSGTSFTYMVDPVYTQLSESFNLHTQDIRDARLPFEYCYRMSSDANSSLIPSVSLSMN  322

Query  458  ANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWSA  279
                F++ +P+  I++ +    YCL +L    +  +IGQNFMTGY++VFD E L LGW  
Sbjct  323  GGGQFLVYDPII-IISSRDELYYCLAILKSTDL-NIIGQNFMTGYKIVFDREKLVLGWKK  380

Query  278  SNCKDLDDNDKVPVT--PTPGGLSASP  204
             +C +++++D +PV    +P G++A P
Sbjct  381  FDCYNIEESDSMPVNLGNSPPGIAAGP  407



>gb|AIU50164.1| aspartyl protease family protein, partial [Chloranthus japonicus]
Length=413

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 106/207 (51%), Gaps = 11/207 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F +   GRI FGD+G  +Q  TPF  L   YN  +VE+            + F A
Sbjct  208  SFSMCFGRDGIGRISFGDKGSSDQEETPF-NLRPTYNISVVEIR-----VGTTVDTNFSA  261

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCY-KARSEGLPNIPSMKLILS  459
              D+G+SFT L    Y ++   F+   +  R     F YCY  + +E +  IPS+ L + 
Sbjct  262  LFDTGTSFTYLRDPAYTRLSESFNSQAHNNRDPKIPFEYCYYMSSTENISRIPSISLTMK  321

Query  458  ANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWSA  279
                F I +P+  I   +    YCL V+  + +  +IGQNFMTG R+VFD E   LGW  
Sbjct  322  GGGQFSILDPIIVIFT-RVEYVYCLAVVKSQDL-NIIGQNFMTGQRVVFDRERHVLGWKN  379

Query  278  SNCKDLDDNDKVPVTP--TPGGLSASP  204
             NC + +D+  +P+ P  +P  ++A P
Sbjct  380  FNCYNTEDDVSLPIHPRNSPPAVAAEP  406



>gb|AET03732.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=522

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 97/193 (50%), Gaps = 9/193 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFS+ F    SGRI FGD G  +Q  TPF  L  ++  Y V +    V         
Sbjct  272  ISDSFSMCFGSDGSGRITFGDTGSSDQGKTPF-NLRESHPTYNVTITQIIVGGYAADHE-  329

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSS-----IDV-FHYCYKARSEGLPNI  483
            F A  DSG+SFT L    Y  +  KF+ L+ A R S      D+ F YCY    +    +
Sbjct  330  FHAIFDSGTSFTYLNDPAYTLISEKFNSLVKANRHSPLSPDSDLPFEYCYDMSPDQTIEV  389

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            P + L +     + + +P+ P+ +       CLG+   + +  +IGQNFMTGYR+VFD E
Sbjct  390  PFLNLTMKGGDDYYVTDPIVPVSSEVEGNLLCLGIQKSDNL-NIIGQNFMTGYRIVFDRE  448

Query  302  NLKLGWSASNCKD  264
            N+ LGW  SNC +
Sbjct  449  NMNLGWKESNCTE  461



>gb|AIU50156.1| aspartyl protease family protein, partial [Citrus clementina]
Length=403

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 100/196 (51%), Gaps = 9/196 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F     GRI FGD+G   Q+ T F  +  +YN  + ++                A
Sbjct  205  SFSMCFGNDGIGRISFGDKGSPYQQETSF-NVNPSYNITVTQIR-----VGTTIDVDITA  258

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKLILS  459
              DSG+SFT +   TY +++  F   +   R S   F YCY    +   + IPSM L + 
Sbjct  259  LFDSGTSFTYMVEPTYTRLLENFHSQVQDKRDSRIPFEYCYDMSPDANASLIPSMSLRMK  318

Query  458  ANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWSA  279
                F + NP+  +++ QG   YCL V+    +  +IGQNFMTGYR+VFD E L LGW  
Sbjct  319  GGSHFTVYNPII-VISTQGELVYCLAVVKSMEL-NIIGQNFMTGYRVVFDRERLVLGWEK  376

Query  278  SNCKDLDDNDKVPVTP  231
             NC D++D+   PV P
Sbjct  377  FNCYDIEDSYTFPVKP  392



>ref|XP_010531119.1| PREDICTED: aspartic proteinase-like protein 1 [Tarenaya hassleriana]
Length=530

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 102/203 (50%), Gaps = 12/203 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            +  SFS+ F     GRI FGD+G  +Q  TP    PL  NYN  +  V       + L  
Sbjct  269  IADSFSMCFGHDGVGRISFGDRGSSDQEETPLNVNPLHPNYNVTVARVR----VGTSLID  324

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
            + F A  D+G+SFT L    Y +V   F       R   D    F YCY   SE  P+ +
Sbjct  325  AEFTALFDTGTSFTYLVDPMYTRVSASFHSQAQDKRHQPDSRIPFEYCYDMSSEANPSLV  384

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PSM L +     F + +P+  +++ +G   YCL V+    +  +IGQNFMTGY++VF+ E
Sbjct  385  PSMSLTMKGGGHFSVNDPII-VISTEGELIYCLAVVKSSEL-NIIGQNFMTGYQVVFNRE  442

Query  302  NLKLGWSASNCKDLDDNDKVPVT  234
             L LGW   +C D++   K  ++
Sbjct  443  KLILGWKKFDCYDIEKTKKTKLS  465



>gb|KHN00446.1| Aspartic proteinase-like protein 1 [Glycine soja]
Length=512

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 102/200 (51%), Gaps = 8/200 (4%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F +   GRI FGD+G  +Q  TPF  L  ++  Y + V    V ++ +    F A
Sbjct  255  SFSMCFGRDGIGRISFGDKGSFDQDETPF-NLNPSHPTYNITVTQVRVGTTVIDVE-FTA  312

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSMKL  468
              DSG+SFT L   TY ++   F   +   R   D    F YCY    +   + IPS+ L
Sbjct  313  LFDSGTSFTYLVDPTYTRLTESFHSQVQDRRHRSDSRIPFEYCYDMSPDANTSLIPSVSL  372

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F + +P+  I        YCL V+    +  +IGQNFMTGYR+VFD E L LG
Sbjct  373  TMGGGSHFAVYDPIIIISTQVSELVYCLAVVKSAEL-NIIGQNFMTGYRVVFDREKLVLG  431

Query  287  WSASNCKDLDD-NDKVPVTP  231
            W   +C D++D ND +P  P
Sbjct  432  WKKFDCYDIEDHNDAIPTRP  451



>gb|AIU50154.1| aspartyl protease family protein, partial [Acorus calamus]
Length=409

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 108/215 (50%), Gaps = 15/215 (7%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYN-KYIVEVEHYCVESSCLKQS  648
            +  SFS+ F +   GRI FGD+G  +Q  TPF     N N  Y V V    V  +   + 
Sbjct  203  ISDSFSMCFGKDGLGRISFGDKGSSDQGETPF-----NVNPSYNVSVTGLSVGGTVGAK-  256

Query  647  GFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKL  468
             F A VD+G+SFT L    Y  +   F+ L    R S   F YCY + +    +IPS+ L
Sbjct  257  -FDALVDTGTSFTCLADPAYSLLTEDFNALARDERDSKIPFDYCYLSSANKTASIPSISL  315

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F     +  I    GV  YCLGV+    +  +IGQNFMTG R+VFD E L LG
Sbjct  316  SMKGGDVFPATGAIIFIPVNAGV-VYCLGVVKSPNL-NIIGQNFMTGLRIVFDRERLILG  373

Query  287  WSASNCKDLDDNDKVPVTPTPGGLSASPLPTNEQQ  183
            W   NC D++D+  +P+ P     ++ P+P+  Q 
Sbjct  374  WKKFNC-DVEDSSTLPINPR----NSPPVPSVGQN  403



>gb|AIU50185.1| aspartyl protease family protein, partial [Ceratophyllum platyacanthum 
subsp. oryzetorum]
Length=395

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 104/199 (52%), Gaps = 9/199 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F     GRI FGDQG  +Q  TPF  +   YN  + EV  Y   S     + 
Sbjct  190  IADSFSLCFGLDGIGRISFGDQGDTDQNVTPF-EMNPMYNISVNEV--YVAAS---MDTS  243

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSE-GLPNIPSMKL  468
            F A  D+G+SFT L    Y  +   F+  +  +R+S   F YCY   S+  +  IP++ L
Sbjct  244  FSAIFDTGTSFTYLSEPAYTSICESFNSYVQDSRNSRVPFEYCYTIGSDRNISWIPTVSL  303

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F +  P+  I +   +  YCL ++    +  +IGQNFMTG+R+VFD E L LG
Sbjct  304  TMKGGGQFPVNKPIVFISDGSDLM-YCLSIIKSLDV-NIIGQNFMTGHRIVFDREKLILG  361

Query  287  WSASNCKDLDDNDKVPVTP  231
            W   NC D++ ++ +P+ P
Sbjct  362  WKEFNCYDMNGSNTLPIKP  380



>gb|AIU50165.1| aspartyl protease family protein, partial [Ceratophyllum demersum]
Length=411

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 104/199 (52%), Gaps = 9/199 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFSL F     GRI FGDQG  +Q  TPF  +   YN  + EV  Y   S     + 
Sbjct  206  IADSFSLCFGLDGVGRISFGDQGDTDQNVTPF-EMNPMYNISVNEV--YVAAS---MDTS  259

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSE-GLPNIPSMKL  468
            F A  D+G+SFT L    Y  +   F+  +  +R+S   F YCY   S+  +  IP++ L
Sbjct  260  FSAIFDTGTSFTYLSEPAYTSICESFNSYVQDSRNSRVPFEYCYTIGSDRNISWIPTVSL  319

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F +  P+  I +   +  YCL ++    +  +IGQNFMTG+R+VFD E L LG
Sbjct  320  TMKGGGQFPVNKPIVFISDGSDLM-YCLSIIKSLDV-NIIGQNFMTGHRIVFDREKLILG  377

Query  287  WSASNCKDLDDNDKVPVTP  231
            W   NC D++ ++ +P+ P
Sbjct  378  WKEFNCYDMNGSNTLPIKP  396



>gb|AIU50159.1| aspartyl protease family protein, partial [Capsella rubella]
Length=409

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 95/192 (49%), Gaps = 9/192 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V  SFS+ F     GRI FGD+G  +Q  TPF  L  NYN  +  V              
Sbjct  201  VADSFSMCFGHDGVGRISFGDKGSSDQEETPF-NLNPNYNITVTRVR-----VGTTIDDE  254

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKL  468
            F A  D+G+SFT L    Y  V   F       R S   F YCY   +E   + IPS+ L
Sbjct  255  FTALFDTGTSFTYLVDPMYTTVSESFHSQAQDKRDSRIPFEYCYDMSNEANASLIPSLSL  314

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E L L 
Sbjct  315  TMKGNSHFTINDPII-VISTEGELVYCLAIVKSSEL-NIIGQNYMTGYRVVFDREKLVLA  372

Query  287  WSASNCKDLDDN  252
            W   +C D+++ 
Sbjct  373  WKKFDCYDMEET  384



>ref|XP_008806141.1| PREDICTED: aspartic proteinase-like protein 1 [Phoenix dactylifera]
Length=529

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 106/208 (51%), Gaps = 7/208 (3%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F     GRI+FGD+G  +Q  TP L +      Y + +    V +S +    F A
Sbjct  273  SFSMCFGSEGIGRIYFGDKGSSDQEETP-LDVNNRNPVYNISLTGMEVGNSSVDVK-FSA  330

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELM--NATRSSIDV-FHYCYKARSEGLPNI-PSMKL  468
             VDSG+SFT L    Y KV   FD  +  N  +S  D+ F YCY+  S+    + P + L
Sbjct  331  IVDSGTSFTYLADPVYTKVAESFDTQVQDNKHKSDPDIPFEYCYEWSSKQNSTVLPKINL  390

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
                   F I +P+  + N +    YCL ++    +  +IGQNFMTG R+VFD E L LG
Sbjct  391  TTKGGSPFPINDPIVIVSNKKSKLVYCLAIIKSHKL-NIIGQNFMTGLRIVFDRERLILG  449

Query  287  WSASNCKDLDDNDKVPVTPTPGGLSASP  204
            W   +C D++D+  +PV      +  SP
Sbjct  450  WKEFDCFDVEDSSTLPVNKNQSAIPPSP  477



>ref|XP_009149096.1| PREDICTED: aspartic proteinase-like protein 1 [Brassica rapa]
Length=530

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 99/196 (51%), Gaps = 12/196 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F     GRI FGD+G  +Q  TPF   P   NYN  +  V       + L  
Sbjct  270  VADSFSMCFGHDGVGRISFGDKGSSDQEETPFNLNPSHPNYNITVTRVR----VGTTLID  325

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  D+G+SFT L    Y  V   F       R S D    F+YCY   SE   + I
Sbjct  326  DEFTALFDTGTSFTYLVDPMYTSVSESFHSQAQDKRHSPDPRIPFNYCYDMSSEANASLI  385

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PS+ L +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E
Sbjct  386  PSLSLTMKGNSHFTINDPII-VISTEGELVYCLAIVKSSEL-NIIGQNYMTGYRVVFDRE  443

Query  302  NLKLGWSASNCKDLDD  255
             L L W   +C D+++
Sbjct  444  KLVLAWKKFDCYDIEE  459



>gb|AIU50190.1| aspartyl protease family protein, partial [Alisma plantago-aquatica]
Length=411

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 104/208 (50%), Gaps = 10/208 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V  SFS+ F     GRI FGD+G  +Q  TPF P       YIV V    V SS  +   
Sbjct  206  VSDSFSMCFGLDGLGRISFGDKGTSDQDETPFSPSP----TYIVSVTGMQVGSSYTED--  259

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPNIPSMKLI  465
            F A +DSG+SFT L    Y  +   FD  +   R     F  CY   S   P IP + L 
Sbjct  260  FNALIDSGTSFTTLSDPAYTHITQSFDAQVRDKRDPQIPFECCYLISSN-QPEIPVIHLT  318

Query  464  LSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGW  285
            +     F I NP+  I   QG   YCL V+   G + +IGQNFMTG R+VFD E L LGW
Sbjct  319  MKGGSQFPIINPIIFISVKQGEVIYCLAVVK-GGNWNIIGQNFMTGLRVVFDREKLILGW  377

Query  284  SASNCKDLDDNDKVPVTP-TPGGLSASP  204
              +NC ++ D+   PV P  PGG S  P
Sbjct  378  KNANC-EIADSSLFPVNPRNPGGSSTGP  404



>gb|AIU50187.1| aspartyl protease family protein, partial [Platanus x acerifolia]
Length=414

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 106/210 (50%), Gaps = 11/210 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFS+ F +   GRI FGD+G  +Q  TPF  L   YN  ++++            + 
Sbjct  206  IADSFSMCFGRDGIGRISFGDKGSPDQEETPF-NLNPMYNISVIQIRL-----GTSIDTD  259

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKAR-SEGLPNIPSMKL  468
            F A  DSG+SFT L    Y ++   F+      R     F YCY          IPSM L
Sbjct  260  FSALFDSGTSFTYLVDPAYTRLSESFNLQAQDRRDPRIPFEYCYDMSPGANTSMIPSMSL  319

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             + +   F++ +P+  +++ +    YCL V+     + +IGQNFM+GYR+VFD E   LG
Sbjct  320  TMKSGSPFLVYDPII-VISTRAELVYCLAVVKSPD-FNIIGQNFMSGYRIVFDREKFVLG  377

Query  287  WSASNCKDLDDNDKVPVTP--TPGGLSASP  204
            W   NC D++D++  P+ P  +P  ++  P
Sbjct  378  WKKFNCSDVEDSNSFPLRPQNSPPAVAVGP  407



>ref|XP_006425376.1| hypothetical protein CICLE_v10025361mg [Citrus clementina]
 gb|ESR38616.1| hypothetical protein CICLE_v10025361mg [Citrus clementina]
Length=522

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 102/201 (51%), Gaps = 12/201 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F     GRI FGD+G   Q+ T F   P   +YN  + ++       + L     
Sbjct  270  SFSMCFGNDGIGRISFGDKGSPYQQETSFNVNPSHPSYNITVTQIR----VGTTLIDVDI  325

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT +   TY +++  F   +   R   D    F YCY    +   + IPSM
Sbjct  326  TALFDSGTSFTYMVEPTYTRLLENFHSQVQDKRRQHDSRIPFEYCYDMSPDANASLIPSM  385

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + NP+  +++ QG   YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  386  SLRMKGGSHFTVYNPII-VISTQGELVYCLAVVKSMEL-NIIGQNFMTGYRVVFDRERLV  443

Query  293  LGWSASNCKDLDDNDKVPVTP  231
            LGW   NC D++D+   PV P
Sbjct  444  LGWEKFNCYDIEDSYTFPVKP  464



>ref|XP_006467011.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X2 
[Citrus sinensis]
 ref|XP_006467015.1| PREDICTED: aspartic proteinase-like protein 1-like isoform X2 
[Citrus sinensis]
Length=522

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 102/201 (51%), Gaps = 12/201 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F     GRI FGD+G   Q+ T F   P   +YN  + ++       + L     
Sbjct  270  SFSMCFGNDGIGRISFGDKGSPYQQETSFNVNPSHPSYNITVTQIR----VGTTLIDVDI  325

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT +   TY +++  F   +   R   D    F YCY    +   + IPSM
Sbjct  326  TALFDSGTSFTYMVEPTYTRLLENFHSQVQDKRRQHDSRIPFEYCYDMSPDANASLIPSM  385

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +     F + NP+  +++ QG   YCL V+    +  +IGQNFMTGYR+VFD E L 
Sbjct  386  SLRMKGGSHFTVYNPII-VISTQGELVYCLAVVKSMEL-NIIGQNFMTGYRVVFDRERLV  443

Query  293  LGWSASNCKDLDDNDKVPVTP  231
            LGW   NC D++D+   PV P
Sbjct  444  LGWEKFNCYDIEDSYTFPVKP  464



>gb|AIU50158.1| aspartyl protease family protein, partial [Carica papaya]
Length=415

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 100/199 (50%), Gaps = 9/199 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
             P SFS+ F     GRI FGD+G  +Q  TPF  L   YN  I ++    V +S      
Sbjct  206  TPDSFSMCFGSDGVGRISFGDKGSPDQEETPF-NLNPAYNISITQIR---VGTSI--DVD  259

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEG-LPNIPSMKL  468
              A  DSG+SFT L    Y ++   F+     TR S   F YCY    E  +  +PSM L
Sbjct  260  LTALFDSGTSFTYLVDPAYTRLSESFNSQARNTRDSRLPFEYCYDMSPEANVSLVPSMSL  319

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F + +P+  +++ Q    YCL V+    +  +IGQNFMTGYR+VFD E   LG
Sbjct  320  TMKGGSYFTVYDPII-VISTQSELVYCLAVVKSTEM-NIIGQNFMTGYRVVFDREKFILG  377

Query  287  WSASNCKDLDDNDKVPVTP  231
            W   +C D++++    V P
Sbjct  378  WKKFDCYDIENSTSFQVEP  396



>gb|KHG24810.1| hypothetical protein F383_07826 [Gossypium arboreum]
Length=487

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 102/193 (53%), Gaps = 8/193 (4%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F    +GRI FGD+G  +Q  TPF  L  ++  Y V V    V ++ L + GF A
Sbjct  234  SFSMCFGDDGTGRISFGDKGSPDQEETPF-NLNPSHPTYNVTVTQIRVGTT-LTEGGFTA  291

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSMKL  468
              DSG+SFT L   TY  +   F      +R   D    F YCY    +   + IPSM L
Sbjct  292  LFDSGTSFTYLVDPTYSNLAVNFHSQTRDSRRPPDSRIPFEYCYDMSPDANASLIPSMSL  351

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F++ +P+  +++ Q    YCL V+    +  +IGQNFMTGYR+VFD E   LG
Sbjct  352  TMKGGSHFLVYDPII-VISTQSKLVYCLAVVKSTEL-NIIGQNFMTGYRVVFDRERFVLG  409

Query  287  WSASNCKDLDDND  249
            W   +C D+++ +
Sbjct  410  WKKFDCYDIEETN  422



>gb|AIU50150.1| aspartyl protease family protein, partial [Arabidopsis thaliana]
Length=414

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 96/193 (50%), Gaps = 9/193 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V  SFS+ F     GRI FGD+G  +Q  TPF  L  NYN  +  V              
Sbjct  206  VADSFSMCFGHDGVGRISFGDKGSSDQEETPF-NLNPNYNITVTRVR-----VGTTIDDE  259

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKL  468
            F A  D+G+SFT L    Y  V   F       R S   F YCY   ++   + IPS+ L
Sbjct  260  FTALFDTGTSFTYLVDPMYTTVSESFHSQAQDKRDSRIPFEYCYDMSNDANASLIPSLSL  319

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E L L 
Sbjct  320  TMKGNSHFTINDPII-VISTEGELVYCLAIVKSSEL-NIIGQNYMTGYRVVFDREKLVLA  377

Query  287  WSASNCKDLDDND  249
            W   +C D+++ +
Sbjct  378  WKKFDCYDIEETN  390



>gb|AIU50151.1| aspartyl protease family protein, partial [Lilium brownii]
Length=412

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 106/211 (50%), Gaps = 13/211 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            + +SFS+ F     GRI FGDQG  +Q  TPF  L+  YN   + V    V +S    + 
Sbjct  204  ISNSFSMCFGSDGVGRISFGDQGSSDQEQTPF-NLKSTYN---ISVTGVAVGNSI--TAD  257

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKL  468
            F A VDSG+SFT L    Y  +   F+  +   R     F YCY   S  +   +P + L
Sbjct  258  FSALVDSGTSFTYLADPAYTFISQSFNARVKDKRDPNIPFEYCYHISSNNISRQLPDISL  317

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
                   F + +P+  +   Q    YCL ++    +  +IGQNFMTG R+VFD E + LG
Sbjct  318  TTKGGGQFPVSDPIVLLTTQQRENVYCLALVKSSNL-NIIGQNFMTGLRIVFDRERMVLG  376

Query  287  WSASNCKDLDDNDKVPVTPTPGGLSASPLPT  195
            W   NC D+++++ +PV P     + SP PT
Sbjct  377  WKKFNC-DVEESNPLPVNPR----NPSPSPT  402



>gb|AIU50149.1| aspartyl protease family protein, partial [Arabidopsis lyrata]
Length=414

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 96/193 (50%), Gaps = 9/193 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            V  SFS+ F     GRI FGD+G  +Q  TPF  L  NYN  +  V              
Sbjct  206  VADSFSMCFGHDGVGRISFGDKGSSDQEETPF-NLNPNYNITVTRVR-----VGTTIDDE  259

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKL  468
            F A  D+G+SFT L    Y  V   F       R S   F YCY   ++   + IPS+ L
Sbjct  260  FTALFDTGTSFTYLVDPMYTTVSESFHSQAQDKRDSRIPFEYCYDMSNDANASLIPSLSL  319

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E L L 
Sbjct  320  TMKGNSHFTINDPII-VISTEGELVYCLAIVKSSEL-NIIGQNYMTGYRVVFDREKLVLA  377

Query  287  WSASNCKDLDDND  249
            W   +C D+++ +
Sbjct  378  WKKFDCYDIEETN  390



>emb|CDX75536.1| BnaA01g01660D [Brassica napus]
Length=529

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 99/197 (50%), Gaps = 12/197 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F     GRI FGD+G  +Q  TPF   P   NYN  +  V       + L  
Sbjct  270  VADSFSMCFGHDGVGRISFGDKGSSDQEETPFNLNPSHPNYNITVTRVR----VGTTLID  325

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  D+G+SFT L    Y  V   F       R S D    F+YCY   S+   + I
Sbjct  326  DEFTALFDTGTSFTYLVDPMYTSVSESFHSQAQDKRHSPDPRIPFNYCYDMSSDANASLI  385

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PS+ L +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E
Sbjct  386  PSLSLTMKGNSHFTINDPII-VISTEGELVYCLAIVKSSEL-NIIGQNYMTGYRVVFDRE  443

Query  302  NLKLGWSASNCKDLDDN  252
             L L W   +C D+++ 
Sbjct  444  KLVLAWKKFDCYDIEET  460



>emb|CDX69179.1| BnaC01g02740D [Brassica napus]
Length=531

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 99/197 (50%), Gaps = 12/197 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F     GRI FGD+G  +Q  TPF   P   NYN  +  V       + L  
Sbjct  271  VADSFSMCFGHDGVGRISFGDKGSSDQEETPFNLNPSHPNYNITVTRVR----VGTTLID  326

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  D+G+SFT L    Y  V   F       R S D    F+YCY   S+   + I
Sbjct  327  DEFTALFDTGTSFTYLVDPMYTSVSESFHSQAQDKRHSPDPRIPFNYCYDMSSDANASLI  386

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PS+ L +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E
Sbjct  387  PSLSLTMKGNSHFTINDPII-VISTEGELVYCLAIVKSSEL-NIIGQNYMTGYRVVFDRE  444

Query  302  NLKLGWSASNCKDLDDN  252
             L L W   +C D+++ 
Sbjct  445  KLVLAWKKFDCYDIEET  461



>gb|AIU50162.1| aspartyl protease family protein, partial [Buxus sinica]
Length=414

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 106/210 (50%), Gaps = 11/210 (5%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +  SFS+ F +   GRI FGD+G  +Q  TPF P    YN  I ++    V  S     G
Sbjct  206  IEDSFSMCFGRDGVGRISFGDKGSPDQEETPFNP-NSTYNITITQIR---VGKSIDTDLG  261

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKL  468
              A  DSG+SFT L    Y ++ + F+      R     F YCY    +   + +P M L
Sbjct  262  --ALFDSGTSFTYLVDPAYSRLSDSFNLQAQDKRDPRIPFEYCYDMSPDANSSLVPGMSL  319

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     FV+ +P+  +++ Q    YCL V+  + +  +IGQNFMTGY +VFD E   LG
Sbjct  320  TMKGGSPFVVHDPVI-VISTQTEFIYCLAVVKSKEL-NIIGQNFMTGYNIVFDREKHVLG  377

Query  287  WSASNCKDLDDNDKVPVTP--TPGGLSASP  204
            W   NC D+ D++  P+ P  +P  ++  P
Sbjct  378  WKKLNCSDIKDSNSFPLRPRNSPPAVAVGP  407



>ref|XP_010266874.1| PREDICTED: aspartic proteinase-like protein 1 [Nelumbo nucifera]
Length=528

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 101/199 (51%), Gaps = 8/199 (4%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F     GRI FGD+G  +Q  TPF  ++  +  Y + +    V +S +  +   A
Sbjct  269  SFSMCFGSDGIGRISFGDKGSSDQEETPF-NIDQLHPMYNISITQMRVGTSII-DTNLSA  326

Query  635  QVDSGSSFTLLPYETYKKVVNKFD---ELMNATRSSIDVFHYCYKARSEGLPN-IPSMKL  468
              DSG+SFT L    Y ++   F+   +           F YCY  R     + IPSM L
Sbjct  327  LFDSGTSFTYLVDPAYTRLTESFNLQAQDRRRPPDPRIPFEYCYNMRPGANSSLIPSMSL  386

Query  467  ILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLG  288
             +     F + +P+  +++ Q    YCL V+   G   +IGQNFMTGYR+VFD E L LG
Sbjct  387  TMRGGSQFPVYDPII-VISTQAELVYCLAVVK-SGELSIIGQNFMTGYRIVFDREKLVLG  444

Query  287  WSASNCKDLDDNDKVPVTP  231
            W   +C D +D++  P+ P
Sbjct  445  WKKFDCYDTEDSNTFPLKP  463



>gb|AIU50157.1| aspartyl protease family protein, partial [Gossypium raimondii]
Length=411

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 96/190 (51%), Gaps = 9/190 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F    +GRI FGD+G  +Q  TPF  L   YN  + ++             GF A
Sbjct  209  SFSMCFGDDGTGRISFGDKGSPDQEETPF-NLNPTYNVTVTQIR-----VGTTIDGGFTA  262

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKARSEGLPN-IPSMKLILS  459
              DSG+SFT L   TY  +   F      +R S   F YCY    +   + IPSM L + 
Sbjct  263  LFDSGTSFTYLVDPTYSNLAVNFHSQTRDSRDSRIPFEYCYDMSPDANASLIPSMSLTMK  322

Query  458  ANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWSA  279
                F + +P+  +++ Q    YCL V+    +  +IGQNFMTGYR+VFD E   LGW  
Sbjct  323  GGSHFPVYDPII-VISTQSKLVYCLAVIKSTEL-NIIGQNFMTGYRVVFDRERFVLGWKK  380

Query  278  SNCKDLDDND  249
             +C D+++ +
Sbjct  381  FDCYDIEETN  390



>ref|XP_011043127.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Populus 
euphratica]
Length=532

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 111/219 (51%), Gaps = 14/219 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPF---LPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            SFS+ F     GRI FGD+G   Q  T F    P    YN  I +       S  +    
Sbjct  286  SFSMCFSPDGIGRISFGDKGSTGQGETSFNQGQPRSSLYNISITQTSIGGQASDLV----  341

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR-SSIDV-FHYCYK-ARSEGLPNIPSM  474
            + A  DSG+SFT L    Y  +   F+ ++  TR SS +V F YCY  + ++    IP++
Sbjct  342  YSAIFDSGTSFTYLNDPAYTLIAESFNNMVKETRHSSTEVPFDYCYDISANQTELTIPAV  401

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L++S    F + +P+  +    G   YCLG++   G   +IGQNFMTG+R+VFD E + 
Sbjct  402  NLVMSGGDYFNVTDPIVVVQLADGSAVYCLGMIK-SGDVNIIGQNFMTGHRIVFDRERMI  460

Query  293  LGWSASNCKDLDDNDKVPVTP---TPGGLSASPLPTNEQ  186
            LGW  S+C D  D + + V+P    P   + +P  T+ Q
Sbjct  461  LGWKPSSCYDNMDTNTLAVSPNTAVPPATAVNPEATSTQ  499



>ref|XP_011043126.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Populus 
euphratica]
Length=532

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 111/219 (51%), Gaps = 14/219 (6%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPF---LPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            SFS+ F     GRI FGD+G   Q  T F    P    YN  I +       S  +    
Sbjct  286  SFSMCFSPDGIGRISFGDKGSTGQGETSFNQGQPRSSLYNISITQTSIGGQASDLV----  341

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR-SSIDV-FHYCYK-ARSEGLPNIPSM  474
            + A  DSG+SFT L    Y  +   F+ ++  TR SS +V F YCY  + ++    IP++
Sbjct  342  YSAIFDSGTSFTYLNDPAYTLIAESFNNMVKETRHSSTEVPFDYCYDISANQTELTIPAV  401

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L++S    F + +P+  +    G   YCLG++   G   +IGQNFMTG+R+VFD E + 
Sbjct  402  NLVMSGGDYFNVTDPIVVVQLADGSAVYCLGMIK-SGDVNIIGQNFMTGHRIVFDRERMI  460

Query  293  LGWSASNCKDLDDNDKVPVTP---TPGGLSASPLPTNEQ  186
            LGW  S+C D  D + + V+P    P   + +P  T+ Q
Sbjct  461  LGWKPSSCYDNMDTNTLAVSPNTAVPPATAVNPEATSTQ  499



>ref|XP_007203645.1| hypothetical protein PRUPE_ppa004265mg [Prunus persica]
 gb|EMJ04844.1| hypothetical protein PRUPE_ppa004265mg [Prunus persica]
Length=519

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 102/200 (51%), Gaps = 12/200 (6%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGN-YNKYIVEVEHYCVESSCLKQSGF  642
            +SFS+ F    SGRI FGD G  +Q  TPF    G  Y  Y + +    +  S +    F
Sbjct  273  NSFSMCFGLDGSGRISFGDNGSLDQAETPFNLKNGRAYPTYNITITQLAIGES-VTDLEF  331

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPNIPSMK  471
             A  DSG+SFT L    Y ++   F+  +   + S D    F YCY       PN  ++ 
Sbjct  332  YAIFDSGTSFTYLNDPAYTQITENFNSALKNKQRSKDSSIPFEYCYDIS----PN-QTVN  386

Query  470  LILSANQSFVIQNPMFPILNYQGV-KCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
            L L   + + + +P+    N  G    YCLG++   G   +IGQNFMTGYR++FD E + 
Sbjct  387  LTLKGGKQYPLLDPLVVFANEDGTPMLYCLGIVK-SGDVNIIGQNFMTGYRVIFDRERMV  445

Query  293  LGWSASNCKDLDDNDKVPVT  234
            LGW  SNC +++D   +PVT
Sbjct  446  LGWKESNCYNVEDTVTLPVT  465



>ref|XP_011011846.1| PREDICTED: aspartic proteinase-like protein 1 isoform X1 [Populus 
euphratica]
Length=514

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 101/204 (50%), Gaps = 12/204 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPF--LPLEGNYNKYIVEVEHYCVESSCLKQ  651
            +  SFS+ F     GRI FGD+G  +Q  TPF   P    YN  + +        + L  
Sbjct  259  IADSFSMCFGHDGIGRISFGDKGSPDQEETPFNIDPAHPTYNVTVTQAR----VGTMLID  314

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  DSG+SFT +    Y +V  KF  L        D    F YCY    +   + +
Sbjct  315  VEFTALFDSGTSFTYMVDPAYSRVSEKFHSLARDKWRPPDPRIPFEYCYDMSPDANASLV  374

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PSM L +   + F + +P+  +++ Q    YCL ++    +  +IGQNFMTGYR+VFD E
Sbjct  375  PSMSLTMKGGRHFTVYDPII-VISTQNEIVYCLAIVKSTEL-NIIGQNFMTGYRVVFDRE  432

Query  302  NLKLGWSASNCKDLDDNDKVPVTP  231
             L LGW   +C D++D +  P+ P
Sbjct  433  KLVLGWKKFDCYDVEDYNNFPLQP  456



>ref|XP_002869053.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45312.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=522

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 99/198 (50%), Gaps = 12/198 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F     GRI FGD+G  +Q  TPF   P   NYN  +  V       + L  
Sbjct  265  VADSFSMCFGHDGVGRISFGDKGSSDQEETPFNLNPSHPNYNITVTRVR----VGTTLID  320

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  D+G+SFT L    Y  V   F       R S D    F YCY   ++   + I
Sbjct  321  DEFTALFDTGTSFTYLVDPMYTTVSESFHSQAQDKRHSPDSRIPFEYCYDMSNDANASLI  380

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PS+ L +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E
Sbjct  381  PSLSLTMKGNSHFTINDPII-VISTEGELVYCLAIVKSSEL-NIIGQNYMTGYRVVFDRE  438

Query  302  NLKLGWSASNCKDLDDND  249
             L L W   +C D+++ +
Sbjct  439  KLVLAWKKFDCYDIEETN  456



>ref|XP_011011847.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Populus 
euphratica]
Length=513

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 101/204 (50%), Gaps = 12/204 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPF--LPLEGNYNKYIVEVEHYCVESSCLKQ  651
            +  SFS+ F     GRI FGD+G  +Q  TPF   P    YN  + +        + L  
Sbjct  258  IADSFSMCFGHDGIGRISFGDKGSPDQEETPFNIDPAHPTYNVTVTQAR----VGTMLID  313

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  DSG+SFT +    Y +V  KF  L        D    F YCY    +   + +
Sbjct  314  VEFTALFDSGTSFTYMVDPAYSRVSEKFHSLARDKWRPPDPRIPFEYCYDMSPDANASLV  373

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PSM L +   + F + +P+  +++ Q    YCL ++    +  +IGQNFMTGYR+VFD E
Sbjct  374  PSMSLTMKGGRHFTVYDPII-VISTQNEIVYCLAIVKSTEL-NIIGQNFMTGYRVVFDRE  431

Query  302  NLKLGWSASNCKDLDDNDKVPVTP  231
             L LGW   +C D++D +  P+ P
Sbjct  432  KLVLGWKKFDCYDVEDYNNFPLQP  455



>ref|NP_195313.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|ACE79041.1| At4g35880 [Arabidopsis thaliana]
 dbj|BAH19546.1| AT4G35880 [Arabidopsis thaliana]
 gb|AEE86584.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=524

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 99/198 (50%), Gaps = 12/198 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F     GRI FGD+G  +Q  TPF   P   NYN  +  V       + L  
Sbjct  267  VADSFSMCFGHDGVGRISFGDKGSSDQEETPFNLNPSHPNYNITVTRVR----VGTTLID  322

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  D+G+SFT L    Y  V   F       R S D    F YCY   ++   + I
Sbjct  323  DEFTALFDTGTSFTYLVDPMYTTVSESFHSQAQDKRHSPDSRIPFEYCYDMSNDANASLI  382

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PS+ L +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E
Sbjct  383  PSLSLTMKGNSHFTINDPII-VISTEGELVYCLAIVKSSEL-NIIGQNYMTGYRVVFDRE  440

Query  302  NLKLGWSASNCKDLDDND  249
             L L W   +C D+++ +
Sbjct  441  KLVLAWKKFDCYDIEETN  458



>ref|XP_010437405.1| PREDICTED: aspartic proteinase-like protein 1 [Camelina sativa]
Length=523

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 99/197 (50%), Gaps = 12/197 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F     GRI FGD+G  +Q  TPF   P   NYN  +  V       + L  
Sbjct  266  VADSFSMCFGHDGVGRISFGDKGSSDQEETPFNLNPSHPNYNITVTRVR----VGTTLID  321

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  D+G+SFT L    Y  V   F    +  R S D    F YCY   +E   + I
Sbjct  322  DEFTALFDTGTSFTYLVDPMYTTVSESFHSQAHDKRHSPDSRIPFEYCYDMSNEANASLI  381

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PS+ L +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E
Sbjct  382  PSLSLTMKGNSHFTINDPII-VISTEGELVYCLAIVKSFEL-NIIGQNYMTGYRVVFDRE  439

Query  302  NLKLGWSASNCKDLDDN  252
             L L W   +C D+++ 
Sbjct  440  KLVLAWKKFDCYDVEET  456



>ref|XP_010446864.1| PREDICTED: aspartic proteinase-like protein 1 [Camelina sativa]
Length=523

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 100/198 (51%), Gaps = 12/198 (6%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQ  651
            V  SFS+ F     GRI FGD+G  +Q  TPF   P   NYN  +  V       + L  
Sbjct  266  VADSFSMCFGHDGVGRISFGDKGSSDQEETPFNLNPSHPNYNITVTRVR----VGTTLID  321

Query  650  SGFRAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-I  483
              F A  D+G+SFT L    Y  V   F    +  R S D    F YCY   +E   + I
Sbjct  322  DEFTALFDTGTSFTYLVDPMYTTVSESFHSQAHDKRHSPDSRIPFEYCYDMSNEANASLI  381

Query  482  PSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWE  303
            PS+ L +  N  F I +P+  +++ +G   YCL ++    +  +IGQN+MTGYR+VFD E
Sbjct  382  PSLSLTMKGNSHFTINDPII-VISTEGELVYCLAIVKSFEL-NIIGQNYMTGYRVVFDRE  439

Query  302  NLKLGWSASNCKDLDDND  249
             L L W   +C D+++ +
Sbjct  440  KLVLAWKKFDCYDVEETN  457



>gb|KJB17586.1| hypothetical protein B456_003G006500 [Gossypium raimondii]
Length=518

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 111/207 (54%), Gaps = 20/207 (10%)
 Frame = -2

Query  818  HSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEG--NYNKYIVEVEHYCVESSCLKQSG  645
            +SFS+ F     GRI FGD+G  +Q  TP  P +    YN  I ++       S   ++G
Sbjct  264  NSFSMCFRSDGIGRITFGDKGSSDQGETPINPRQSRPTYNISITQI-------SVGGKTG  316

Query  644  ---FRAQVDSGSSFTLLPYETYKKVVNKFDELM----NATRSSIDV-FHYCYK-ARSEGL  492
               F A  DSG+SFT L    Y  +   F+ L     + ++S+ D+ F YCY  + ++  
Sbjct  317  DLEFDAVFDSGTSFTYLNDPAYTLISETFNNLALDKRHTSKSTDDLPFEYCYDLSANQTS  376

Query  491  PNIPSMKLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVF  312
               P + L +      ++ +P+  +L  QG   YCL V+  + +  +IGQNFMTGYR+VF
Sbjct  377  LKYPVVNLTMKGGDQLLVNDPI-AVLPMQGGAIYCLAVVKSDSV-NIIGQNFMTGYRIVF  434

Query  311  DWENLKLGWSASNCKDLDDNDKVPVTP  231
            D E + LGW AS+C +++ ++ +PV P
Sbjct  435  DREKMVLGWKASDCYNIESSNTLPVIP  461



>gb|AIU50183.1| aspartyl protease family protein, partial [Vitis vinifera]
Length=413

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 96/196 (49%), Gaps = 10/196 (5%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSGFRA  636
            SFS+ F     GRI FGD+G  +Q  TPF  L   YN  + +V              F A
Sbjct  209  SFSMCFGPDGIGRISFGDKGSPDQEETPF-NLNPTYNITVTQVR-----VGTTIDLDFTA  262

Query  635  QVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDVFHYCYKAR-SEGLPNIPSMKLILS  459
              DSG+SFT L    Y  V+  F      +R S   F +CY     E    IPSM L + 
Sbjct  263  LFDSGTSFTYLVDPIYTNVLKSFHSQAQDSRDSRIPFEFCYDMSPGENTSLIPSMSLTMK  322

Query  458  ANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLKLGWSA  279
                F + +P+  I++ Q    YC+ V+    +  +IGQNFMTGYR++FD E L LGW  
Sbjct  323  GGSQFPVYDPII-IISSQSELIYCMAVVRSAEL-NIIGQNFMTGYRIIFDREKLVLGWKE  380

Query  278  SNCKDLDDNDKVPVTP  231
              C D+ +N  VP+ P
Sbjct  381  FECDDI-ENSSVPIRP  395



>ref|XP_009605165.1| PREDICTED: aspartic proteinase-like protein 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=515

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 109/215 (51%), Gaps = 17/215 (8%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F    +GRI FGD+G  +Q  TPF   PL   YN   + V+   V ++ +  SGF
Sbjct  262  SFSMCFGHDGAGRISFGDKGSFDQEETPFNINPLHPTYN---ISVDQIRVGTTHI-DSGF  317

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  D+G+SFT L   +Y K+   F   +   R   D    F YCY    +   + IPS+
Sbjct  318  TALFDTGTSFTYLADLSYTKLTESFHSQVLDKRRPPDPRIPFEYCYDMSPDANTSLIPSL  377

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L +      V+ +P+  +++ QG   YCL V+  + +  +IGQNFMTGYR VFD E   
Sbjct  378  SLTIEGGGQLVVYDPII-VISMQGQLVYCLAVVKSQDL-NIIGQNFMTGYRFVFDREKAI  435

Query  293  LGWSASNCKDLDDNDKVP-----VTPTPGGLSASP  204
            LGW   +C +++  D  P      T  P  ++  P
Sbjct  436  LGWKKFDCYEIEKIDHFPSEAVNTTRVPPAVAVGP  470



>emb|CDP01850.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 109/227 (48%), Gaps = 22/227 (10%)
 Frame = -2

Query  815  SFSLXFDQSHSGRIFFGDQGPGNQRFTPFL--PLEGNYNKYIVEVEHYCVESSCLKQSGF  642
            SFS+ F    +GRI FGD+G  +Q  TPF   PL   YN  +V++       + L  S F
Sbjct  266  SFSMCFGHDGTGRINFGDKGSLDQEETPFNVNPLHPTYNISVVQIR----VGTALIDSEF  321

Query  641  RAQVDSGSSFTLLPYETYKKVVNKFDELMNATRSSIDV---FHYCYKARSEGLPN-IPSM  474
             A  DSG+SFT L    Y  ++  F       R   D    F YCY    +   + IP++
Sbjct  322  TALFDSGTSFTYLVDPAYSMILENFHLQAQDKRHLPDARIPFEYCYDMSPDANTSLIPTI  381

Query  473  KLILSANQSFVIQNPMFPILNYQGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVFDWENLK  294
             L L     +V+ +P+  +++ Q    YCL V+  +  + +IGQNFMTGYR+VFD E L 
Sbjct  382  SLTLKGGGQYVVYDPII-VISTQHQLIYCLAVVKSQD-FNIIGQNFMTGYRVVFDREKLV  439

Query  293  LGWSASNCKDLDDNDKVPVTP---------TPGGLSASPLPTNEQQR  180
            LGW   +C D D  +     P            G+     P++E+ R
Sbjct  440  LGWKKFDCYD-DVEESTAAIPRNSSSVPPAVAAGVGTKSKPSSEENR  485



>gb|KDO71327.1| hypothetical protein CISIN_1g010129mg [Citrus sinensis]
Length=320

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 108/207 (52%), Gaps = 16/207 (8%)
 Frame = -2

Query  824  VPHSFSLXFDQSHSGRIFFGDQGPGNQRFTPFLPLEGNYNKYIVEVEHYCVESSCLKQSG  645
            +P+SFS+ F    +GRI FGD+G   Q  TPF  L   +  Y + +    V  + +    
Sbjct  68   IPNSFSMCFGSDGTGRISFGDKGSPGQGETPF-SLRQTHPTYNITITQVSVGGNAVNFE-  125

Query  644  FRAQVDSGSSFTLLPYETYKKVVNKFDELMNATR--SSIDV-FHYCYKARSEGLPN----  486
            F A  DSG+SFT L    Y ++   F+ L    R  S+ D+ F YCY       PN    
Sbjct  126  FSAIFDSGTSFTYLNDPAYTQISETFNSLAKEKRETSTSDLPFEYCYVLS----PNQTNF  181

Query  485  -IPSMKLILSANQSFVIQNPMFPILNY-QGVKCYCLGVLPIEGIYGLIGQNFMTGYRMVF  312
              P + L +     F + +P+  + +  +G+  YCLGV+  + +  +IGQNFMTGY +VF
Sbjct  182  EYPVVNLTMKGGGPFFVNDPIVIVSSEPKGLYLYCLGVVKSDNV-NIIGQNFMTGYNIVF  240

Query  311  DWENLKLGWSASNCKDLDDNDKVPVTP  231
            D E   LGW AS+C  ++++  +P+ P
Sbjct  241  DREKNVLGWKASDCYGVNNSSALPIPP  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1765995469312