BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1435

Length=889
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABN49455.1|  photosystem I chlorophyll a/b binding protein         90.9    1e-18   Pisum sativum [garden pea]
gb|ABX71549.1|  chloroplast chlorophyll a/b binding protein           89.4    3e-18   Helianthus annuus
gb|AEX12937.1|  hypothetical protein CL1595Contig1_02                 87.0    3e-18   Pinus taeda
gb|AAP69815.1|  chlorophyll a/b-binding protein                       88.2    3e-18   Vitis vinifera
sp|Q9SQL2.1|CB24_PEA  RecName: Full=Chlorophyll a-b binding prote...  90.9    5e-18   Pisum sativum [garden pea]
emb|CAA57877.1|  light-harvesting chlorophyll a /b binding protein    90.1    6e-18   Nicotiana tabacum [American tobacco]
ref|XP_009773617.1|  PREDICTED: chlorophyll a-b binding protein P...  90.9    6e-18   Nicotiana sylvestris
ref|XP_010678492.1|  PREDICTED: chlorophyll a-b binding protein 4...  90.5    7e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK37078.1|  unknown                                               90.5    7e-18   Lotus japonicus
pdb|2O01|4  Chain 4, The Structure Of A Plant Photosystem I Super...  89.0    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374556.1|  PREDICTED: chlorophyll a-b binding protein P...  90.5    8e-18   Malus domestica [apple tree]
ref|XP_007209497.1|  hypothetical protein PRUPE_ppa010291mg           90.5    8e-18   Prunus persica
ref|XP_009369279.1|  PREDICTED: chlorophyll a-b binding protein P...  90.5    9e-18   
ref|XP_010258312.1|  PREDICTED: chlorophyll a-b binding protein 4...  90.1    9e-18   Nelumbo nucifera [Indian lotus]
gb|KEH33314.1|  light-harvesting complex I chlorophyll A/B-bindin...  89.4    9e-18   Medicago truncatula
ref|XP_011087238.1|  PREDICTED: chlorophyll a-b binding protein 4...  90.1    9e-18   Sesamum indicum [beniseed]
ref|XP_004138171.1|  PREDICTED: chlorophyll a-b binding protein P...  90.1    1e-17   Cucumis sativus [cucumbers]
ref|XP_004513901.1|  PREDICTED: chlorophyll a-b binding protein P...  90.1    1e-17   Cicer arietinum [garbanzo]
gb|ACJ85068.1|  unknown                                               90.1    1e-17   Medicago truncatula
ref|XP_008453211.1|  PREDICTED: chlorophyll a-b binding protein P...  90.1    1e-17   Cucumis melo [Oriental melon]
gb|ACB05669.1|  chloroplast chlorophyll a/b binding protein           90.1    1e-17   Capsicum annuum
ref|XP_010257811.1|  PREDICTED: chlorophyll a-b binding protein 4...  90.1    1e-17   Nelumbo nucifera [Indian lotus]
emb|CAA78932.1|  Lhca4 protein,Type 4 protein of light-harvesting...  89.7    1e-17   Pinus sylvestris [Scotch pine]
ref|XP_004236014.1|  PREDICTED: chlorophyll a-b binding protein 4...  90.1    1e-17   
emb|CAC84491.1|  putative chlorophyll a/b-binding protein type 4      89.7    1e-17   Pinus pinaster [cluster pine]
emb|CBI15210.3|  unnamed protein product                              89.7    1e-17   Vitis vinifera
ref|XP_002284856.1|  PREDICTED: chlorophyll a-b binding protein 4...  89.7    1e-17   Vitis vinifera
emb|CAA78901.1|  Lhca4 protein,Type 4 protein of light-harvesting...  89.7    1e-17   Pinus sylvestris [Scotch pine]
ref|XP_009339094.1|  PREDICTED: chlorophyll a-b binding protein P...  89.7    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_008393169.1|  PREDICTED: chlorophyll a-b binding protein P...  89.7    2e-17   
ref|XP_004299348.1|  PREDICTED: chlorophyll a-b binding protein P...  89.4    2e-17   Fragaria vesca subsp. vesca
ref|XP_009587071.1|  PREDICTED: chlorophyll a-b binding protein P...  89.4    2e-17   Nicotiana tomentosiformis
ref|XP_010093602.1|  Chlorophyll a-b binding protein P4               89.0    2e-17   Morus notabilis
ref|XP_009804068.1|  PREDICTED: chlorophyll a-b binding protein 4...  89.0    2e-17   Nicotiana sylvestris
gb|ABR25329.1|  chloroplast chlorophyll a-b binding proteinr          85.5    2e-17   Oryza sativa Indica Group [Indian rice]
ref|WP_039310946.1|  hypothetical protein                             88.2    2e-17   
ref|XP_009618704.1|  PREDICTED: chlorophyll a-b binding protein P...  89.0    3e-17   Nicotiana tomentosiformis
gb|AAG40364.1|AF325012_1  AT3g47470                                   86.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006477466.1|  PREDICTED: chlorophyll a-b binding protein P...  88.6    3e-17   Citrus sinensis [apfelsine]
gb|KDO55546.1|  hypothetical protein CISIN_1g025674mg                 88.6    3e-17   Citrus sinensis [apfelsine]
ref|XP_006374459.1|  hypothetical protein POPTR_0015s07340g           86.7    3e-17   
ref|XP_006440616.1|  hypothetical protein CICLE_v10021861mg           88.6    3e-17   Citrus clementina [clementine]
ref|XP_010515052.1|  PREDICTED: chlorophyll a-b binding protein 4...  88.6    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_012080280.1|  PREDICTED: chlorophyll a-b binding protein P...  88.6    4e-17   Jatropha curcas
ref|XP_002877563.1|  chlorophyll a/b-binding protein                  88.2    4e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_006404376.1|  hypothetical protein EUTSA_v10010659mg           88.2    4e-17   Eutrema salsugineum [saltwater cress]
gb|ACF84895.1|  unknown                                               86.3    4e-17   Zea mays [maize]
ref|XP_008783815.1|  PREDICTED: chlorophyll a-b binding protein 4...  88.2    5e-17   Phoenix dactylifera
ref|XP_006354774.1|  PREDICTED: chlorophyll a-b binding protein 4...  88.2    5e-17   Solanum tuberosum [potatoes]
ref|XP_010322569.1|  PREDICTED: chlorophyll a-b binding protein 4...  88.2    5e-17   
ref|XP_010547822.1|  PREDICTED: chlorophyll a-b binding protein 4...  88.2    5e-17   Tarenaya hassleriana [spider flower]
ref|XP_010426187.1|  PREDICTED: chlorophyll a-b binding protein 4...  88.2    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_004137413.1|  PREDICTED: chlorophyll a-b binding protein P...  87.8    6e-17   Cucumis sativus [cucumbers]
ref|XP_002514741.1|  chlorophyll A/B binding protein, putative        87.8    6e-17   Ricinus communis
pdb|4RKU|4  Chain 4, Crystal Structure Of Plant Photosystem I At ...  87.0    6e-17   Pisum sativum [garden pea]
ref|XP_006291725.1|  hypothetical protein CARUB_v10017894mg           87.8    7e-17   Capsella rubella
ref|XP_006374463.1|  Chlorophyll a-b binding protein 4                87.8    7e-17   
ref|XP_006374464.1|  hypothetical protein POPTR_0015s07340g           87.8    7e-17   
ref|XP_006827292.1|  PREDICTED: chlorophyll a-b binding protein 4...  87.4    8e-17   Amborella trichopoda
ref|NP_001275056.1|  chlorophyll a-b binding protein 4, chloropla...  87.4    8e-17   Solanum tuberosum [potatoes]
gb|KFK27969.1|  hypothetical protein AALP_AA8G455000                  87.4    8e-17   Arabis alpina [alpine rockcress]
gb|AEZ49173.1|  chlorophyll a/b binding protein 4                     87.4    9e-17   Wolffia australiana
ref|XP_010030046.1|  PREDICTED: chlorophyll a-b binding protein 4...  87.8    9e-17   Eucalyptus grandis [rose gum]
ref|XP_004973512.1|  PREDICTED: chlorophyll a-b binding protein P...  87.4    9e-17   Setaria italica
gb|ACG35965.1|  chlorophyll a-b binding protein 4                     87.4    9e-17   Zea mays [maize]
ref|XP_009398171.1|  PREDICTED: chlorophyll a-b binding protein 4...  87.4    9e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937179.1|  PREDICTED: chlorophyll a-b binding protein 4...  87.4    1e-16   Elaeis guineensis
gb|ACU22606.1|  unknown                                               85.1    1e-16   Glycine max [soybeans]
ref|NP_190331.3|  chlorophyll a-b binding protein 4                   87.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150371.1|  LOC100284001                                     87.0    1e-16   
gb|ACF86037.1|  unknown                                               87.0    1e-16   Zea mays [maize]
gb|KFK34045.1|  hypothetical protein AALP_AA5G094700                  87.0    1e-16   Arabis alpina [alpine rockcress]
ref|XP_010550595.1|  PREDICTED: chlorophyll a-b binding protein 4...  87.0    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_009388762.1|  PREDICTED: chlorophyll a-b binding protein 4...  87.0    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGU28447.1|  light-harvesting chlorophyll-protein complex I su...  86.3    1e-16   Sinapis alba [bai jie]
gb|AFW62278.1|  chlorophyll a-b binding protein 4                     86.7    1e-16   
gb|ABK24236.1|  unknown                                               86.7    1e-16   Picea sitchensis
gb|ACN40598.1|  unknown                                               86.7    1e-16   Picea sitchensis
ref|XP_010939818.1|  PREDICTED: chlorophyll a-b binding protein 4...  86.7    1e-16   Elaeis guineensis
ref|XP_010550593.1|  PREDICTED: chlorophyll a-b binding protein 4...  87.0    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_007138174.1|  hypothetical protein PHAVU_009G186500g           86.7    2e-16   Phaseolus vulgaris [French bean]
ref|XP_009149912.1|  PREDICTED: chlorophyll a-b binding protein 4...  86.7    2e-16   Brassica rapa
gb|ACG30344.1|  chlorophyll a-b binding protein 4                     86.7    2e-16   Zea mays [maize]
gb|AAR19267.2|  chlorophyll a/b binding protein presusor              86.3    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KJB08273.1|  hypothetical protein B456_001G074300                  84.3    2e-16   Gossypium raimondii
gb|KEH37276.1|  light-harvesting complex I chlorophyll A/B-bindin...  83.2    2e-16   Medicago truncatula
gb|EAZ07099.1|  hypothetical protein OsI_29348                        86.3    2e-16   Oryza sativa Indica Group [Indian rice]
gb|KJB50940.1|  hypothetical protein B456_008G194000                  86.3    2e-16   Gossypium raimondii
gb|KHG01496.1|  Chlorophyll a-b binding P4, chloroplastic             86.3    2e-16   Gossypium arboreum [tree cotton]
ref|NP_001061884.1|  Os08g0435900                                     86.3    2e-16   
gb|EAZ07102.1|  hypothetical protein OsI_29351                        85.9    2e-16   Oryza sativa Indica Group [Indian rice]
gb|AAC67557.1|  chlorophyll a/b-binding protein presursor             85.9    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011047180.1|  PREDICTED: chlorophyll a-b binding protein P...  86.3    2e-16   Populus euphratica
ref|XP_006659431.1|  PREDICTED: chlorophyll a-b binding protein P...  85.9    2e-16   Oryza brachyantha
gb|KHN26254.1|  Chlorophyll a-b binding protein P4, chloroplastic     85.9    3e-16   Glycine soja [wild soybean]
gb|KHN01874.1|  Chlorophyll a-b binding protein P4, chloroplastic     85.5    3e-16   Glycine soja [wild soybean]
gb|EPS72553.1|  chlorophyll a /b binding protein                      84.7    4e-16   Genlisea aurea
gb|KJB08272.1|  hypothetical protein B456_001G074300                  84.3    4e-16   Gossypium raimondii
ref|XP_003523016.2|  PREDICTED: chlorophyll a-b binding protein P...  85.9    4e-16   
gb|EYU24361.1|  hypothetical protein MIMGU_mgv1a012416mg              84.3    4e-16   Erythranthe guttata [common monkey flower]
ref|XP_007037388.1|  Light-harvesting chlorophyll-protein complex...  85.1    5e-16   
gb|KJB08274.1|  hypothetical protein B456_001G074300                  84.3    5e-16   Gossypium raimondii
gb|EYU24360.1|  hypothetical protein MIMGU_mgv1a012416mg              85.1    5e-16   Erythranthe guttata [common monkey flower]
gb|KJB08275.1|  hypothetical protein B456_001G074300                  85.1    5e-16   Gossypium raimondii
ref|XP_003527087.2|  PREDICTED: chlorophyll a-b binding protein P...  85.5    5e-16   
gb|KHG21243.1|  Chlorophyll a-b binding 4, chloroplastic -like pr...  85.1    5e-16   Gossypium arboreum [tree cotton]
ref|XP_010546068.1|  PREDICTED: chlorophyll a-b binding protein 4...  85.1    5e-16   Tarenaya hassleriana [spider flower]
pdb|2WSC|4  Chain 4, Improved Model Of Plant Photosystem I            84.7    7e-16   Spinacia oleracea
ref|XP_008802578.1|  PREDICTED: chlorophyll a-b binding protein 4...  84.3    8e-16   Phoenix dactylifera
ref|XP_003578105.1|  PREDICTED: chlorophyll a-b binding protein 1...  84.3    8e-16   Brachypodium distachyon [annual false brome]
emb|CDP12284.1|  unnamed protein product                              84.3    9e-16   Coffea canephora [robusta coffee]
gb|AGV54882.1|  chlorophyll A/B binding protein P4 chloroplastic-...  84.0    1e-15   Phaseolus vulgaris [French bean]
gb|AGZ15388.1|  PSI light-harvesting antenna chlorophyll a/b-bind...  84.0    1e-15   Phaseolus vulgaris [French bean]
gb|EMS64136.1|  Chlorophyll a-b binding protein 1B-20, chloroplastic  83.6    2e-15   Triticum urartu
dbj|BAJ89800.1|  predicted protein                                    83.6    2e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF90200.1|AF287276_2  chlorophyll a/b-binding protein precursor   83.2    2e-15   Hordeum vulgare [barley]
gb|ABV44672.1|  photosystem I light-harvesting complex type 4 pro...  82.4    4e-15   Bambusa oldhamii
gb|ACA66262.1|  chloroplast chlorophyll a/b binding protein precu...  82.0    6e-15   Phyllostachys edulis [kikko-chiku]
ref|XP_003620026.1|  Chlorophyll a /b binding protein                 79.0    9e-15   
sp|Q36718.1|CB120_HORVU  RecName: Full=Chlorophyll a-b binding pr...  80.5    2e-14   Hordeum vulgare [barley]
pdb|3LW5|4  Chain 4, Improved Model Of Plant Photosystem I            79.0    2e-14   unidentified
ref|XP_003620019.1|  Chlorophyll a /b binding protein                 77.4    2e-14   
gb|KEH17643.1|  light-harvesting complex I chlorophyll A/B-bindin...  77.0    3e-14   Medicago truncatula
gb|EMT16884.1|  hypothetical protein F775_43922                       81.3    3e-14   
ref|XP_010235157.1|  PREDICTED: chlorophyll a-b binding protein 4...  79.3    5e-14   Brachypodium distachyon [annual false brome]
ref|XP_002964438.1|  light-harvesting complex                         73.9    3e-12   Selaginella moellendorffii
ref|XP_002975356.1|  light-harvesting complex                         73.9    4e-12   Selaginella moellendorffii
emb|CCI55399.1|  PSI antenna protein Lhca4                            72.4    1e-11   Marchantia polymorpha
ref|XP_008239927.1|  PREDICTED: chlorophyll a-b binding protein P...  68.6    3e-10   Prunus mume [ume]
gb|KDO84189.1|  hypothetical protein CISIN_1g0246511mg                66.6    5e-10   Citrus sinensis [apfelsine]
ref|XP_006434776.1|  hypothetical protein CICLE_v10002178mg           66.6    6e-10   
dbj|BAD10637.1|  unknown protein                                      67.0    6e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDP01357.1|  unnamed protein product                              67.8    8e-10   Coffea canephora [robusta coffee]
ref|XP_011083846.1|  PREDICTED: chlorophyll a-b binding protein 4...  67.0    1e-09   Sesamum indicum [beniseed]
emb|CDY17055.1|  BnaA08g04190D                                        67.0    2e-09   Brassica napus [oilseed rape]
ref|NP_001146805.1|  uncharacterized protein LOC100280410             67.0    2e-09   
emb|CDY43213.1|  BnaC08g04860D                                        66.2    3e-09   Brassica napus [oilseed rape]
ref|XP_006434778.1|  hypothetical protein CICLE_v10002178mg           66.2    3e-09   Citrus clementina [clementine]
ref|XP_009107445.1|  PREDICTED: chlorophyll a-b binding protein 4...  66.2    3e-09   Brassica rapa
ref|XP_006393637.1|  hypothetical protein EUTSA_v10011725mg           66.2    3e-09   Eutrema salsugineum [saltwater cress]
ref|XP_009359490.1|  PREDICTED: chlorophyll a-b binding protein P...  66.2    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_006473329.1|  PREDICTED: chlorophyll a-b binding protein P...  66.2    3e-09   Citrus sinensis [apfelsine]
ref|XP_002891322.1|  light-harvesting complex protein                 65.9    3e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_008393806.1|  PREDICTED: chlorophyll a-b binding protein P...  65.9    3e-09   Malus domestica [apple tree]
dbj|BAH19631.1|  AT1G45474                                            65.9    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175137.1|  photosystem I light harvesting complex protein 5    65.9    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510221.1|  chlorophyll A/B binding protein, putative        65.9    4e-09   Ricinus communis
gb|AAD28768.1|AF134121_1  Lhca5 protein                               65.9    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500206.1|  PREDICTED: chlorophyll a-b binding protein 4...  65.9    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010479098.1|  PREDICTED: chlorophyll a-b binding protein 4...  65.9    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010059937.1|  PREDICTED: chlorophyll a-b binding protein 4...  65.9    5e-09   Eucalyptus grandis [rose gum]
ref|XP_010108606.1|  Chlorophyll a-b binding protein P4               65.5    5e-09   Morus notabilis
gb|AAM65689.1|  light-harvesting complex protein                      65.1    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291112.2|  PREDICTED: chlorophyll a-b binding protein P...  65.1    7e-09   Fragaria vesca subsp. vesca
ref|XP_012071664.1|  PREDICTED: chlorophyll a-b binding protein P...  64.7    1e-08   Jatropha curcas
gb|EYU25420.1|  hypothetical protein MIMGU_mgv1a011943mg              64.7    1e-08   Erythranthe guttata [common monkey flower]
gb|KFK36161.1|  hypothetical protein AALP_AA4G086000                  64.3    1e-08   Arabis alpina [alpine rockcress]
ref|XP_006305539.1|  hypothetical protein CARUB_v10010062mg           64.3    1e-08   Capsella rubella
ref|XP_010538121.1|  PREDICTED: chlorophyll a-b binding protein 4...  63.9    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_010461501.1|  PREDICTED: chlorophyll a-b binding protein 4...  63.9    2e-08   Camelina sativa [gold-of-pleasure]
gb|AFK43193.1|  unknown                                               63.2    2e-08   Lotus japonicus
ref|XP_006828393.1|  PREDICTED: chlorophyll a-b binding protein P...  63.5    3e-08   Amborella trichopoda
gb|AFK47516.1|  unknown                                               63.5    3e-08   Lotus japonicus
ref|XP_002961446.1|  light-harvesting complex                         63.2    3e-08   
ref|XP_011029950.1|  PREDICTED: chlorophyll a-b binding protein 4...  63.2    4e-08   Populus euphratica
ref|XP_007017245.1|  Light-harvesting complex I protein Lhca5 iso...  62.8    5e-08   
ref|XP_006374944.1|  chlorophyll A-B binding family protein           62.8    6e-08   
gb|KEH17644.1|  hypothetical protein MTR_0003s0070                    59.3    6e-08   Medicago truncatula
ref|XP_003528272.2|  PREDICTED: chlorophyll a-b binding protein 7...  62.8    7e-08   Glycine max [soybeans]
ref|XP_008220221.1|  PREDICTED: chlorophyll a-b binding protein P...  62.4    7e-08   Prunus mume [ume]
gb|KJB14576.1|  hypothetical protein B456_002G132100                  60.5    8e-08   Gossypium raimondii
ref|XP_010675790.1|  PREDICTED: chlorophyll a-b binding protein 4...  62.0    8e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004501571.1|  PREDICTED: chlorophyll a-b binding protein 4...  62.0    8e-08   Cicer arietinum [garbanzo]
ref|XP_007222188.1|  hypothetical protein PRUPE_ppa010039mg           62.0    9e-08   Prunus persica
ref|XP_004150882.1|  PREDICTED: chlorophyll a-b binding protein 4...  62.0    1e-07   Cucumis sativus [cucumbers]
ref|XP_005849804.1|  hypothetical protein CHLNCDRAFT_59626            61.6    1e-07   Chlorella variabilis
gb|AHM26631.1|  a-b binding protein                                   63.2    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_008444623.1|  PREDICTED: chlorophyll a-b binding protein P...  62.0    1e-07   Cucumis melo [Oriental melon]
ref|XP_009630364.1|  PREDICTED: chlorophyll a-b binding protein P...  61.6    1e-07   Nicotiana tomentosiformis
ref|XP_001780681.1|  predicted protein                                60.5    1e-07   
ref|XP_007136682.1|  hypothetical protein PHAVU_009G064900g           61.6    1e-07   Phaseolus vulgaris [French bean]
ref|XP_011399967.1|  Chlorophyll a-b binding protein 4, chloropla...  60.5    2e-07   Auxenochlorella protothecoides
ref|XP_009760096.1|  PREDICTED: chlorophyll a-b binding protein P...  61.2    2e-07   Nicotiana sylvestris
dbj|BAK01456.1|  predicted protein                                    57.8    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006343439.1|  PREDICTED: chlorophyll a-b binding protein P...  60.8    2e-07   Solanum tuberosum [potatoes]
ref|XP_006660507.1|  PREDICTED: chlorophyll a-b binding protein E...  59.3    2e-07   Oryza brachyantha
emb|CAA06961.1|  chlorophyll a/b-binding protein                      57.8    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABN10530.1|  Lhca5 protein                                         60.8    2e-07   Gentiana lutea
ref|XP_002284724.1|  PREDICTED: chlorophyll a-b binding protein 4...  60.8    3e-07   Vitis vinifera
ref|XP_010939425.1|  PREDICTED: chlorophyll a-b binding protein 4...  60.8    3e-07   Elaeis guineensis
ref|XP_003603038.1|  Chlorophyll a-b binding protein                  60.5    3e-07   Medicago truncatula
gb|ABK95186.1|  unknown                                               58.5    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_009616189.1|  PREDICTED: uncharacterized protein LOC104108775  50.1    3e-07   Nicotiana tomentosiformis
gb|AFA36569.1|  putative chlorophyll a/b-binding protein              59.3    3e-07   Lolium perenne [perennial ryegrass]
gb|KJB14575.1|  hypothetical protein B456_002G132100                  60.1    4e-07   Gossypium raimondii
gb|KHG00964.1|  Chlorophyll a-b binding P4, chloroplastic             60.1    4e-07   Gossypium arboreum [tree cotton]
ref|XP_009412442.1|  PREDICTED: chlorophyll a-b binding protein C...  60.1    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004242951.1|  PREDICTED: chlorophyll a-b binding protein 4...  59.7    5e-07   Solanum lycopersicum
gb|EAZ44119.1|  hypothetical protein OsJ_28744                        59.7    5e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EMS60898.1|  Chlorophyll a-b binding protein CP29.2, chloropla...  58.9    5e-07   Triticum urartu
emb|CBL86548.1|  chlorophyll a/b binding protein                      58.2    7e-07   Olea europaea
emb|CDP07244.1|  unnamed protein product                              59.7    8e-07   Coffea canephora [robusta coffee]
gb|EAZ08502.1|  hypothetical protein OsI_30775                        59.3    1e-06   Oryza sativa Indica Group [Indian rice]
gb|ABD37906.1|  light-harvesting chlorophyll-a/b binding protein ...  58.5    1e-06   Chlamydomonas incerta
ref|NP_001062801.1|  Os09g0296800                                     59.3    1e-06   
gb|AAF44703.1|AF241525_1  chlorophyll a/b-binding protein type III    57.8    1e-06   Alonsoa meridionalis
ref|XP_004238472.1|  PREDICTED: chlorophyll a-b binding protein o...  59.3    1e-06   Solanum lycopersicum
gb|AHM26630.1|  a-b binding protein                                   57.0    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_006342200.1|  PREDICTED: chlorophyll a-b binding protein o...  58.9    1e-06   Solanum tuberosum [potatoes]
ref|XP_011041127.1|  PREDICTED: chlorophyll a-b binding protein 5...  58.9    1e-06   Populus euphratica
ref|XP_003622415.1|  Chlorophyll a-b binding protein                  58.5    1e-06   
ref|XP_002945875.1|  light harvesting complex a protein               58.2    1e-06   Volvox carteri f. nagariensis
ref|XP_002307004.1|  chlorophyll A-B binding family protein           58.9    1e-06   Populus trichocarpa [western balsam poplar]
tpg|DAA05918.1|  TPA: chloroplast light-harvesting complex I prot...  58.5    1e-06   Mesostigma viride
gb|AFW73580.1|  hypothetical protein ZEAMMB73_964613                  56.6    2e-06   
ref|XP_010558381.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_010537249.1|  PREDICTED: chlorophyll a-b binding protein o...  58.9    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_008797264.1|  PREDICTED: chlorophyll a-b binding protein 4...  58.5    2e-06   Phoenix dactylifera
ref|XP_011041125.1|  PREDICTED: chlorophyll a-b binding protein 5...  58.9    2e-06   Populus euphratica
ref|XP_011041126.1|  PREDICTED: chlorophyll a-b binding protein 5...  58.9    2e-06   Populus euphratica
ref|XP_002459987.1|  hypothetical protein SORBIDRAFT_02g020290        58.9    2e-06   Sorghum bicolor [broomcorn]
gb|ABD37880.1|  light-harvesting chlorophyll-a/b binding protein ...  58.5    2e-06   Mesostigma viride
ref|XP_002323575.1|  chlorophyll a/b binding protein CP29             58.5    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011014743.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    2e-06   Populus euphratica
ref|NP_001048216.1|  Os02g0764500                                     58.2    2e-06   
ref|XP_001758295.1|  predicted protein                                58.2    2e-06   
gb|ABK96503.1|  unknown                                               58.5    2e-06   Populus trichocarpa x Populus deltoides
gb|EEC74057.1|  hypothetical protein OsI_09055                        58.2    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_001696202.1|  light-harvesting protein of photosystem I        57.8    2e-06   Chlamydomonas reinhardtii
ref|XP_011047451.1|  PREDICTED: chlorophyll a-b binding protein C...  58.5    2e-06   Populus euphratica
gb|EMT21651.1|  Chlorophyll a-b binding protein CP29.2, chloropla...  58.5    2e-06   
ref|XP_010270018.1|  PREDICTED: chlorophyll a-b binding protein 4...  58.2    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_004956497.1|  PREDICTED: chlorophyll a-b binding protein 1...  58.5    2e-06   Setaria italica
gb|KCW68163.1|  hypothetical protein EUGRSUZ_F01826                   57.8    2e-06   Eucalyptus grandis [rose gum]
gb|AEO51756.1|  chloroplast chlorophyll A/B binding protein           58.2    2e-06   Dimocarpus longan [longan]
ref|XP_010109617.1|  hypothetical protein L484_015572                 58.2    2e-06   Morus notabilis
ref|XP_010262833.1|  PREDICTED: chlorophyll a-b binding protein C...  58.2    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010061245.1|  PREDICTED: chlorophyll a-b binding protein o...  58.5    2e-06   Eucalyptus grandis [rose gum]
gb|AEW08137.1|  hypothetical protein 2_784_02                         55.8    3e-06   Pinus radiata
ref|XP_012073543.1|  PREDICTED: chlorophyll a-b binding protein o...  58.2    3e-06   Jatropha curcas
ref|XP_003577951.1|  PREDICTED: chlorophyll a-b binding protein o...  58.2    3e-06   Brachypodium distachyon [annual false brome]
gb|EYU26660.1|  hypothetical protein MIMGU_mgv1a011247mg              57.8    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_010112887.1|  Chlorophyll a-b binding protein 8                57.8    3e-06   Morus notabilis
gb|EPS71850.1|  hypothetical protein M569_02908                       58.2    3e-06   Genlisea aurea
ref|XP_011074048.1|  PREDICTED: chlorophyll a-b binding protein o...  57.8    3e-06   Sesamum indicum [beniseed]
dbj|BAJ98426.1|  predicted protein                                    57.4    3e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR25925.1|  chloroplast chlorophyll a-b binding protein           55.8    4e-06   Oryza sativa Indica Group [Indian rice]
gb|ABX89589.1|  Lhca3                                                 53.9    4e-06   Solanum tuberosum [potatoes]
gb|EPS68718.1|  hypothetical protein M569_06048                       57.4    4e-06   Genlisea aurea
ref|XP_011095216.1|  PREDICTED: chlorophyll a-b binding protein C...  57.8    4e-06   Sesamum indicum [beniseed]
ref|NP_001057513.1|  Os06g0320500                                     57.0    4e-06   
gb|AFW70295.1|  hypothetical protein ZEAMMB73_802965                  55.5    4e-06   
dbj|BAD06999.1|  chlorophyll a/b-binding protein-like protein         53.9    4e-06   Ipomoea nil [qian niu]
ref|XP_001782441.1|  predicted protein                                57.0    4e-06   
ref|XP_010246736.1|  PREDICTED: chlorophyll a-b binding protein o...  57.8    4e-06   Nelumbo nucifera [Indian lotus]
gb|KHN13315.1|  Chlorophyll a-b binding protein CP29.2, chloropla...  55.5    4e-06   Glycine soja [wild soybean]
ref|XP_010246735.1|  PREDICTED: chlorophyll a-b binding protein o...  57.8    4e-06   
ref|NP_001105502.1|  photosystem II subunit29                         57.4    4e-06   Zea mays [maize]
ref|NP_001136606.1|  uncharacterized protein LOC100216729             57.4    4e-06   Zea mays [maize]
ref|XP_006656037.1|  PREDICTED: chlorophyll a-b binding protein 1...  57.0    4e-06   
ref|XP_012087873.1|  PREDICTED: chlorophyll a-b binding protein C...  57.4    4e-06   Jatropha curcas
ref|XP_004246325.1|  PREDICTED: chlorophyll a-b binding protein C...  57.4    4e-06   Solanum lycopersicum
ref|XP_009588563.1|  PREDICTED: chlorophyll a-b binding protein C...  57.4    4e-06   Nicotiana tomentosiformis
ref|XP_009804550.1|  PREDICTED: chlorophyll a-b binding protein C...  57.4    4e-06   Nicotiana sylvestris
ref|XP_007160589.1|  hypothetical protein PHAVU_001G000400g           57.4    4e-06   Phaseolus vulgaris [French bean]
gb|ABG73415.1|  chloroplast pigment-binding protein CP29              57.4    4e-06   Nicotiana tabacum [American tobacco]
ref|XP_002463016.1|  hypothetical protein SORBIDRAFT_02g036260        57.4    5e-06   Sorghum bicolor [broomcorn]
ref|XP_004958012.1|  PREDICTED: chlorophyll a-b binding protein C...  57.4    5e-06   Setaria italica
ref|NP_001240088.1|  uncharacterized protein LOC100786260             57.4    5e-06   Glycine max [soybeans]
gb|ABR25924.1|  chloroplast chlorophyll a-b binding protein 8         55.8    5e-06   Oryza sativa Indica Group [Indian rice]
gb|KHN48517.1|  Chlorophyll a-b binding protein 4, chloroplastic      57.4    5e-06   Glycine soja [wild soybean]
ref|XP_008350546.1|  PREDICTED: chlorophyll a-b binding protein C...  54.7    5e-06   
gb|KJB17070.1|  hypothetical protein B456_002G263900                  57.0    5e-06   Gossypium raimondii
gb|KHN29869.1|  Chlorophyll a-b binding protein 3, chloroplastic      57.0    5e-06   Glycine soja [wild soybean]
ref|XP_006289419.1|  hypothetical protein CARUB_v10002918mg           57.0    5e-06   Capsella rubella
ref|XP_001773300.1|  predicted protein                                55.8    5e-06   
gb|KFK42074.1|  hypothetical protein AALP_AA2G207800                  57.4    6e-06   Arabis alpina [alpine rockcress]
ref|XP_007026729.1|  Light-harvesting complex II protein Lhcb4        57.0    6e-06   Theobroma cacao [chocolate]
ref|XP_003562892.1|  PREDICTED: chlorophyll a-b binding protein C...  57.0    6e-06   Brachypodium distachyon [annual false brome]
ref|XP_007028794.1|  Light-harvesting complex II protein Lhcb7        57.4    6e-06   
ref|XP_003545381.1|  PREDICTED: chlorophyll a-b binding protein 3...  57.0    6e-06   
ref|XP_004499329.1|  PREDICTED: chlorophyll a-b binding protein t...  57.0    6e-06   
gb|ACO51068.1|  chloroplast chlorophyll A-B binding protein           57.0    6e-06   
gb|EPS58306.1|  hypothetical protein M569_16509                       55.5    6e-06   
ref|XP_004954021.1|  PREDICTED: chlorophyll a-b binding protein P...  57.0    6e-06   
gb|KHG23195.1|  Uncharacterized protein F383_29279                    57.0    6e-06   
gb|AFW70293.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  56.6    6e-06   
ref|NP_001276264.1|  chlorophyll a-b binding protein 3, chloropla...  56.6    6e-06   
pdb|2WSC|3  Chain 3, Improved Model Of Plant Photosystem I            56.6    6e-06   Spinacia oleracea
gb|KFK38281.1|  hypothetical protein AALP_AA3G093700                  57.0    7e-06   
ref|XP_008237889.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophyll ...  57.0    7e-06   
ref|XP_007209349.1|  hypothetical protein PRUPE_ppa008546mg           57.0    7e-06   
gb|EMT30378.1|  hypothetical protein F775_43807                       55.1    7e-06   
ref|XP_009125404.1|  PREDICTED: chlorophyll a-b binding protein C...  57.0    7e-06   
ref|XP_009146970.1|  PREDICTED: chlorophyll a-b binding protein C...  57.0    7e-06   
gb|ACU19827.1|  unknown                                               57.0    7e-06   
gb|KFK24655.1|  hypothetical protein AALP_AA8G007900                  56.6    7e-06   
ref|XP_006407730.1|  hypothetical protein EUTSA_v10021263mg           56.6    7e-06   
ref|XP_002873005.1|  chlorophyll a/b-binding protein CP29             56.6    7e-06   
ref|XP_002321218.1|  chlorophyll A-B binding family protein           56.6    7e-06   
gb|ACJ84724.1|  unknown                                               56.6    7e-06   
emb|CDY53084.1|  BnaCnng24140D                                        56.6    7e-06   
emb|CDY04834.1|  BnaAnng00160D                                        56.6    7e-06   
ref|XP_004499328.1|  PREDICTED: chlorophyll a-b binding protein t...  57.0    7e-06   
gb|KIY92592.1|  Chlorophyll a-b binding protein                       54.7    7e-06   
gb|ABK96765.1|  unknown                                               56.6    7e-06   
ref|XP_010486443.1|  PREDICTED: chlorophyll a-b binding protein C...  56.6    7e-06   
dbj|BAJ33665.1|  unnamed protein product                              56.6    7e-06   
gb|ABD37882.1|  light-harvesting chlorophyll-a/b binding protein ...  56.2    7e-06   
ref|XP_010037701.1|  PREDICTED: chlorophyll a-b binding protein C...  56.6    7e-06   
ref|XP_006657829.1|  PREDICTED: chlorophyll a-b binding protein C...  56.6    7e-06   
ref|XP_011008196.1|  PREDICTED: chlorophyll a-b binding protein 8...  56.6    7e-06   
gb|AAM12979.1|  chlorophyll a/b-binding protein CP29                  56.6    7e-06   
gb|KIY93777.1|  hypothetical protein MNEG_14186                       56.2    7e-06   
ref|XP_010466814.1|  PREDICTED: chlorophyll a-b binding protein C...  56.6    7e-06   
gb|ACO06087.1|  chlorophyll a-b binding protein                       56.6    8e-06   
ref|XP_006300034.1|  hypothetical protein CARUB_v10016258mg           56.6    8e-06   
ref|NP_001141936.1|  uncharacterized protein LOC100274085             54.7    8e-06   
gb|AAK43851.1|AF370474_1  chlorophyll a/b-binding protein CP29        56.6    8e-06   
ref|NP_195773.1|  chlorophyll a-b binding protein CP29.1              56.6    8e-06   
gb|ABA27047.1|  TO75-2                                                53.1    8e-06   
ref|XP_006647025.1|  PREDICTED: chlorophyll a-b binding protein 8...  56.2    8e-06   
gb|AAS56914.1|  CAB-like protein                                      53.9    8e-06   
gb|ACN30800.1|  unknown                                               55.5    8e-06   
ref|NP_001148183.1|  chlorophyll a-b binding protein 6A               55.8    9e-06   
ref|XP_011019131.1|  PREDICTED: chlorophyll a-b binding protein C...  56.2    9e-06   
ref|XP_002309134.1|  chlorophyll a/b binding protein CP29             56.2    9e-06   
gb|KIZ05849.1|  hypothetical protein MNEG_2107                        54.3    9e-06   
gb|EMS45291.1|  Chlorophyll a-b binding protein 1B-21, chloroplastic  55.5    9e-06   
ref|XP_006398606.1|  hypothetical protein EUTSA_v10014055mg           56.6    9e-06   
ref|XP_004147887.1|  PREDICTED: chlorophyll a-b binding protein C...  56.2    9e-06   
ref|XP_008800353.1|  PREDICTED: chlorophyll a-b binding protein C...  56.2    9e-06   
ref|XP_010928786.1|  PREDICTED: chlorophyll a-b binding protein o...  56.6    9e-06   
ref|XP_009377780.1|  PREDICTED: chlorophyll a-b binding protein C...  56.2    9e-06   
ref|XP_006429357.1|  hypothetical protein CICLE_v10012370mg           56.2    9e-06   
gb|ACF86226.1|  unknown                                               56.2    9e-06   
ref|XP_006429356.1|  hypothetical protein CICLE_v10012370mg           56.2    9e-06   
ref|XP_008449241.1|  PREDICTED: chlorophyll a-b binding protein C...  56.2    9e-06   
gb|ACD13267.1|  chlorophyll a/b binding protein precursor             55.1    1e-05   
ref|NP_001148187.1|  LOC100281795                                     56.2    1e-05   
gb|AFW73581.1|  chlorophyll a-b binding protein 4                     56.6    1e-05   
ref|XP_008370077.1|  PREDICTED: chlorophyll a-b binding protein C...  56.2    1e-05   
ref|XP_005645058.1|  light harvesting complex protein I-20            55.5    1e-05   
ref|XP_002528105.1|  chlorophyll A/B binding protein, putative        56.2    1e-05   
ref|XP_004506774.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophyll ...  56.6    1e-05   
gb|ABV82714.1|  chloroplast chlorophyll a/b binding protein precu...  55.8    1e-05   
ref|XP_009627312.1|  PREDICTED: chlorophyll a-b binding protein, ...  55.8    1e-05   
dbj|BAK02397.1|  predicted protein                                    56.2    1e-05   
ref|XP_008380041.1|  PREDICTED: chlorophyll a-b binding protein 8...  56.2    1e-05   
ref|XP_002974259.1|  light-harvesting complex                         56.2    1e-05   
ref|XP_002985629.1|  light-harvesting complex                         56.2    1e-05   
ref|XP_003604653.1|  Chlorophyll a-b binding protein                  56.6    1e-05   
dbj|BAD06919.1|  light-harvesting chlorophyll-a/b protein of phot...  55.8    1e-05   
ref|XP_010664037.1|  PREDICTED: chlorophyll a-b binding protein o...  56.2    1e-05   
gb|AAB29485.1|  light-harvesting complex I                            55.5    1e-05   
ref|XP_001698070.1|  light-harvesting protein of photosystem I        55.8    1e-05   
gb|ABD37904.1|  light-harvesting chlorophyll-a/b binding protein ...  55.8    1e-05   
dbj|BAD25284.1|  putative chlorophyll a/b-binding protein type II...  55.8    1e-05   
gb|AHM26628.1|  a-b binding protein                                   55.8    1e-05   
gb|ACD13266.1|  chlorophyll a/b binding protein precursor             55.1    1e-05   
gb|ADE42967.1|  type III chlorophyll a/b binding protein              55.8    1e-05   
ref|XP_002451621.1|  hypothetical protein SORBIDRAFT_04g004770        55.5    1e-05   
ref|XP_008381981.1|  PREDICTED: chlorophyll a-b binding protein 6...  55.5    1e-05   
ref|XP_008356411.1|  PREDICTED: chlorophyll a-b binding protein 1...  54.3    1e-05   
ref|XP_008377758.1|  PREDICTED: chlorophyll a-b binding protein 6...  54.7    1e-05   
ref|XP_002510744.1|  chlorophyll A/B binding protein, putative        56.2    1e-05   
gb|EMS52019.1|  Chlorophyll a-b binding protein P4, chloroplastic     55.8    1e-05   
ref|XP_006647960.1|  PREDICTED: chlorophyll a-b binding protein 7...  55.8    1e-05   
ref|XP_008782824.1|  PREDICTED: chlorophyll a-b binding protein o...  55.8    1e-05   
sp|Q9SDM1.1|CB121_HORVU  RecName: Full=Chlorophyll a-b binding pr...  55.5    1e-05   
ref|XP_009759850.1|  PREDICTED: chlorophyll a-b binding protein, ...  55.5    1e-05   
gb|KJB19280.1|  hypothetical protein B456_003G092700                  56.2    1e-05   
ref|XP_002946247.1|  hypothetical protein VOLCADRAFT_108856           55.5    1e-05   
gb|KJB19279.1|  hypothetical protein B456_003G092700                  56.2    1e-05   
gb|ABN48563.1|  chloroplast PSI type III chlorophyll a/b-binding ...  53.1    1e-05   
gb|AFK41379.1|  unknown                                               53.9    1e-05   
ref|XP_006366348.1|  PREDICTED: chlorophyll a-b binding protein C...  55.8    1e-05   
ref|NP_001149586.1|  chlorophyll a-b binding protein 6A               55.5    2e-05   
ref|XP_010253858.1|  PREDICTED: chlorophyll a-b binding protein C...  55.8    2e-05   
ref|XP_004302636.1|  PREDICTED: chlorophyll a-b binding protein C...  55.8    2e-05   
ref|XP_004965344.1|  PREDICTED: chlorophyll a-b binding protein 1...  55.8    2e-05   
gb|EAZ40279.1|  hypothetical protein OsJ_24721                        55.5    2e-05   
ref|XP_001778557.1|  predicted protein                                55.5    2e-05   
emb|CBI40786.3|  unnamed protein product                              55.8    2e-05   
ref|XP_011082880.1|  PREDICTED: chlorophyll a-b binding protein 8...  55.5    2e-05   
ref|XP_007201239.1|  hypothetical protein PRUPE_ppa010511mg           55.1    2e-05   
ref|XP_009378087.1|  PREDICTED: chlorophyll a-b binding protein 6...  55.1    2e-05   
ref|XP_004307395.1|  PREDICTED: chlorophyll a-b binding protein 6...  55.1    2e-05   
ref|NP_001148598.1|  chlorophyll a-b binding protein 8                53.5    2e-05   
gb|AAD27878.1|AF139466_1  chlorophyll a/b binding protein CP29        55.5    2e-05   
ref|XP_006390178.1|  hypothetical protein EUTSA_v10018862mg           55.8    2e-05   
ref|NP_187506.1|  light harvesting complex photosystem II interac...  55.5    2e-05   
gb|EAZ00730.1|  hypothetical protein OsI_22755                        55.1    2e-05   
ref|XP_001782439.1|  predicted protein                                54.7    2e-05   
gb|ACU23907.1|  unknown                                               55.5    2e-05   
ref|XP_010670717.1|  PREDICTED: chlorophyll a-b binding protein C...  55.5    2e-05   
ref|XP_006390176.1|  hypothetical protein EUTSA_v10018862mg           55.1    2e-05   
ref|XP_010099628.1|  Chlorophyll a-b binding protein 6A               55.1    2e-05   
ref|XP_009416063.1|  PREDICTED: chlorophyll a-b binding protein C...  55.5    2e-05   
ref|XP_005846968.1|  hypothetical protein CHLNCDRAFT_134943           55.1    2e-05   
ref|XP_003520609.1|  PREDICTED: chlorophyll a-b binding protein C...  55.5    2e-05   
ref|XP_002507489.1|  chlorophyll a/b-binding protein, chloroplast...  55.1    2e-05   
ref|XP_007133907.1|  hypothetical protein PHAVU_010G002100g           55.5    2e-05   
ref|XP_009388349.1|  PREDICTED: chlorophyll a-b binding protein C...  55.5    2e-05   
dbj|BAH20219.1|  AT3G54890                                            53.5    2e-05   
ref|XP_003516950.1|  PREDICTED: chlorophyll a-b binding protein C...  55.5    2e-05   
ref|NP_001059975.1|  Os07g0558400                                     55.5    2e-05   
ref|XP_011464998.1|  PREDICTED: chlorophyll a-b binding protein 5...  55.5    2e-05   
ref|XP_005645057.1|  light-harvesting complex I protein               55.1    2e-05   
ref|XP_006288402.1|  hypothetical protein CARUB_v10001659mg           55.1    2e-05   
ref|XP_008782823.1|  PREDICTED: chlorophyll a-b binding protein o...  55.5    2e-05   
gb|KDO52039.1|  hypothetical protein CISIN_1g016235mg                 55.5    2e-05   
ref|XP_006857558.1|  PREDICTED: chlorophyll a-b binding protein 8...  55.1    2e-05   
ref|XP_009409310.1|  PREDICTED: chlorophyll a-b binding protein 4...  55.1    2e-05   
ref|XP_002882591.1|  LHCB4.2                                          55.1    2e-05   
ref|XP_001778909.1|  predicted protein                                53.9    2e-05   
pdb|3PL9|A  Chain A, Crystal Structure Of Spinach Minor Light-Har...  54.7    2e-05   
ref|XP_002985890.1|  light-harvesting complex                         55.5    2e-05   
ref|XP_008243837.1|  PREDICTED: chlorophyll a-b binding protein C...  55.1    2e-05   
ref|XP_009128183.1|  PREDICTED: chlorophyll a-b binding protein o...  55.5    2e-05   
emb|CDY45980.1|  BnaA02g18160D                                        55.5    2e-05   
ref|XP_010437187.1|  PREDICTED: chlorophyll a-b binding protein C...  55.1    2e-05   
ref|XP_011464996.1|  PREDICTED: chlorophyll a-b binding protein o...  55.5    2e-05   
gb|AFY99054.1|  chlorophyll binding protein                           53.9    2e-05   
gb|ABJ99590.1|  type III chlorophyll a/b-binding protein              55.1    2e-05   
ref|XP_008453033.1|  PREDICTED: chlorophyll a-b binding protein o...  55.1    2e-05   
gb|ABJ99591.1|  type III chlorophyll a/b-binding protein              55.1    2e-05   
ref|XP_002976428.1|  light-harvesting complex                         55.5    2e-05   
ref|XP_010455433.1|  PREDICTED: chlorophyll a-b binding protein C...  55.1    2e-05   
ref|XP_006357455.1|  PREDICTED: chlorophyll a-b binding protein C...  55.1    2e-05   
ref|XP_006431740.1|  hypothetical protein CICLE_v10002129mg           53.5    3e-05   
gb|AFY52187.1|  chlorophyll binding protein                           53.9    3e-05   
gb|AFY52157.1|  chlorophyll binding protein                           53.9    3e-05   
ref|XP_002279834.1|  PREDICTED: chlorophyll a-b binding protein C...  55.1    3e-05   
pdb|2O01|1  Chain 1, The Structure Of A Plant Photosystem I Super...  53.5    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264706.1|  PREDICTED: chlorophyll a-b binding protein 6...  54.7    3e-05   
gb|EMT31406.1|  Chlorophyll a-b binding protein E, chloroplastic      53.5    3e-05   
ref|XP_008368787.1|  PREDICTED: chlorophyll a-b binding protein 6...  55.1    3e-05   
ref|XP_009419140.1|  PREDICTED: chlorophyll a-b binding protein o...  55.1    3e-05   
ref|XP_008651122.1|  PREDICTED: uncharacterized protein LOC100274...  55.1    3e-05   
ref|XP_009419141.1|  PREDICTED: chlorophyll a-b binding protein o...  55.1    3e-05   
gb|ACN40554.1|  unknown                                               54.7    3e-05   
ref|XP_008388205.1|  PREDICTED: chlorophyll a-b binding protein C...  54.7    3e-05   
gb|AHM26635.1|  a-b binding protein                                   54.7    3e-05   
gb|AFK48966.1|  unknown                                               54.3    3e-05   
ref|XP_008453032.1|  PREDICTED: chlorophyll a-b binding protein o...  55.1    3e-05   
gb|ABK23158.1|  unknown                                               55.1    3e-05   
gb|ABK21181.1|  unknown                                               55.1    3e-05   
ref|XP_009788730.1|  PREDICTED: chlorophyll a-b binding protein o...  55.1    3e-05   
gb|ACN40433.1|  unknown                                               55.1    3e-05   
gb|ABK23587.1|  unknown                                               55.1    3e-05   
ref|XP_009595950.1|  PREDICTED: chlorophyll a-b binding protein o...  55.1    3e-05   
ref|XP_003563900.1|  PREDICTED: chlorophyll a-b binding protein 1...  54.3    3e-05   
ref|XP_008450298.1|  PREDICTED: chlorophyll a-b binding protein 8...  54.7    3e-05   
ref|WP_039310936.1|  hypothetical protein                             54.7    3e-05   
gb|AFY99055.1|  chlorophyll binding protein                           53.5    3e-05   
gb|AFK33642.1|  unknown                                               54.3    3e-05   
gb|AFS34654.1|  chloroplast chlorophyll a-b binding protein           53.5    3e-05   
ref|XP_009344712.1|  PREDICTED: chlorophyll a-b binding protein C...  54.7    3e-05   
ref|XP_009788731.1|  PREDICTED: chlorophyll a-b binding protein o...  55.1    3e-05   
emb|CBI31475.3|  unnamed protein product                              53.5    3e-05   
emb|CAA44777.1|  Precursor of CP29, core chlorophyll a/b binding ...  54.7    3e-05   
emb|CAA41405.1|  Type 1 chlorophyll a /b-binding protein              53.9    3e-05   
ref|XP_001773105.1|  predicted protein                                54.3    3e-05   
ref|XP_008807305.1|  PREDICTED: chlorophyll a-b binding protein 6...  54.3    3e-05   
ref|XP_009769851.1|  PREDICTED: chlorophyll a-b binding protein 6...  54.3    3e-05   
gb|EMT03206.1|  Chlorophyll a-b binding protein CP26, chloroplastic   54.7    3e-05   
gb|AFW87506.1|  chlorophyll a-b binding protein 8                     53.9    3e-05   
ref|XP_008246201.1|  PREDICTED: chlorophyll a-b binding protein 6...  52.8    3e-05   
ref|XP_009609516.1|  PREDICTED: chlorophyll a-b binding protein 6...  54.3    3e-05   
gb|AAR85970.1|  type III chlorophyll a/b-binding protein              51.6    3e-05   
ref|XP_007009806.1|  Light-harvesting complex I protein Lhca1 iso...  54.3    3e-05   
gb|ABD37908.1|  light-harvesting chlorophyll-a/b binding protein ...  53.5    3e-05   
ref|XP_008453995.1|  PREDICTED: chlorophyll a-b binding protein 6...  54.3    4e-05   
gb|ABK23427.1|  unknown                                               54.3    4e-05   
ref|XP_002275552.1|  PREDICTED: chlorophyll a-b binding protein 6...  54.3    4e-05   
emb|CAA41404.1|  Type 1 chlorophyll a /b-binding protein              54.3    4e-05   
gb|KDO52042.1|  hypothetical protein CISIN_1g016235mg                 54.7    4e-05   
gb|ABK26977.1|  unknown                                               54.3    4e-05   
ref|XP_009390617.1|  PREDICTED: chlorophyll a-b binding protein 8...  54.3    4e-05   
ref|XP_004143800.1|  PREDICTED: chlorophyll a-b binding protein 6...  54.3    4e-05   
ref|XP_010906487.1|  PREDICTED: chlorophyll a-b binding protein 6...  53.9    4e-05   
ref|XP_011077002.1|  PREDICTED: chlorophyll a-b binding protein 6...  54.3    4e-05   
ref|XP_006436282.1|  hypothetical protein CICLE_v10032568mg           53.9    4e-05   
gb|EMS49688.1|  Chlorophyll a-b binding protein CP26, chloroplastic   54.7    4e-05   
gb|KDO52040.1|  hypothetical protein CISIN_1g016235mg                 54.7    4e-05   
gb|KJB78935.1|  hypothetical protein B456_013G026000                  53.9    4e-05   
gb|KHN13373.1|  Chlorophyll a-b binding protein 6A, chloroplastic     53.9    4e-05   
gb|AAA34140.1|  chlorophyll a/b-binding protein                       53.9    4e-05   
gb|KDO52037.1|  hypothetical protein CISIN_1g016235mg                 54.7    4e-05   
gb|ABK23400.1|  unknown                                               53.9    4e-05   
ref|NP_850705.1|  chlorophyll a-b binding protein 6                   53.5    4e-05   
ref|XP_006490397.1|  PREDICTED: chlorophyll a-b binding protein 1...  54.7    4e-05   
ref|XP_004491629.1|  PREDICTED: chlorophyll a-b binding protein 3...  54.3    4e-05   
gb|KHG25903.1|  Chlorophyll a-b binding 6A, chloroplastic             53.9    4e-05   
gb|KDO42915.1|  hypothetical protein CISIN_1g0225291mg                53.1    4e-05   
ref|XP_010252884.1|  PREDICTED: chlorophyll a-b binding protein 8...  54.3    4e-05   
ref|XP_011031762.1|  PREDICTED: chlorophyll a-b binding protein 6...  53.9    4e-05   
ref|XP_006490396.1|  PREDICTED: chlorophyll a-b binding protein 1...  54.7    4e-05   
ref|XP_008373346.1|  PREDICTED: chlorophyll a-b binding protein o...  54.7    4e-05   



>gb|ABN49455.1| photosystem I chlorophyll a/b binding protein [Pisum sativum]
Length=144

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIVQTLG
Sbjct  100  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTLG  142



>gb|ABX71549.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71550.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71551.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71552.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71553.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71554.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71555.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71556.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71557.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71558.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71559.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71560.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71561.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71562.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71563.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71564.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71565.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71566.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
 gb|ABX71567.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus 
annuus]
Length=135

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQT+
Sbjct  91   GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTM  132



>gb|AEX12937.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12938.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12939.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12940.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12941.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12942.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12943.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12944.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12945.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12946.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12947.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12948.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12949.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
 gb|AEX12950.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda]
Length=60

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTI+Q L
Sbjct  16   GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIIQVL  57



>gb|AAP69815.1| chlorophyll a/b-binding protein, partial [Vitis vinifera]
Length=96

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTI+QTL
Sbjct  52   GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTL  93



>sp|Q9SQL2.1|CB24_PEA RecName: Full=Chlorophyll a-b binding protein P4, chloroplastic; 
AltName: Full=LHCI type III CAB-P4; Flags: Precursor [Pisum 
sativum]
 gb|AAF13731.1| PSI light-harvesting antenna chlorophyll a/b-binding protein 
[Pisum sativum]
Length=252

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIVQTLG
Sbjct  208  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTLG  250



>emb|CAA57877.1| light-harvesting chlorophyll a /b binding protein [Nicotiana 
tabacum]
Length=200

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFIVQHNV GKGPFDNLLQHLSDPWHNTIVQTLG
Sbjct  157  GRLAMLAFLGFIVQHNVVGKGPFDNLLQHLSDPWHNTIVQTLG  199



>ref|XP_009773617.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Nicotiana sylvestris]
Length=251

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFIVQHNV GKGPFDNLLQHLSDPWHNTIVQTLG
Sbjct  208  GRLAMLAFLGFIVQHNVVGKGPFDNLLQHLSDPWHNTIVQTLG  250



>ref|XP_010678492.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 emb|CAE30280.1| chlorophyll a /b binding protein [Beta vulgaris]
Length=252

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT G
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFG  250



>gb|AFK37078.1| unknown [Lotus japonicus]
Length=252

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  249



>pdb|2O01|4 Chain 4, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=165

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIVQTL
Sbjct  124  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTL  165



>ref|XP_008374556.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Malus domestica]
Length=253

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  209  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  250



>ref|XP_007209497.1| hypothetical protein PRUPE_ppa010291mg [Prunus persica]
 gb|EMJ10696.1| hypothetical protein PRUPE_ppa010291mg [Prunus persica]
Length=255

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  211  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  252



>ref|XP_009369279.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Pyrus x bretschneideri]
 gb|AHM26641.1| a-b binding protein [Pyrus x bretschneideri]
Length=253

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  209  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  250



>ref|XP_010258312.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Nelumbo 
nucifera]
Length=251

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  207  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  248



>gb|KEH33314.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=192

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  147  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  188



>ref|XP_011087238.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Sesamum 
indicum]
Length=249

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  206  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTL  247



>ref|XP_004138171.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Cucumis sativus]
 gb|KGN63677.1| hypothetical protein Csa_1G009810 [Cucumis sativus]
Length=252

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTIVQT G
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIVQTFG  250



>ref|XP_004513901.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cicer arietinum]
Length=252

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTL  249



>gb|ACJ85068.1| unknown [Medicago truncatula]
 gb|AFK42004.1| unknown [Medicago truncatula]
 gb|KEH33313.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=253

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  208  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  249



>ref|XP_008453211.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Cucumis melo]
Length=252

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTIVQT G
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIVQTFG  250



>gb|ACB05669.1| chloroplast chlorophyll a/b binding protein [Capsicum annuum]
Length=250

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ  159
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QTL  
Sbjct  206  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTLSS  249



>ref|XP_010257811.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Nelumbo nucifera]
Length=250

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  207  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  248



>emb|CAA78932.1| Lhca4 protein,Type 4 protein of light-harvesting complex of photosystem 
I [Pinus sylvestris]
Length=251

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  207  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIIQTL  248



>ref|XP_004236014.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Solanum 
lycopersicum]
Length=287

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QTL 
Sbjct  244  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTLS  286



>emb|CAC84491.1| putative chlorophyll a/b-binding protein type 4 [Pinus pinaster]
Length=251

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  207  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIIQTL  248



>emb|CBI15210.3| unnamed protein product [Vitis vinifera]
Length=249

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTI+QTL
Sbjct  205  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTL  246



>ref|XP_002284856.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Vitis 
vinifera]
 emb|CAN79984.1| hypothetical protein VITISV_038035 [Vitis vinifera]
Length=252

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTI+QTL
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTL  249



>emb|CAA78901.1| Lhca4 protein,Type 4 protein of light-harvesting complex of photosystem 
I [Pinus sylvestris]
Length=244

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  200  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIIQTL  241



>ref|XP_009339094.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Pyrus x bretschneideri]
Length=253

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  209  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIIQTL  250



>ref|XP_008393169.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Malus domestica]
 ref|XP_008351850.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Malus domestica]
Length=253

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  209  GRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIIQTL  250



>ref|XP_004299348.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=251

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNL+QHLSDPWHNTIVQTL
Sbjct  208  GRLAMLAFLGFVVQHNVTGKGPFDNLVQHLSDPWHNTIVQTL  249



>ref|XP_009587071.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=251

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT  
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFA  250



>ref|XP_010093602.1| Chlorophyll a-b binding protein P4 [Morus notabilis]
 gb|EXB54330.1| Chlorophyll a-b binding protein P4 [Morus notabilis]
Length=250

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTG+GPFDNLLQHLSDPWHNTIVQTL
Sbjct  206  GRLAMLAFLGFIVQHNVTGQGPFDNLLQHLSDPWHNTIVQTL  247



>ref|XP_009804068.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Nicotiana sylvestris]
Length=249

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT  
Sbjct  206  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFA  248



>gb|ABR25329.1| chloroplast chlorophyll a-b binding proteinr [Oryza sativa Indica 
Group]
Length=92

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGF+VQHNVT KGPFDNLLQHLSDPWHNTI+QTL 
Sbjct  49   GRLAMLAFLGFLVQHNVTQKGPFDNLLQHLSDPWHNTIIQTLS  91



>ref|WP_039310946.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91182.1| hypothetical protein QW71_36155 [Paenibacillus sp. IHB B 3415]
Length=193

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT 
Sbjct  149  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTF  190



>ref|XP_009618704.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Nicotiana tomentosiformis]
Length=251

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNV GKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  208  GRLAMLAFLGFIVQHNVVGKGPFDNLLQHLSDPWHNTIVQTL  249



>gb|AAG40364.1|AF325012_1 AT3g47470 [Arabidopsis thaliana]
Length=148

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTIVQT 
Sbjct  106  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTF  147



>ref|XP_006477466.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Citrus sinensis]
Length=250

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPF+NLLQH+SDPWHNTIVQTL
Sbjct  206  GRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTL  247



>gb|KDO55546.1| hypothetical protein CISIN_1g025674mg [Citrus sinensis]
Length=249

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPF+NLLQH+SDPWHNTIVQTL
Sbjct  205  GRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTL  246



>ref|XP_006374459.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
 ref|XP_006374460.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
 gb|ERP52256.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
 gb|ERP52257.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
Length=150

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPFDNLLQH+SDPWHNTIVQT 
Sbjct  106  GRLAMLAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTF  147



>ref|XP_006440616.1| hypothetical protein CICLE_v10021861mg [Citrus clementina]
 gb|ESR53856.1| hypothetical protein CICLE_v10021861mg [Citrus clementina]
Length=249

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPF+NLLQH+SDPWHNTIVQTL
Sbjct  205  GRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTL  246



>ref|XP_010515052.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Camelina sativa]
Length=253

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTIVQTL
Sbjct  210  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTL  251



>ref|XP_012080280.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Jatropha curcas]
 gb|KDP31267.1| hypothetical protein JCGZ_11643 [Jatropha curcas]
Length=249

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTIVQTL
Sbjct  205  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTL  246



>ref|XP_002877563.1| chlorophyll a/b-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53822.1| chlorophyll a/b-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTIVQTL
Sbjct  210  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTL  251



>ref|XP_006404376.1| hypothetical protein EUTSA_v10010659mg [Eutrema salsugineum]
 dbj|BAJ33651.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45829.1| hypothetical protein EUTSA_v10010659mg [Eutrema salsugineum]
Length=251

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPF+NLLQHLSDPWHNTIVQTL
Sbjct  209  GRLAMLAFLGFVIQHNVTGKGPFENLLQHLSDPWHNTIVQTL  250



>gb|ACF84895.1| unknown [Zea mays]
Length=149

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFL F++QHNVTGKGPFDNLLQHLSDPWHNTI+QTL 
Sbjct  106  GRLAMLAFLAFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTLS  148



>ref|XP_008783815.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Phoenix dactylifera]
Length=252

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTG+GPFDNLLQHLSDPWHNTI+QTL
Sbjct  209  GRLAMLAFLGFIIQHNVTGQGPFDNLLQHLSDPWHNTIIQTL  250



>ref|XP_006354774.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=250

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTI+QT 
Sbjct  207  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTF  248



>ref|XP_010322569.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Solanum lycopersicum]
Length=250

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTI+QT 
Sbjct  207  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTF  248



>ref|XP_010547822.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Tarenaya 
hassleriana]
Length=252

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+QTL
Sbjct  209  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIIQTL  250



>ref|XP_010426187.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Camelina sativa]
Length=253

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPF+NLLQHLSDPWHNTIVQTL
Sbjct  210  GRLAMLAFLGFVIQHNVTGKGPFENLLQHLSDPWHNTIVQTL  251



>ref|XP_004137413.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cucumis sativus]
 gb|KGN64012.1| hypothetical protein Csa_1G033310 [Cucumis sativus]
Length=250

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDN +QH+SDPWHNTIVQTL
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFDNFMQHISDPWHNTIVQTL  249



>ref|XP_002514741.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47847.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=251

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPFDNLLQHLSDPWHNTI+QT 
Sbjct  207  GRLAMLAFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF  248



>pdb|4RKU|4 Chain 4, Crystal Structure Of Plant Photosystem I At 3 Angstrom 
Resolution
Length=196

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQT  168
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIVQT
Sbjct  156  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQT  196



>ref|XP_006291725.1| hypothetical protein CARUB_v10017894mg [Capsella rubella]
 ref|XP_010503346.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Camelina 
sativa]
 gb|EOA24623.1| hypothetical protein CARUB_v10017894mg [Capsella rubella]
Length=253

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPF+NLLQHLSDPWHNTIVQTL
Sbjct  210  GRLAMLAFLGFVIQHNVTGKGPFENLLQHLSDPWHNTIVQTL  251



>ref|XP_006374463.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa]
 gb|ABK96327.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP52260.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa]
Length=251

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPFDNLLQH+SDPWHNTIVQT 
Sbjct  207  GRLAMLAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTF  248



>ref|XP_006374464.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
 gb|ERP52261.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
Length=252

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPFDNLLQH+SDPWHNTIVQT 
Sbjct  207  GRLAMLAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTF  248



>ref|XP_006827292.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Amborella 
trichopoda]
 gb|ERM94529.1| hypothetical protein AMTR_s00010p00264770 [Amborella trichopoda]
Length=252

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQ+NVTGKGPF+NLLQHLSDPWHNTIVQTL
Sbjct  209  GRLAMLAFLGFIVQYNVTGKGPFENLLQHLSDPWHNTIVQTL  250



>ref|NP_001275056.1| chlorophyll a-b binding protein 4, chloroplastic-like [Solanum 
tuberosum]
 emb|CAK24966.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=251

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPFDNLLQHL DPWHNTI+QTL
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLFDPWHNTIIQTL  249



>gb|KFK27969.1| hypothetical protein AALP_AA8G455000 [Arabis alpina]
Length=251

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NL+QHLSDPWHNTIVQTL
Sbjct  209  GRLAMLAFLGFVVQHNVTGKGPFENLVQHLSDPWHNTIVQTL  250



>gb|AEZ49173.1| chlorophyll a/b binding protein 4 [Wolffia australiana]
Length=250

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHN+TGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  207  GRLAMLAFLGFLIQHNLTGKGPFDNLLQHLSDPWHNTIIQTL  248



>ref|XP_010030046.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Eucalyptus 
grandis]
 gb|KCW83631.1| hypothetical protein EUGRSUZ_B00523 [Eucalyptus grandis]
Length=294

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NL+QHLSDPWHNTIVQTL
Sbjct  250  GRLAMLAFLGFVVQHNVTGKGPFENLVQHLSDPWHNTIVQTL  291



>ref|XP_004973512.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Setaria italica]
Length=245

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPFDNLLQHLSDPWHNTI+QT 
Sbjct  202  GRLAMLAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF  243



>gb|ACG35965.1| chlorophyll a-b binding protein 4 [Zea mays]
Length=247

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPFDNLLQHLSDPWHNTI+QT 
Sbjct  204  GRLAMLAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF  245



>ref|XP_009398171.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=252

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFL FI+QHN+TGKGPF+NLLQHLSDPWHNTI+QTLG
Sbjct  209  GRLAMLAFLAFIIQHNLTGKGPFENLLQHLSDPWHNTIIQTLG  251



>ref|XP_010937179.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Elaeis guineensis]
Length=251

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTG+GPFDNLLQHLSDPWHNTI+QTL
Sbjct  208  GRLAMLAFLGFLVQHNVTGQGPFDNLLQHLSDPWHNTIIQTL  249



>gb|ACU22606.1| unknown [Glycine max]
Length=150

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  106  GRLAMLAFLGFIVQHNVTGKGPFENLLQHLSDPWHNTIINTI  147



>ref|NP_190331.3| chlorophyll a-b binding protein 4 [Arabidopsis thaliana]
 sp|P27521.1|CA4_ARATH RecName: Full=Chlorophyll a-b binding protein 4, chloroplastic; 
AltName: Full=LHCI type III CAB-4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA32760.1| light-harvesting chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 emb|CAB61973.1| CHLOROPHYLL A-B BINDING PROTEIN 4 PRECURSOR homolog [Arabidopsis 
thaliana]
 gb|AAM13079.1| chlorophyll A-B binding protein 4 precursor homolog [Arabidopsis 
thaliana]
 gb|AAM63472.1| chlorophyll a-b binding protein 4 precursor homolog [Arabidopsis 
thaliana]
 gb|AAN15412.1| chlorophyll A-B binding protein 4 precursor homolog [Arabidopsis 
thaliana]
 gb|AEE78285.1| chlorophyll a-b binding protein 4 [Arabidopsis thaliana]
Length=251

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTIVQT 
Sbjct  209  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTF  250



>ref|NP_001150371.1| LOC100284001 [Zea mays]
 gb|ACG38831.1| chlorophyll a-b binding protein 4 [Zea mays]
Length=247

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPFDNLLQHLSDPWHNTI+QT 
Sbjct  204  GRLAMLAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF  245



>gb|ACF86037.1| unknown [Zea mays]
 gb|ACG28373.1| chlorophyll a-b binding protein 4 [Zea mays]
 tpg|DAA48990.1| TPA: chlorophyll a-b binding protein 4 [Zea mays]
Length=247

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPFDNLLQHLSDPWHNTI+QT 
Sbjct  204  GRLAMLAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF  245



>gb|KFK34045.1| hypothetical protein AALP_AA5G094700 [Arabis alpina]
Length=252

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPF+NL+QHLSDPWHNTIVQTL
Sbjct  209  GRLAMLAFLGFVIQHNVTGKGPFENLVQHLSDPWHNTIVQTL  250



>ref|XP_010550595.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=252

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+QT 
Sbjct  209  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIIQTF  250



>ref|XP_009388762.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=251

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTGKGPF+NLLQHLSDPWHNTI+QT 
Sbjct  208  GRLAMLAFLGFIIQHNVTGKGPFENLLQHLSDPWHNTIIQTF  249



>gb|AGU28447.1| light-harvesting chlorophyll-protein complex I subunit A4, partial 
[Sinapis alba]
Length=206

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPF+NLLQHLSDPWHNTIVQT 
Sbjct  164  GRLAMLAFLGFVIQHNVTGKGPFENLLQHLSDPWHNTIVQTF  205



>gb|AFW62278.1| chlorophyll a-b binding protein 4 [Zea mays]
Length=244

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFL F++QHNVTGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  201  GRLAMLAFLAFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTL  242



>gb|ABK24236.1| unknown [Picea sitchensis]
 gb|ABK25778.1| unknown [Picea sitchensis]
 gb|ACN40523.1| unknown [Picea sitchensis]
Length=251

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+QT 
Sbjct  207  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIIQTF  248



>gb|ACN40598.1| unknown [Picea sitchensis]
Length=251

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+QT 
Sbjct  207  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIIQTF  248



>ref|XP_010939818.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Elaeis guineensis]
Length=251

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTG+GPFDNLLQH+SDPWHNTI+QTL
Sbjct  208  GRLAMLAFLGFVIQHNVTGQGPFDNLLQHISDPWHNTIIQTL  249



>ref|XP_010550593.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=278

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+QT 
Sbjct  235  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIIQTF  276



>ref|XP_007138174.1| hypothetical protein PHAVU_009G186500g [Phaseolus vulgaris]
 gb|AGV54430.1| chlorophyll A/B binding protein [Phaseolus vulgaris]
 gb|ESW10168.1| hypothetical protein PHAVU_009G186500g [Phaseolus vulgaris]
Length=252

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIINTI  249



>ref|XP_009149912.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Brassica 
rapa]
 emb|CDY47410.1| BnaCnng15190D [Brassica napus]
 emb|CDX99044.1| BnaA06g17350D [Brassica napus]
Length=252

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPF+NLLQHLSDPWHNTIVQT 
Sbjct  210  GRLAMLAFLGFVIQHNVTGKGPFENLLQHLSDPWHNTIVQTF  251



>gb|ACG30344.1| chlorophyll a-b binding protein 4 [Zea mays]
Length=252

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFL F++QHNVTGKGPFDNLLQHLSDPWHNTI+QTL
Sbjct  209  GRLAMLAFLAFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTL  250



>gb|AAR19267.2| chlorophyll a/b binding protein presusor [Oryza sativa Japonica 
Group]
Length=244

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGF+VQHNVT KGPFDNLLQHLSDPWHNTI+QTL 
Sbjct  201  GRLAMLAFLGFLVQHNVTQKGPFDNLLQHLSDPWHNTIIQTLS  243



>gb|KJB08273.1| hypothetical protein B456_001G074300 [Gossypium raimondii]
Length=150

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  106  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIINTI  147



>gb|KEH37276.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=102

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI QHNVTGKG FDNLL+HLSDPWHNTIVQTL
Sbjct  57   GRLAMLAFLGFISQHNVTGKGRFDNLLEHLSDPWHNTIVQTL  98



>gb|EAZ07099.1| hypothetical protein OsI_29348 [Oryza sativa Indica Group]
Length=244

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVT KGPFDNLLQHLSDPWHNTI+QTL
Sbjct  201  GRLAMLAFLGFLVQHNVTQKGPFDNLLQHLSDPWHNTIIQTL  242



>gb|KJB50940.1| hypothetical protein B456_008G194000 [Gossypium raimondii]
Length=252

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIINTI  249



>gb|KHG01496.1| Chlorophyll a-b binding P4, chloroplastic [Gossypium arboreum]
Length=252

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIINTI  249



>ref|NP_001061884.1| Os08g0435900 [Oryza sativa Japonica Group]
 dbj|BAD10636.1| putative chlorophyll a/b-binding protein precursor [Oryza sativa 
Japonica Group]
 dbj|BAF23798.1| Os08g0435900 [Oryza sativa Japonica Group]
 gb|EAZ42851.1| hypothetical protein OsJ_27444 [Oryza sativa Japonica Group]
 dbj|BAG90554.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96663.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96733.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87372.1| unnamed protein product [Oryza sativa Japonica Group]
Length=244

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVT KGPFDNLLQHLSDPWHNTI+QTL
Sbjct  201  GRLAMLAFLGFLVQHNVTQKGPFDNLLQHLSDPWHNTIIQTL  242



>gb|EAZ07102.1| hypothetical protein OsI_29351 [Oryza sativa Indica Group]
Length=244

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVT KGPFDNLLQHLSDPWHNTI+QTL
Sbjct  201  GRLAMLAFLGFLVQHNVTQKGPFDNLLQHLSDPWHNTIIQTL  242



>gb|AAC67557.1| chlorophyll a/b-binding protein presursor [Oryza sativa Japonica 
Group]
Length=244

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVT KGPFDNLLQHLSDPWHNTI+QTL
Sbjct  201  GRLAMLAFLGFLVQHNVTQKGPFDNLLQHLSDPWHNTIIQTL  242



>ref|XP_011047180.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Populus euphratica]
Length=251

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTGKGPF+NLLQH+SDPWHNTIVQT 
Sbjct  207  GRLAMLAFLGFVIQHNVTGKGPFENLLQHISDPWHNTIVQTF  248



>ref|XP_006659431.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Oryza brachyantha]
Length=246

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVT KGPFDNLLQHLSDPWHNTI+QTL
Sbjct  203  GRLAMLAFLGFLVQHNVTQKGPFDNLLQHLSDPWHNTIIQTL  244



>gb|KHN26254.1| Chlorophyll a-b binding protein P4, chloroplastic [Glycine soja]
Length=252

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFENLLQHLSDPWHNTIINTI  249



>gb|KHN01874.1| Chlorophyll a-b binding protein P4, chloroplastic [Glycine soja]
Length=252

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFIVQHNVTGKGPFENLLQHLSDPWHNTIINTI  249



>gb|EPS72553.1| chlorophyll a /b binding protein, partial [Genlisea aurea]
Length=208

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPFDNL+QHL+DPWHNTI+QT 
Sbjct  164  GRLAMLAFLGFLVQHNVTGKGPFDNLVQHLADPWHNTIIQTF  205



>gb|KJB08272.1| hypothetical protein B456_001G074300 [Gossypium raimondii]
Length=183

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  139  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIINTI  180



>ref|XP_003523016.2| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Glycine max]
Length=291

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  247  GRLAMLAFLGFIVQHNVTGKGPFENLLQHLSDPWHNTIINTI  288



>gb|EYU24361.1| hypothetical protein MIMGU_mgv1a012416mg [Erythranthe guttata]
Length=186

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKG FDNLLQHLSDPWHNTI+QT 
Sbjct  143  GRLAMLAFLGFVVQHNVTGKGAFDNLLQHLSDPWHNTIIQTF  184



>ref|XP_007037388.1| Light-harvesting chlorophyll-protein complex I subunit A4 [Theobroma 
cacao]
 gb|EOY21889.1| Light-harvesting chlorophyll-protein complex I subunit A4 [Theobroma 
cacao]
Length=252

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQH+VTGKGPFDNLLQHLSDPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFVVQHSVTGKGPFDNLLQHLSDPWHNTIINTI  249



>gb|KJB08274.1| hypothetical protein B456_001G074300 [Gossypium raimondii]
Length=192

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  148  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIINTI  189



>gb|EYU24360.1| hypothetical protein MIMGU_mgv1a012416mg [Erythranthe guttata]
Length=251

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKG FDNLLQHLSDPWHNTI+QT 
Sbjct  208  GRLAMLAFLGFVVQHNVTGKGAFDNLLQHLSDPWHNTIIQTF  249



>gb|KJB08275.1| hypothetical protein B456_001G074300 [Gossypium raimondii]
Length=252

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIINTI  249



>ref|XP_003527087.2| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Glycine max]
Length=292

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFIVQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  248  GRLAMLAFLGFIVQHNVTGKGPFENLLQHLSDPWHNTIINTI  289



>gb|KHG21243.1| Chlorophyll a-b binding 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=252

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIINTI  249



>ref|XP_010546068.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Tarenaya hassleriana]
Length=252

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NLLQHLSDPWH+TI+QT 
Sbjct  209  GRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHSTIIQTF  250



>pdb|2WSC|4 Chain 4, Improved Model Of Plant Photosystem I
 pdb|2WSE|4 Chain 4, Improved Model Of Plant Photosystem I
 pdb|2WSF|4 Chain 4, Improved Model Of Plant Photosystem I
Length=251

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 1/43 (2%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRL MLAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIVQTLG
Sbjct  208  GRL-MLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTLG  249



>ref|XP_008802578.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Phoenix dactylifera]
Length=247

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF++QHNVTG+GPFDNLLQH+SDPWH TI+QTL
Sbjct  204  GRLAMLAFLGFVIQHNVTGQGPFDNLLQHISDPWHTTIIQTL  245



>ref|XP_003578105.1| PREDICTED: chlorophyll a-b binding protein 1B-20, chloroplastic-like 
[Brachypodium distachyon]
Length=246

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NL+QHL+DPWHNTI+QT 
Sbjct  203  GRLAMLAFLGFLVQHNVTGKGPFENLMQHLADPWHNTIIQTF  244



>emb|CDP12284.1| unnamed protein product [Coffea canephora]
Length=252

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLGFI+Q+NVTG+GPFDNLL+HLSDPWHNTIVQT  
Sbjct  208  GRLAMLAFLGFIIQYNVTGEGPFDNLLKHLSDPWHNTIVQTFA  250



>gb|AGV54882.1| chlorophyll A/B binding protein P4 chloroplastic-like protein 
[Phaseolus vulgaris]
Length=252

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQHL DPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHLFDPWHNTIINTI  249



>gb|AGZ15388.1| PSI light-harvesting antenna chlorophyll a/b-binding protein 
[Phaseolus vulgaris]
Length=252

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+QHNVTGKGPFDNLLQHL DPWHNTI+ T+
Sbjct  208  GRLAMLAFLGFIIQHNVTGKGPFDNLLQHLFDPWHNTIINTI  249



>gb|EMS64136.1| Chlorophyll a-b binding protein 1B-20, chloroplastic [Triticum 
urartu]
Length=245

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NL QHL+DPWHNTI+QT+
Sbjct  201  GRLAMLAFLGFLVQHNVTGKGPFENLQQHLADPWHNTIIQTI  242



>dbj|BAJ89800.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85392.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NL QHL+DPWHNTI+QT+
Sbjct  201  GRLAMLAFLGFLVQHNVTGKGPFENLQQHLADPWHNTIIQTI  242



>gb|AAF90200.1|AF287276_2 chlorophyll a/b-binding protein precursor [Hordeum vulgare]
Length=228

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NL QHL+DPWHNTI+QT+
Sbjct  184  GRLAMLAFLGFLVQHNVTGKGPFENLQQHLADPWHNTIIQTI  225



>gb|ABV44672.1| photosystem I light-harvesting complex type 4 protein [Bambusa 
oldhamii]
Length=244

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFL F+VQH +TGKGPF+NLLQHLSDPWHNTI+QTL
Sbjct  201  GRLAMLAFLAFMVQHGITGKGPFENLLQHLSDPWHNTIIQTL  242



>gb|ACA66262.1| chloroplast chlorophyll a/b binding protein precursor [Phyllostachys 
edulis]
Length=245

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQH +TGKGPF+NLLQHL DPWHNTI+QTL
Sbjct  202  GRLAMLAFLGFMVQHGITGKGPFENLLQHLFDPWHNTIIQTL  243



>ref|XP_003620026.1| Chlorophyll a /b binding protein [Medicago truncatula]
Length=121

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 42/63 (67%), Gaps = 10/63 (16%)
 Frame = -3

Query  284  LAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA*G*WKPEGRCCLCCC  105
             AMLAFLGFI QH+VTGKG FDNLLQHLSDPWHNTIVQTL            G+ C    
Sbjct  55   FAMLAFLGFISQHSVTGKGRFDNLLQHLSDPWHNTIVQTLSG----------GKACCAAA  104

Query  104  NHE  96
            + E
Sbjct  105  DKE  107



>sp|Q36718.1|CB120_HORVU RecName: Full=Chlorophyll a-b binding protein 1B-20, chloroplastic; 
AltName: Full=LHCI type I CAB-1B-20; AltName: Full=Light-harvesting 
complex I 20 kDa protein; Flags: Precursor, partial 
[Hordeum vulgare]
 gb|AAB29486.1| light-harvesting complex I, partial (chloroplast) [Hordeum vulgare]
Length=231

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNV GKGPF+NL QHL+DPWHNTI+QT+
Sbjct  187  GRLAMLAFLGFLVQHNVHGKGPFENLQQHLADPWHNTIIQTI  228



>pdb|3LW5|4 Chain 4, Improved Model Of Plant Photosystem I
Length=166

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 1/40 (3%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQ  171
            GRL MLAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIVQ
Sbjct  128  GRL-MLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQ  166



>ref|XP_003620019.1| Chlorophyll a /b binding protein [Medicago truncatula]
 gb|AES76237.1| chlorophyll A/B-binding protein, putative [Medicago truncatula]
Length=104

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  284  LAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
             AMLAFLGFI QH+VTGKG FDNLLQHLSDPWHNTIVQTL
Sbjct  61   FAMLAFLGFISQHSVTGKGRFDNLLQHLSDPWHNTIVQTL  100



>gb|KEH17643.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=95

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLA+LAFLGFI QH V GKG FDNLLQHLSDPWHN IVQTL
Sbjct  50   GRLALLAFLGFISQHKVAGKGRFDNLLQHLSDPWHNIIVQTL  91



>gb|EMT16884.1| hypothetical protein F775_43922 [Aegilops tauschii]
Length=329

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF+VQHNVTGKGPF+NL QHL+DPWH TI+QT+
Sbjct  201  GRLAMLAFLGFLVQHNVTGKGPFENLQQHLADPWHTTIIQTI  242



>ref|XP_010235157.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Brachypodium distachyon]
Length=244

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLA+LGF VQH VTGKGP DNL QHLSDPWHNTI+QT 
Sbjct  201  GRLAMLAYLGFSVQHAVTGKGPLDNLFQHLSDPWHNTIIQTF  242



>ref|XP_002964438.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ34771.1| light-harvesting complex [Selaginella moellendorffii]
Length=248

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+Q NVT +GPF+NLL HLSDPWH+TIVQ++
Sbjct  204  GRLAMLAFLGFIIQSNVTHQGPFENLLTHLSDPWHHTIVQSI  245



>ref|XP_002975356.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ23557.1| light-harvesting complex [Selaginella moellendorffii]
Length=248

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGFI+Q NVT +GPF+NLL HLSDPWH+TIVQ++
Sbjct  204  GRLAMLAFLGFIIQSNVTHQGPFENLLTHLSDPWHHTIVQSI  245



>emb|CCI55399.1| PSI antenna protein Lhca4 [Marchantia polymorpha]
Length=249

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAMLAFLG +VQ  +TG GPF+NLL HL+DPWH TIVQTL 
Sbjct  206  GRLAMLAFLGMLVQSKLTGAGPFENLLTHLADPWHTTIVQTLA  248



>ref|XP_008239927.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Prunus mume]
Length=256

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -3

Query  266  LGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
             G +VQHNVTGKGPFDNLLQHLSDPWHNTIVQTL
Sbjct  220  FGDVVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  253



>gb|KDO84189.1| hypothetical protein CISIN_1g0246511mg, partial [Citrus sinensis]
 gb|KDO84190.1| hypothetical protein CISIN_1g0246511mg, partial [Citrus sinensis]
 gb|KDO84191.1| hypothetical protein CISIN_1g0246511mg, partial [Citrus sinensis]
 gb|KDO84192.1| hypothetical protein CISIN_1g0246511mg, partial [Citrus sinensis]
Length=149

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA  150
            GRLAM+A LG  VQ +VT  GP DN+L+HLSDPWH TI+QTL   G+
Sbjct  103  GRLAMVAMLGIFVQASVTHVGPIDNILEHLSDPWHKTIIQTLANSGS  149



>ref|XP_006434776.1| hypothetical protein CICLE_v10002178mg [Citrus clementina]
 gb|ESR48016.1| hypothetical protein CICLE_v10002178mg [Citrus clementina]
Length=160

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA  150
            GRLAM+A LG  VQ +VT  GP DN+L+HLSDPWH TI+QTL   G+
Sbjct  114  GRLAMVAMLGIFVQASVTHVGPIDNILEHLSDPWHKTIIQTLANSGS  160



>dbj|BAD10637.1| unknown protein [Oryza sativa Japonica Group]
Length=191

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  178  MVLCHGSDRCCSRLSNGPLPVTLCCTMNPRNANIANLP  291
            MVLCHGSDRCCSRLS GP  VTLCCT NP+NA+IA+LP
Sbjct  2    MVLCHGSDRCCSRLSKGPFCVTLCCTRNPKNASIASLP  39



>emb|CDP01357.1| unnamed protein product [Coffea canephora]
Length=268

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM+A LGF VQ +VT  GP DNL++HLSDPWH TI+QTL 
Sbjct  222  GRLAMVAMLGFFVQASVTHAGPIDNLVEHLSDPWHKTIIQTLA  264



>ref|XP_011083846.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Sesamum 
indicum]
Length=265

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ NVT  GP DNL+QHLSDPWH TI+QTL
Sbjct  219  GRLAMVAMLGIFVQANVTHVGPVDNLIQHLSDPWHTTIIQTL  260



>emb|CDY17055.1| BnaA08g04190D [Brassica napus]
Length=258

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  212  GRLAMMAILGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  253



>ref|NP_001146805.1| uncharacterized protein LOC100280410 [Zea mays]
 gb|ACL54787.1| unknown [Zea mays]
Length=272

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  178  MVLCHGSDRCCSRLSNGPLPVTLCCTMNPRNANIANLPAK  297
            MVLCHGSDRCCSRLS GPLPVTLC     RNA++A+LPA+
Sbjct  2    MVLCHGSDRCCSRLSKGPLPVTLCWIRKARNASMASLPAE  41



>emb|CDY43213.1| BnaC08g04860D [Brassica napus]
Length=258

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  212  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  253



>ref|XP_006434778.1| hypothetical protein CICLE_v10002178mg [Citrus clementina]
 ref|XP_006434779.1| hypothetical protein CICLE_v10002178mg [Citrus clementina]
 ref|XP_006434780.1| hypothetical protein CICLE_v10002178mg [Citrus clementina]
 gb|ESR48018.1| hypothetical protein CICLE_v10002178mg [Citrus clementina]
 gb|ESR48019.1| hypothetical protein CICLE_v10002178mg [Citrus clementina]
 gb|ESR48020.1| hypothetical protein CICLE_v10002178mg [Citrus clementina]
Length=265

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA  150
            GRLAM+A LG  VQ +VT  GP DN+L+HLSDPWH TI+QTL   G+
Sbjct  219  GRLAMVAMLGIFVQASVTHVGPIDNILEHLSDPWHKTIIQTLANSGS  265



>ref|XP_009107445.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Brassica 
rapa]
Length=258

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  212  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  253



>ref|XP_006393637.1| hypothetical protein EUTSA_v10011725mg [Eutrema salsugineum]
 gb|ESQ30923.1| hypothetical protein EUTSA_v10011725mg [Eutrema salsugineum]
Length=255

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  209  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  250



>ref|XP_009359490.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Pyrus x bretschneideri]
Length=260

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNLL+HLS+PWH TIVQTL
Sbjct  215  GRLAMVAMLGFFVQASVTHVGPIDNLLEHLSNPWHRTIVQTL  256



>ref|XP_006473329.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006473330.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
isoform X2 [Citrus sinensis]
 ref|XP_006473331.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=265

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA  150
            GRLAM+A LG  VQ +VT  GP DN+L+HLSDPWH TI+QTL   G+
Sbjct  219  GRLAMVAMLGIFVQASVTHVGPIDNILEHLSDPWHKTIIQTLANSGS  265



>ref|XP_002891322.1| light-harvesting complex protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67581.1| light-harvesting complex protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  210  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  251



>ref|XP_008393806.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Malus domestica]
Length=260

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNLL+HLS+PWH TIVQTL
Sbjct  215  GRLAMVAMLGFFVQASVTHVGPIDNLLEHLSNPWHRTIVQTL  256



>dbj|BAH19631.1| AT1G45474 [Arabidopsis thaliana]
Length=248

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  202  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  243



>ref|NP_175137.1| photosystem I light harvesting complex protein 5 [Arabidopsis 
thaliana]
 ref|NP_849778.1| photosystem I light harvesting complex protein 5 [Arabidopsis 
thaliana]
 gb|AAG50618.1|AC083835_3 light-harvesting complex protein [Arabidopsis thaliana]
 gb|AAL32974.1| At1g45474/F2G19.4 [Arabidopsis thaliana]
 gb|AAL90924.1| At1g45474/F2G19.4 [Arabidopsis thaliana]
 dbj|BAD95402.1| light-harvesting complex protein [Arabidopsis thaliana]
 gb|AEE32117.1| photosystem I light harvesting complex protein 5 [Arabidopsis 
thaliana]
 gb|AEE32118.1| photosystem I light harvesting complex protein 5 [Arabidopsis 
thaliana]
Length=256

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  210  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  251



>ref|XP_002510221.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF52408.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=269

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ  VT  GP DNLL+HLSDPWH TI+QTL
Sbjct  223  GRLAMVAMLGIFVQAAVTHTGPIDNLLEHLSDPWHKTIIQTL  264



>gb|AAD28768.1|AF134121_1 Lhca5 protein [Arabidopsis thaliana]
Length=256

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  210  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  251



>ref|XP_010500206.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Camelina 
sativa]
Length=256

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  210  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  251



>ref|XP_010479098.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Camelina sativa]
Length=256

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  210  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  251



>ref|XP_010059937.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Eucalyptus 
grandis]
 gb|KCW66425.1| hypothetical protein EUGRSUZ_F00228 [Eucalyptus grandis]
Length=270

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ +VT  GP DNL++HLSDPWH TI+QTL
Sbjct  224  GRLAMVAMLGIFVQASVTHAGPIDNLVEHLSDPWHRTIIQTL  265



>ref|XP_010108606.1| Chlorophyll a-b binding protein P4 [Morus notabilis]
 gb|EXC19762.1| Chlorophyll a-b binding protein P4 [Morus notabilis]
Length=264

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM+A LG  VQ +VT  GP DNL++HLSDPWH TIVQTL 
Sbjct  218  GRLAMMAMLGIFVQASVTHVGPVDNLVEHLSDPWHKTIVQTLA  260



>gb|AAM65689.1| light-harvesting complex protein [Arabidopsis thaliana]
Length=256

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  210  GRLAMMAMLGFFVQASVTHTGPIDNLVEHLSNPWHXTIIQTL  251



>ref|XP_004291112.2| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=265

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA  150
            GRLAM+A LG  VQ +VT  GP DNLL HLSDPWH TIVQTL   G+
Sbjct  219  GRLAMVAMLGMFVQASVTHAGPVDNLLLHLSDPWHRTIVQTLANSGS  265



>ref|XP_012071664.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Jatropha curcas]
 gb|KDP38340.1| hypothetical protein JCGZ_04265 [Jatropha curcas]
Length=264

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM+A LG  VQ  VT  GP DNL++HLS PWHNTIVQTL 
Sbjct  221  GRLAMVAMLGIFVQAAVTHAGPIDNLVKHLSSPWHNTIVQTLA  263



>gb|EYU25420.1| hypothetical protein MIMGU_mgv1a011943mg [Erythranthe guttata]
Length=266

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ  159
            GRLAM+A +GF VQ NVT  GP +NL++HLS+PWH TI+QT+ Q
Sbjct  220  GRLAMMAMVGFFVQANVTHVGPIENLIKHLSNPWHTTIIQTMVQ  263



>gb|KFK36161.1| hypothetical protein AALP_AA4G086000 [Arabis alpina]
Length=257

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL++HLS+PWH TI+Q L
Sbjct  212  GRLAMMAMLGFFVQASVTHTGPIDNLIEHLSNPWHKTIIQAL  253



>ref|XP_006305539.1| hypothetical protein CARUB_v10010062mg [Capsella rubella]
 gb|EOA38437.1| hypothetical protein CARUB_v10010062mg [Capsella rubella]
Length=257

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP +NL++HLS+PWH TI+QTL
Sbjct  212  GRLAMMAMLGFFVQASVTHTGPIENLVEHLSNPWHKTIIQTL  253



>ref|XP_010538121.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Tarenaya 
hassleriana]
Length=255

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ +VT  GP DNL+ HLS+PWH TI+QTL
Sbjct  209  GRLAMIAMLGFFVQASVTHVGPIDNLVDHLSNPWHKTIIQTL  250



>ref|XP_010461501.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Camelina sativa]
Length=256

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+  LGF VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  210  GRLAMMVMLGFFVQASVTHTGPIDNLVEHLSNPWHKTIIQTL  251



>gb|AFK43193.1| unknown [Lotus japonicus]
Length=213

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA  150
            GRLAM+A LG  VQ +VT  GP DNL++HLS+PWH T++QTL   G+
Sbjct  167  GRLAMVAILGIFVQASVTHVGPIDNLVEHLSNPWHKTVIQTLASSGS  213



>ref|XP_006828393.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Amborella trichopoda]
 gb|ERM95809.1| hypothetical protein AMTR_s00060p00031820 [Amborella trichopoda]
Length=260

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM+A +G  VQ +VT  GP DNL++HLS+PWH T++QTLG
Sbjct  215  GRLAMVAMIGIFVQASVTHTGPVDNLIKHLSNPWHTTVIQTLG  257



>gb|AFK47516.1| unknown [Lotus japonicus]
Length=266

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA  150
            GRLAM+A LG  VQ +VT  GP DNL++HLS+PWH T++QTL   G+
Sbjct  220  GRLAMVAILGIFVQASVTHVGPIDNLVEHLSNPWHKTVIQTLASSGS  266



>ref|XP_002961446.1| light-harvesting complex [Selaginella moellendorffii]
 ref|XP_002971365.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ27963.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ36706.1| light-harvesting complex [Selaginella moellendorffii]
Length=250

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ   T  GP DNLL H+SDPWHNTIVQTL
Sbjct  206  GRLAMVAILGVFVQAFFTKTGPIDNLLTHVSDPWHNTIVQTL  247



>ref|XP_011029950.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Populus 
euphratica]
Length=267

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = -3

Query  392  VKP*LPSNSMINLMGYP---NAAYL*KLCNLWGVCFAGRLAMLAFLGFIVQHNVTGKGPF  222
            ++P  P   ++N +G      +A++ KL  +      GRLAM+A +G  VQ  VT  GP 
Sbjct  188  LEPGYPGGPLLNPLGLARDIESAHVWKLKEIKN----GRLAMVAMVGIFVQAAVTHAGPI  243

Query  221  DNLLQHLSDPWHNTIVQTLGQ*GA  150
            DNL++HLS+PWH TI+QTL   G+
Sbjct  244  DNLIEHLSNPWHRTIIQTLANSGS  267



>ref|XP_007017245.1| Light-harvesting complex I protein Lhca5 isoform 1 [Theobroma 
cacao]
 gb|EOY14470.1| Light-harvesting complex I protein Lhca5 isoform 1 [Theobroma 
cacao]
Length=264

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ  VT  GP DNL++HLS+PWH TI+QTL
Sbjct  218  GRLAMIAMLGIFVQAYVTHAGPIDNLVEHLSNPWHKTIIQTL  259



>ref|XP_006374944.1| chlorophyll A-B binding family protein [Populus trichocarpa]
 gb|ERP52741.1| chlorophyll A-B binding family protein [Populus trichocarpa]
Length=266

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA  150
            GRLAM+A +G  VQ  VT  GP DNL++HLS+PWH TI+QTL   G+
Sbjct  220  GRLAMVAMVGIFVQAAVTHAGPIDNLIEHLSNPWHRTIIQTLANSGS  266



>gb|KEH17644.1| hypothetical protein MTR_0003s0070 [Medicago truncatula]
Length=85

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  251  QHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            QH+VTGKG FDNLLQHLSDPWHNTIVQTL
Sbjct  53   QHSVTGKGRFDNLLQHLSDPWHNTIVQTL  81



>ref|XP_003528272.2| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Glycine max]
 gb|KHN22319.1| Chlorophyll a-b binding protein 7, chloroplastic [Glycine soja]
Length=285

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ +VT  GP DNL++HLS+PWH TI+QTL
Sbjct  239  GRLAMVAMLGIFVQASVTHVGPIDNLVEHLSNPWHKTIIQTL  280



>ref|XP_008220221.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Prunus mume]
Length=266

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ ++T  GP DNL++HLS+PWH TIVQTL
Sbjct  220  GRLAMVAMLGIFVQASITHVGPIDNLMEHLSNPWHRTIVQTL  261



>gb|KJB14576.1| hypothetical protein B456_002G132100 [Gossypium raimondii]
Length=160

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM+A LG  VQ  VT  GP DNL++HLS+PW  TI+QTL 
Sbjct  114  GRLAMIAMLGIFVQAYVTHAGPIDNLVEHLSNPWQKTIIQTLA  156



>ref|XP_010675790.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=265

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ +VT  GP +NL+QHLSDPWH TI+ TL
Sbjct  219  GRLAMIAMLGLFVQAHVTHTGPIENLVQHLSDPWHKTIIHTL  260



>ref|XP_004501571.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Cicer arietinum]
Length=266

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ  159
            GRLAM+A LG  +Q +VT  GP DNL++HLS+PWH TI+QTL  
Sbjct  220  GRLAMVAILGIFIQASVTHVGPIDNLVEHLSNPWHKTIIQTLAS  263



>ref|XP_007222188.1| hypothetical protein PRUPE_ppa010039mg [Prunus persica]
 gb|EMJ23387.1| hypothetical protein PRUPE_ppa010039mg [Prunus persica]
Length=266

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM+A LG  VQ ++T  GP DNL++HLS+PWH TIVQTL 
Sbjct  220  GRLAMVAMLGIFVQASITHVGPIDNLVEHLSNPWHRTIVQTLA  262



>ref|XP_004150882.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Cucumis 
sativus]
 gb|KGN62506.1| hypothetical protein Csa_2G357290 [Cucumis sativus]
Length=259

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ  VT  GP DNL++HLS+PWH TI+QTL
Sbjct  213  GRLAMVAMLGIFVQAYVTHTGPIDNLVEHLSNPWHKTIIQTL  254



>ref|XP_005849804.1| hypothetical protein CHLNCDRAFT_59626 [Chlorella variabilis]
 gb|EFN57702.1| hypothetical protein CHLNCDRAFT_59626 [Chlorella variabilis]
Length=249

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  308  WGVCFAGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHN  183
            W     GRLAM+AFLGF+ QH  TGKGP DNL  HL+DPW N
Sbjct  194  WREIRNGRLAMMAFLGFLAQHAATGKGPLDNLADHLADPWAN  235



>gb|AHM26631.1| a-b binding protein [Pyrus x bretschneideri]
Length=1217

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI  177
            GRLAM+A LGF VQ +VT  GP DNLL+HLS+PWH TI
Sbjct  850  GRLAMVAMLGFFVQASVTHVGPIDNLLEHLSNPWHRTI  887



>ref|XP_008444623.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Cucumis melo]
Length=260

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ  159
            GRLAM+A LG  VQ  VT  GP DNL++HLS+PWH TI+QTL  
Sbjct  214  GRLAMVAMLGIFVQAYVTHTGPIDNLVEHLSNPWHKTIIQTLSS  257



>ref|XP_009630364.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Nicotiana tomentosiformis]
Length=265

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ +VT  GP DNL++HLS+PWH TI+QT+
Sbjct  219  GRLAMVAMLGIFVQASVTHVGPIDNLVEHLSNPWHKTIIQTI  260



>ref|XP_001780681.1| predicted protein [Physcomitrella patens]
 gb|EDQ54465.1| predicted protein, partial [Physcomitrella patens]
Length=208

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = -3

Query  377  PSNSMINLMGYPNAAYL*KLCNLWGVCFAGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLS  198
            P   + N +G+ N     +    W     GRLAM+A +GF+VQ  VT  GP +NLL HLS
Sbjct  137  PGGPLFNPLGFANDPTKPQPLR-WKEIKNGRLAMVAMVGFMVQAYVTKTGPIENLLTHLS  195

Query  197  DPWHNTIVQTL  165
            DP HNTI+Q +
Sbjct  196  DPVHNTIIQRI  206



>ref|XP_007136682.1| hypothetical protein PHAVU_009G064900g [Phaseolus vulgaris]
 gb|ESW08676.1| hypothetical protein PHAVU_009G064900g [Phaseolus vulgaris]
Length=264

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM+A LG  VQ +VT  GP DNL++HLS+PWH T++QT+ 
Sbjct  218  GRLAMVAMLGIFVQASVTHVGPIDNLVEHLSNPWHKTVIQTIA  260



>ref|XP_011399967.1| Chlorophyll a-b binding protein 4, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27011.1| Chlorophyll a-b binding protein 4, chloroplastic [Auxenochlorella 
protothecoides]
Length=214

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIV  174
            GRLAMLAFLGF+ Q   TGKGP  NL +H+ DPWHN   
Sbjct  164  GRLAMLAFLGFVAQAKATGKGPITNLFEHIGDPWHNNFT  202



>ref|XP_009760096.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ*GA  150
            GRLAM+A  G  VQ +VT  GP DNL++HLS+PWH TI+QT+   G+
Sbjct  219  GRLAMVAMFGIFVQASVTHVGPIDNLVEHLSNPWHKTIIQTISASGS  265



>dbj|BAK01456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=78

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGFIVQ +VT  GP DNLL HLSDP++  I+  L
Sbjct  34   GRLAMVAMLGFIVQASVTHAGPIDNLLTHLSDPFNKNIIHAL  75



>ref|XP_006343439.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Solanum tuberosum]
Length=266

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ +VT  GP DNL++HLS+PWH TI+QT+
Sbjct  220  GRLAMVAMLGIFVQSSVTHVGPIDNLIEHLSNPWHKTILQTI  261



>ref|XP_006660507.1| PREDICTED: chlorophyll a-b binding protein E, chloroplastic-like 
[Oryza brachyantha]
Length=164

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQT  168
            GRLAM+A+LGF +Q  VTGKGP  NL++HLSDP HN I+ +
Sbjct  122  GRLAMVAWLGFYIQAAVTGKGPIQNLVEHLSDPLHNNILSS  162



>emb|CAA06961.1| chlorophyll a/b-binding protein [Hordeum vulgare subsp. vulgare]
Length=75

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ  159
             RLAM+AFLGF VQ   TGKGP +N   HLSDP H TI  T G 
Sbjct  31   ARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIFDTFGS  74



>gb|ABN10530.1| Lhca5 protein [Gentiana lutea]
Length=272

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ +VT  GP +NL++HLSDPWH TI+Q L
Sbjct  226  GRLAMVAILGIFVQASVTHVGPLENLVEHLSDPWHTTIIQIL  267



>ref|XP_002284724.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Vitis 
vinifera]
 emb|CBI19523.3| unnamed protein product [Vitis vinifera]
Length=264

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ +VT  GP +NL++HLS+PWH TI+QT+
Sbjct  219  GRLAMVAMLGVFVQASVTHAGPIENLVEHLSNPWHKTIIQTI  260



>ref|XP_010939425.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Elaeis 
guineensis]
Length=269

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF VQ  VT  GP DNLL HLSDP++ TI+QTL
Sbjct  223  GRLAMIAMLGFFVQAQVTHVGPIDNLLTHLSDPFNKTIIQTL  264



>ref|XP_003603038.1| Chlorophyll a-b binding protein [Medicago truncatula]
 gb|AES73289.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=267

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ  159
            GRLAM+A LG  VQ +VT  GP DNL++HLS+PWH TI+Q L  
Sbjct  221  GRLAMVAILGIFVQASVTHVGPIDNLVEHLSNPWHKTIIQILAS  264



>gb|ABK95186.1| unknown [Populus trichocarpa]
Length=142

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
             RLAM+AFLGF VQ  VTGKGP +N   HLSDP H TI+ TL
Sbjct  99   ARLAMVAFLGFAVQAWVTGKGPLNNWATHLSDPLHTTIIDTL  140



>ref|XP_009616189.1| PREDICTED: uncharacterized protein LOC104108775 [Nicotiana tomentosiformis]
Length=105

 Score = 50.1 bits (118),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDN  216
            GRLAMLAFLGFIVQHNV  KGPFD+
Sbjct  39   GRLAMLAFLGFIVQHNVVAKGPFDS  63


 Score = 32.7 bits (73),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 24/42 (57%), Gaps = 7/42 (17%)
 Frame = -1

Query  196  THGTTPLCKHWVSEGLKVDGNQREDVVYVVVTM-----NRAL  86
            THGTTPLCKH  S   K  GN  E +V +V  +     NRAL
Sbjct  65   THGTTPLCKH--SATRKPHGNWIEYIVTLVTMLWFLIKNRAL  104



>gb|AFA36569.1| putative chlorophyll a/b-binding protein, partial [Lolium perenne]
Length=206

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF VQ  VTGKGP  NL++HLSDP HN I+ + 
Sbjct  164  GRLAMVAWLGFYVQAAVTGKGPVQNLIEHLSDPLHNNILSSF  205



>gb|KJB14575.1| hypothetical protein B456_002G132100 [Gossypium raimondii]
Length=265

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM+A LG  VQ  VT  GP DNL++HLS+PW  TI+QTL 
Sbjct  219  GRLAMIAMLGIFVQAYVTHAGPIDNLVEHLSNPWQKTIIQTLA  261



>gb|KHG00964.1| Chlorophyll a-b binding P4, chloroplastic [Gossypium arboreum]
Length=265

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM+A LG  VQ  VT  GP DNL++HLS+PW  TI+QTL 
Sbjct  219  GRLAMIAMLGIFVQAYVTHAGPIDNLVEHLSNPWQKTIIQTLA  261



>ref|XP_009412442.1| PREDICTED: chlorophyll a-b binding protein CP29.2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=288

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+AFLGF VQ  VTGKGP +N   HLSDP H TI+ T 
Sbjct  244  GRLAMVAFLGFAVQAAVTGKGPLNNWATHLSDPLHTTIIDTF  285



>ref|XP_004242951.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Solanum 
lycopersicum]
Length=262

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ +VT  GP DNL+ HLS+PWH TI+QT+
Sbjct  216  GRLAMVAMLGIFVQASVTHVGPIDNLIDHLSNPWHKTILQTI  257



>gb|EAZ44119.1| hypothetical protein OsJ_28744 [Oryza sativa Japonica Group]
Length=245

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  VTGKGP  NL++HLSDP HN I+ + 
Sbjct  203  GRLAMVAWLGFYIQAAVTGKGPIQNLVEHLSDPLHNNILSSF  244



>gb|EMS60898.1| Chlorophyll a-b binding protein CP29.2, chloroplastic [Triticum 
urartu]
Length=206

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ  159
             RLAM+AFLGF VQ   TGKGP +N   HLSDP H TI  TLG 
Sbjct  162  ARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIFDTLGS  205



>emb|CBL86548.1| chlorophyll a/b binding protein [Olea europaea]
Length=179

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
             RLAM+AFLGF VQ   TGKGP +N   HLSDP H TI+ T G
Sbjct  134  ARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTILDTFG  176



>emb|CDP07244.1| unnamed protein product [Coffea canephora]
Length=330

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF VQ  VTGKGP  NLL H+SDP HN IV  L
Sbjct  286  GRLAMVAWLGFYVQAAVTGKGPVQNLLDHISDPIHNNIVSFL  327



>gb|EAZ08502.1| hypothetical protein OsI_30775 [Oryza sativa Indica Group]
Length=321

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  VTGKGP  NL++HLSDP HN I+ + 
Sbjct  279  GRLAMVAWLGFYIQAAVTGKGPIQNLVEHLSDPLHNNILSSF  320



>gb|ABD37906.1| light-harvesting chlorophyll-a/b binding protein Lhca4 [Chlamydomonas 
incerta]
Length=237

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWH  186
            GRLAMLAFLGF+ Q   TG GP DNL+ HL DPWH
Sbjct  190  GRLAMLAFLGFVAQKYATGAGPVDNLVAHLKDPWH  224



>ref|NP_001062801.1| Os09g0296800 [Oryza sativa Japonica Group]
 dbj|BAD33211.1| putative chlorophyll a/b-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF24715.1| Os09g0296800 [Oryza sativa Japonica Group]
Length=321

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  VTGKGP  NL++HLSDP HN I+ + 
Sbjct  279  GRLAMVAWLGFYIQAAVTGKGPIQNLVEHLSDPLHNNILSSF  320



>gb|AAF44703.1|AF241525_1 chlorophyll a/b-binding protein type III [Alonsoa meridionalis]
Length=193

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHN  183
            GRLAMLA LG+ +Q  VTG GPF NLL HL+DPWHN
Sbjct  158  GRLAMLAILGYFIQGLVTGVGPFQNLLDHLADPWHN  193



>ref|XP_004238472.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Solanum 
lycopersicum]
Length=318

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF VQ  +TGKGP  NLL+H+SDP+HN ++  L
Sbjct  274  GRLAMVAWLGFYVQAALTGKGPVQNLLEHISDPFHNNLLSIL  315



>gb|AHM26630.1| a-b binding protein [Pyrus x bretschneideri]
Length=142

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIV  174
             RLAM+AFLGF VQ  VTGKGP +N   HLSDP H TI+
Sbjct  99   ARLAMVAFLGFAVQAAVTGKGPLNNWATHLSDPLHTTII  137



>ref|XP_006342200.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Solanum tuberosum]
Length=318

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF VQ  +TGKGP  NLL+H+SDP+HN ++  L
Sbjct  274  GRLAMVAWLGFYVQAALTGKGPVQNLLEHISDPFHNNLLSIL  315



>ref|XP_011041127.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic isoform 
X3 [Populus euphratica]
Length=314

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  +TGKGP +NL++H+SDP HN +  TL
Sbjct  270  GRLAMVAWLGFYIQAALTGKGPVENLVEHISDPLHNNLFSTL  311



>ref|XP_003622415.1| Chlorophyll a-b binding protein [Medicago truncatula]
Length=249

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  251  QHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            QHNVTGKG FDNLLQHLSDPW NTIVQTL 
Sbjct  217  QHNVTGKGRFDNLLQHLSDPWQNTIVQTLS  246



>ref|XP_002945875.1| light harvesting complex a protein [Volvox carteri f. nagariensis]
 gb|AAD55568.1|AF110786_1 light harvesting complex a protein [Volvox carteri f. nagariensis]
 gb|EFJ52870.1| light harvesting complex a protein [Volvox carteri f. nagariensis]
Length=243

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWH  186
            GRLAM+AFLGF  Q   TGKGP DNL  HL+DPWH
Sbjct  196  GRLAMVAFLGFTAQKFATGKGPIDNLAAHLADPWH  230



>ref|XP_002307004.1| chlorophyll A-B binding family protein [Populus trichocarpa]
 gb|EEE94000.1| chlorophyll A-B binding family protein [Populus trichocarpa]
Length=338

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  +TGKGP +NL++H+SDP HN +  TL
Sbjct  294  GRLAMVAWLGFYIQAALTGKGPVENLVEHISDPLHNNLFSTL  335



>tpg|DAA05918.1| TPA_inf: chloroplast light-harvesting complex I protein precursor 
Lhca3 [Mesostigma viride]
Length=278

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = -3

Query  386  P*LPSNSMINLMGYP------NAAYL*KLCNLWGVCFAGRLAMLAFLGFIVQHNVTGKGP  225
            P  P  ++ N +GY       N   L +L N       GRLAM+A LGF +Q   TG+GP
Sbjct  199  PSYPGGAIFNFLGYGKDEKSMNDLKLKELKN-------GRLAMVATLGFFIQAMATGEGP  251

Query  224  FDNLLQHLSDPWHNTIVQTLGQ*G  153
            F NL  HL+DP++N I+ T G+ G
Sbjct  252  FQNLTDHLADPFNNNILTTFGKIG  275



>gb|AFW73580.1| hypothetical protein ZEAMMB73_964613 [Zea mays]
Length=158

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGF+VQ +VT  GP DNLL HLSDP++  I+ T 
Sbjct  114  GRLAMVAMLGFMVQASVTHAGPIDNLLTHLSDPFNKNIIHTF  155



>ref|XP_010558381.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Tarenaya hassleriana]
Length=286

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            RLAM+AFLGF VQ   TGKGP DN   HLSDP H TI+ T 
Sbjct  244  RLAMVAFLGFAVQAAATGKGPLDNWATHLSDPLHTTIIDTF  284



>ref|XP_010537249.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Tarenaya 
hassleriana]
Length=323

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF  Q  VTGKGP  NLL+H+SDP HN I+  L
Sbjct  280  GRLAMVAWLGFYAQAAVTGKGPVQNLLEHISDPLHNNILAIL  321



>ref|XP_008797264.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Phoenix 
dactylifera]
Length=270

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ  VT  GP DNLL HLSDP+  TI+QTL
Sbjct  224  GRLAMIAMLGIFVQARVTHVGPIDNLLTHLSDPFKKTIIQTL  265



>ref|XP_011041125.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic isoform 
X1 [Populus euphratica]
Length=345

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  +TGKGP +NL++H+SDP HN +  TL
Sbjct  301  GRLAMVAWLGFYIQAALTGKGPVENLVEHISDPLHNNLFSTL  342



>ref|XP_011041126.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic isoform 
X2 [Populus euphratica]
Length=338

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  +TGKGP +NL++H+SDP HN +  TL
Sbjct  294  GRLAMVAWLGFYIQAALTGKGPVENLVEHISDPLHNNLFSTL  335



>ref|XP_002459987.1| hypothetical protein SORBIDRAFT_02g020290 [Sorghum bicolor]
 gb|EER96508.1| hypothetical protein SORBIDRAFT_02g020290 [Sorghum bicolor]
Length=314

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  VTGKGP  NL++HLSDP HN I+ + 
Sbjct  272  GRLAMVAWLGFYIQAAVTGKGPVQNLVEHLSDPLHNNILSSF  313



>gb|ABD37880.1| light-harvesting chlorophyll-a/b binding protein Lhca3 [Mesostigma 
viride]
Length=300

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = -3

Query  386  P*LPSNSMINLMGYP------NAAYL*KLCNLWGVCFAGRLAMLAFLGFIVQHNVTGKGP  225
            P  P  ++ N +GY       N   L +L N       GRLAM+A LGF +Q   TG+GP
Sbjct  221  PSYPGGAIFNFLGYGKDEKSMNDLKLKELKN-------GRLAMVATLGFFIQAMATGEGP  273

Query  224  FDNLLQHLSDPWHNTIVQTLGQ*G  153
            F NL  HL+DP++N I+ T G+ G
Sbjct  274  FQNLTDHLADPFNNNILTTFGKIG  297



>ref|XP_002323575.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
 gb|EEF05336.1| chlorophyll a/b binding protein CP29 [Populus trichocarpa]
Length=283

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            RLAM+AFLGF VQ  VTGKGP +N   HLSDP H TI+ TL
Sbjct  241  RLAMVAFLGFAVQAWVTGKGPLNNWATHLSDPLHTTIIDTL  281



>ref|XP_011014743.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=283

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            RLAM+AFLGF VQ  VTGKGP +N   HLSDP H TI+ TL
Sbjct  241  RLAMVAFLGFAVQAWVTGKGPLNNWATHLSDPLHTTIIDTL  281



>ref|NP_001048216.1| Os02g0764500 [Oryza sativa Japonica Group]
 dbj|BAD17114.1| putative light-harvesting chlorophyll-a/b protein of photosystem 
I [Oryza sativa Japonica Group]
 dbj|BAF10130.1| Os02g0764500 [Oryza sativa Japonica Group]
 dbj|BAG89895.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57857.1| hypothetical protein OsJ_08493 [Oryza sativa Japonica Group]
Length=261

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGFIVQ +VT  GP DNLL HLSDP++  I+ TL
Sbjct  217  GRLAMVAMLGFIVQASVTHVGPIDNLLTHLSDPFNKNIIHTL  258



>ref|XP_001758295.1| predicted protein [Physcomitrella patens]
 gb|EDQ76697.1| predicted protein [Physcomitrella patens]
Length=270

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLA LG  VQ NVT  GP DNL  HL+DP+H TI+Q+L
Sbjct  226  GRLAMLAVLGAFVQANVTHVGPIDNLFAHLADPYHTTILQSL  267



>gb|ABK96503.1| unknown [Populus trichocarpa x Populus deltoides]
Length=283

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            RLAM+AFLGF VQ  VTGKGP +N   HLSDP H TI+ TL
Sbjct  241  RLAMVAFLGFAVQAWVTGKGPLNNWATHLSDPLHTTIIDTL  281



>gb|EEC74057.1| hypothetical protein OsI_09055 [Oryza sativa Indica Group]
Length=261

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGFIVQ +VT  GP DNLL HLSDP++  I+ TL
Sbjct  217  GRLAMVAMLGFIVQASVTHVGPIDNLLTHLSDPFNKNIIHTL  258



>ref|XP_001696202.1| light-harvesting protein of photosystem I [Chlamydomonas reinhardtii]
 dbj|BAD06921.1| light-harvesting chlorophyll-a/b protein of photosystem I [Chlamydomonas 
reinhardtii]
 gb|EDP08179.1| light-harvesting protein of photosystem I [Chlamydomonas reinhardtii]
Length=243

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWH  186
            GRLAMLAFLGF+ Q   TG GP DNL  HL DPWH
Sbjct  196  GRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWH  230



>ref|XP_011047451.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Populus euphratica]
 ref|XP_011014741.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=283

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            RLAM+AFLGF VQ  VTGKGP +N   HLSDP H TI+ TL
Sbjct  241  RLAMVAFLGFAVQAWVTGKGPLNNWATHLSDPLHTTIIDTL  281



>gb|EMT21651.1| Chlorophyll a-b binding protein CP29.2, chloroplastic [Aegilops 
tauschii]
Length=286

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGQ  159
            RLAM+AFLGF VQ   TGKGP +N   HLSDP H TI  TLG 
Sbjct  243  RLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIFDTLGS  285



>ref|XP_010270018.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Nelumbo 
nucifera]
Length=261

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LG  VQ  VT  GP DNL+ HLS+PWH T++Q L
Sbjct  215  GRLAMVAMLGIFVQAYVTHAGPIDNLVTHLSNPWHRTVIQIL  256



>ref|XP_004956497.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Setaria italica]
Length=317

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  VTGKGP  NL++HLSDP HN I+ + 
Sbjct  275  GRLAMVAWLGFYIQAAVTGKGPVQNLVEHLSDPVHNNILSSF  316



>gb|KCW68163.1| hypothetical protein EUGRSUZ_F01826 [Eucalyptus grandis]
Length=250

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF VQ  +TGKGP  NLL+H+SDP HN +   L
Sbjct  206  GRLAMVAWLGFYVQAALTGKGPIQNLLEHISDPLHNNLFSVL  247



>gb|AEO51756.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=286

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            RLAM+ FLGF VQ  VTGKGP +N   HLSDP H TI+ TL
Sbjct  244  RLAMVGFLGFAVQAAVTGKGPLNNWATHLSDPLHTTIIDTL  284



>ref|XP_010109617.1| hypothetical protein L484_015572 [Morus notabilis]
 gb|EXC23662.1| hypothetical protein L484_015572 [Morus notabilis]
Length=287

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            RLAM+AFLGF VQ  VTGKGP +N   HLSDP H TI+ T 
Sbjct  244  RLAMVAFLGFAVQAAVTGKGPLNNWATHLSDPLHTTIIDTF  284



>ref|XP_010262833.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic-like 
[Nelumbo nucifera]
Length=288

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            RLAM+AFLGF +Q  VTGKGP +N + HLSDP H TI+ T 
Sbjct  244  RLAMVAFLGFAIQAAVTGKGPLNNWVTHLSDPLHTTIIDTF  284



>ref|XP_010061245.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
 gb|KCW68160.1| hypothetical protein EUGRSUZ_F01826 [Eucalyptus grandis]
Length=333

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF VQ  +TGKGP  NLL+H+SDP HN +   L
Sbjct  289  GRLAMVAWLGFYVQAALTGKGPIQNLLEHISDPLHNNLFSVL  330



>gb|AEW08137.1| hypothetical protein 2_784_02, partial [Pinus radiata]
 gb|AFG62791.1| hypothetical protein 2_784_02, partial [Pinus taeda]
 gb|AFG62792.1| hypothetical protein 2_784_02, partial [Pinus taeda]
 gb|AFG62793.1| hypothetical protein 2_784_02, partial [Pinus taeda]
 gb|AFG62794.1| hypothetical protein 2_784_02, partial [Pinus taeda]
Length=132

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -3

Query  386  P*LPSNSMINLMGYPNAAYL*KLCNLWGVCFAGRLAMLAFLGFIVQHNVTGKGPFDNLLQ  207
            P  P   + N +G+       K   L  V   GRLAMLA LG+ +Q  VTG GPF NLL 
Sbjct  56   PAYPGGPLFNPLGFGKDEKSMKELKLKEVK-NGRLAMLAILGYFIQGLVTGVGPFQNLLD  114

Query  206  HLSDPWHNTIVQTL  165
            HL+DP++N I+  L
Sbjct  115  HLADPFNNNILTNL  128



>ref|XP_012073543.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Jatropha 
curcas]
 gb|KDP36725.1| hypothetical protein JCGZ_08016 [Jatropha curcas]
Length=337

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF  Q  +TGKGP  NLL+H+SDP+HN +   L
Sbjct  293  GRLAMVAWLGFYAQAALTGKGPVQNLLEHISDPFHNNLCSVL  334



>ref|XP_003577951.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Brachypodium 
distachyon]
Length=318

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  VTGKGP  NL++HLSDP HN I+ + 
Sbjct  276  GRLAMVAWLGFYLQAAVTGKGPVQNLVEHLSDPLHNNILSSF  317



>gb|EYU26660.1| hypothetical protein MIMGU_mgv1a011247mg [Erythranthe guttata]
Length=288

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
             RLAM+AFLGF VQ   TGKGP +N   HLSDP H TI+ T G
Sbjct  243  ARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTILDTFG  285



>ref|XP_010112887.1| Chlorophyll a-b binding protein 8 [Morus notabilis]
 gb|EXC35022.1| Chlorophyll a-b binding protein 8 [Morus notabilis]
Length=273

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLA LGF VQ  VTG GP+ NLL HL+DP HN I+ +L
Sbjct  229  GRLAMLAILGFFVQGLVTGVGPYQNLLDHLADPIHNNILTSL  270



>gb|EPS71850.1| hypothetical protein M569_02908 [Genlisea aurea]
Length=473

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            GRLAM A LGF +Q  VTGKGP DNL  HLSDP+ N ++  +G
Sbjct  422  GRLAMFAMLGFFIQAYVTGKGPVDNLASHLSDPFGNNLLTVIG  464



>ref|XP_011074048.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Sesamum 
indicum]
Length=317

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A+LGF +Q  +TGKGP  NLL H++DP HN ++ TL
Sbjct  273  GRLAMVAWLGFYIQAALTGKGPVQNLLDHIADPLHNNLLSTL  314



>dbj|BAJ98426.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91651.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87039.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAM+A LGFIVQ +VT  GP DNLL HLSDP++  I+  L
Sbjct  213  GRLAMVAMLGFIVQASVTHAGPIDNLLTHLSDPFNKNIIHAL  254



>gb|ABR25925.1| chloroplast chlorophyll a-b binding protein [Oryza sativa Indica 
Group]
Length=171

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLAFLGF VQ   TG GP  NLL HL+DP HN I+ +L
Sbjct  127  GRLAMLAFLGFSVQALFTGVGPVQNLLDHLADPVHNNILTSL  168



>gb|ABX89589.1| Lhca3 [Solanum tuberosum]
 gb|ABX89590.1| Lhca3 [Solanum tuberosum]
Length=45

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTL  165
            GRLAMLA LG+ +Q  VTG GP+ NLL HL+DP +N ++ +L
Sbjct  1    GRLAMLAILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSL  42



>gb|EPS68718.1| hypothetical protein M569_06048, partial [Genlisea aurea]
Length=283

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -3

Query  287  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
            RLAM+AFLGF VQ   TGKGP +N   HLSDP H TI  T G
Sbjct  239  RLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIFDTFG  280



>ref|XP_011095216.1| PREDICTED: chlorophyll a-b binding protein CP29.1, chloroplastic 
[Sesamum indicum]
Length=360

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  290  GRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLG  162
             RLAM+AFLGF VQ   TGKGP +N   HLSDP H TI+ T G
Sbjct  315  ARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTILDTFG  357



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2032267776884