BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1421

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001274821.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    185   6e-52   Solanum tuberosum [potatoes]
ref|XP_009784799.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    185   9e-52   Nicotiana sylvestris
ref|XP_009597845.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    185   1e-51   Nicotiana tomentosiformis
ref|XP_004236571.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    184   2e-51   Solanum lycopersicum
ref|XP_011075374.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    173   3e-47   Sesamum indicum [beniseed]
gb|EYU20786.1|  hypothetical protein MIMGU_mgv1a007085mg                172   4e-47   Erythranthe guttata [common monkey flower]
ref|XP_010672937.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    172   5e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011078942.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    171   2e-46   Sesamum indicum [beniseed]
ref|XP_010102703.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    170   3e-46   Morus notabilis
ref|XP_009346976.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    170   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_008373011.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    170   3e-46   
gb|EYU18679.1|  hypothetical protein MIMGU_mgv1a007110mg                170   4e-46   Erythranthe guttata [common monkey flower]
ref|XP_008240755.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    169   1e-45   Prunus mume [ume]
ref|XP_007215436.1|  hypothetical protein PRUPE_ppa006193mg             169   1e-45   Prunus persica
ref|XP_009349656.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    168   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_008392344.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    167   3e-45   
gb|AFK37996.1|  unknown                                                 166   1e-44   Lotus japonicus
ref|XP_007222545.1|  hypothetical protein PRUPE_ppa006198mg             166   1e-44   Prunus persica
ref|XP_004303626.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    165   2e-44   Fragaria vesca subsp. vesca
ref|XP_002274738.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    165   3e-44   Vitis vinifera
ref|XP_008224408.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    165   3e-44   Prunus mume [ume]
gb|KEH33522.1|  UDP-glcnac-adolichol phosphate glcnac-1-P-transfe...    164   5e-44   Medicago truncatula
gb|KHN36406.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    164   7e-44   Glycine soja [wild soybean]
ref|NP_001241234.1|  uncharacterized protein LOC100801463               164   8e-44   Glycine max [soybeans]
ref|XP_008224412.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    163   1e-43   Prunus mume [ume]
gb|EPS69334.1|  hypothetical protein M569_05432                         162   2e-43   Genlisea aurea
ref|XP_010056578.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    162   2e-43   Eucalyptus grandis [rose gum]
ref|XP_004516363.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    162   2e-43   Cicer arietinum [garbanzo]
ref|XP_006421198.1|  hypothetical protein CICLE_v10005020mg             162   5e-43   Citrus clementina [clementine]
emb|CDP14191.1|  unnamed protein product                                161   7e-43   Coffea canephora [robusta coffee]
ref|XP_003535894.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    161   7e-43   Glycine max [soybeans]
gb|KEH17477.1|  UDP-glcnac-adolichol phosphate glcnac-1-P-transfe...    161   8e-43   Medicago truncatula
gb|AFK44971.1|  unknown                                                 161   8e-43   Medicago truncatula
gb|KDO42332.1|  hypothetical protein CISIN_1g014480mg                   160   1e-42   Citrus sinensis [apfelsine]
ref|XP_006491510.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    160   1e-42   Citrus sinensis [apfelsine]
ref|XP_007145569.1|  hypothetical protein PHAVU_007G249500g             158   9e-42   Phaseolus vulgaris [French bean]
gb|ACU24599.1|  unknown                                                 158   1e-41   Glycine max [soybeans]
ref|XP_008449205.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    157   2e-41   Cucumis melo [Oriental melon]
ref|XP_011653758.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    157   2e-41   Cucumis sativus [cucumbers]
emb|CDX76041.1|  BnaA04g03050D                                          156   3e-41   
ref|XP_002322650.1|  UDP-GLCNAC:DOLICHOL PHOSPHATE GLCNAC-1-P TRA...    157   4e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011033163.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    157   4e-41   Populus euphratica
emb|CDY30973.1|  BnaC04g24510D                                          156   4e-41   Brassica napus [oilseed rape]
ref|XP_011027325.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    156   6e-41   Populus euphratica
gb|KFK34957.1|  hypothetical protein AALP_AA5G216000                    156   7e-41   Arabis alpina [alpine rockcress]
ref|XP_009139045.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    155   7e-41   Brassica rapa
ref|XP_011626535.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    155   1e-40   Amborella trichopoda
ref|XP_002876403.1|  hypothetical protein ARALYDRAFT_907180             155   1e-40   Arabidopsis lyrata subsp. lyrata
gb|KJB35917.1|  hypothetical protein B456_006G134300                    151   2e-40   Gossypium raimondii
ref|XP_010544355.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    155   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_010427590.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    154   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002308006.2|  hypothetical protein POPTR_0006s04420g             154   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010504649.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    154   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006291106.1|  hypothetical protein CARUB_v10017217mg             154   4e-40   
ref|XP_010516334.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    153   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006396060.1|  hypothetical protein EUTSA_v10007732mg             152   8e-40   
ref|XP_009116428.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    153   9e-40   Brassica rapa
emb|CDY06123.1|  BnaA09g36570D                                          152   1e-39   
ref|XP_008776982.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    152   1e-39   Phoenix dactylifera
ref|NP_191281.1|  Glycosyl transferase family 4 protein                 152   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012085942.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    152   2e-39   Jatropha curcas
gb|KCW90100.1|  hypothetical protein EUGRSUZ_A02296                     152   2e-39   Eucalyptus grandis [rose gum]
ref|XP_010921906.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    152   2e-39   Elaeis guineensis
ref|XP_006402897.1|  hypothetical protein EUTSA_v10005999mg             152   2e-39   Eutrema salsugineum [saltwater cress]
ref|XP_006396061.1|  hypothetical protein EUTSA_v10007732mg             151   3e-39   Eutrema salsugineum [saltwater cress]
gb|KJB35919.1|  hypothetical protein B456_006G134300                    150   5e-39   Gossypium raimondii
ref|XP_002879934.1|  hypothetical protein ARALYDRAFT_483226             151   5e-39   
ref|XP_007028608.1|  UDP-glcnac-adolichol phosphate glcnac-1-p-tr...    150   5e-39   Theobroma cacao [chocolate]
ref|XP_010251963.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    149   6e-39   
gb|KDO42331.1|  hypothetical protein CISIN_1g014480mg                   150   6e-39   Citrus sinensis [apfelsine]
gb|EMS64138.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    149   8e-39   Triticum urartu
ref|XP_010525507.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    150   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_002530099.1|  glucosaminephosphotransferase, putative            150   1e-38   
gb|ADE76135.1|  unknown                                                 150   1e-38   Picea sitchensis
gb|KFK36996.1|  hypothetical protein AALP_AA4G198800                    150   1e-38   Arabis alpina [alpine rockcress]
gb|AAM61102.1|  putative UDP-N-acetylglucosamine-dolichyl-phospha...    150   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001780524.1|  predicted protein                                  146   1e-38   
ref|NP_565950.1|  UDP-GlcNAc:dolichol phosphate N-acetylglucosami...    150   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411415.1|  hypothetical protein EUTSA_v10016688mg             149   2e-38   Eutrema salsugineum [saltwater cress]
emb|CDX79934.1|  BnaA05g02220D                                          149   2e-38   
ref|XP_009142749.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    149   2e-38   Brassica rapa
ref|XP_006411416.1|  hypothetical protein EUTSA_v10016688mg             149   2e-38   
ref|XP_009384591.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    149   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY23846.1|  BnaC04g01910D                                          149   2e-38   Brassica napus [oilseed rape]
dbj|BAJ92673.1|  predicted protein                                      149   3e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003562516.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    148   4e-38   Brachypodium distachyon [annual false brome]
ref|XP_010244857.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    147   5e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006658923.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    146   6e-38   Oryza brachyantha
ref|XP_010517642.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    148   7e-38   Camelina sativa [gold-of-pleasure]
ref|XP_004958590.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    147   8e-38   Setaria italica
gb|EAZ05022.1|  hypothetical protein OsI_27203                          147   1e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_010505933.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    147   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010508713.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    147   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006294271.1|  hypothetical protein CARUB_v10023269mg             147   2e-37   Capsella rubella
ref|NP_001142327.1|  hypothetical protein                               146   3e-37   Zea mays [maize]
ref|XP_002971204.1|  hypothetical protein SELMODRAFT_94941              142   3e-37   
ref|XP_002463333.1|  hypothetical protein SORBIDRAFT_02g041960          145   6e-37   Sorghum bicolor [broomcorn]
ref|NP_001060535.1|  Os07g0661100                                       145   7e-37   
gb|EAZ40970.1|  hypothetical protein OsJ_25452                          145   7e-37   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147607.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    144   1e-36   Zea mays [maize]
ref|XP_002971205.1|  hypothetical protein SELMODRAFT_171816             144   1e-36   Selaginella moellendorffii
ref|XP_002961599.1|  hypothetical protein SELMODRAFT_77123              144   2e-36   Selaginella moellendorffii
tpg|DAA63995.1|  TPA: UDP-N-acetylglucosamine--dolichyl-phosphate...    143   4e-36   
gb|EMT11571.1|  hypothetical protein F775_14154                         140   2e-35   
emb|CDY70450.1|  BnaCnng68390D                                          137   2e-34   Brassica napus [oilseed rape]
ref|XP_005843853.1|  hypothetical protein CHLNCDRAFT_49159              135   1e-33   Chlorella variabilis
ref|XP_005645078.1|  hypothetical protein COCSUDRAFT_54347              131   5e-32   Coccomyxa subellipsoidea C-169
gb|KDD74929.1|  glycosyl transferase                                    130   2e-31   Helicosporidium sp. ATCC 50920
ref|XP_002950828.1|  hypothetical protein VOLCADRAFT_91192              129   4e-31   Volvox carteri f. nagariensis
ref|XP_001697886.1|  hypothetical protein CHLREDRAFT_139119             129   4e-31   Chlamydomonas reinhardtii
dbj|BAJ61158.1|  UDP-N-acetylglucosamine: dolichol phosphate N-ac...    129   6e-31   Gateway binary vector pGWB701
gb|KIZ07810.1|  hypothetical protein MNEG_0134                          127   1e-30   Monoraphidium neglectum
ref|XP_002501977.1|  predicted protein                                  125   3e-30   Micromonas commoda
ref|XP_002680053.1|  predicted protein                                  125   4e-30   Naegleria gruberi strain NEG-M
ref|XP_007515020.1|  predicted protein                                  125   1e-29   Bathycoccus prasinos
emb|CEG00038.1|  Glycosyl transferase, family 4                         124   2e-29   Ostreococcus tauri
ref|XP_009822384.1|  hypothetical protein, variant                      122   2e-29   Aphanomyces astaci
ref|XP_003082530.1|  putative U (ISS)                                   124   3e-29   
ref|XP_009822383.1|  hypothetical protein H257_01062                    123   4e-29   Aphanomyces astaci
ref|XP_002172193.1|  UDP-N-acetylglucosamine-dolichyl-phosphateN-...    123   6e-29   Schizosaccharomyces japonicus yFS275
ref|XP_008861451.1|  hypothetical protein, variant 1                    120   9e-29   Aphanomyces invadans
ref|XP_005299870.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    122   1e-28   Chrysemys picta bellii
ref|XP_010145626.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   2e-28   Eurypyga helias
ref|XP_009962690.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   2e-28   Tyto alba [Schleiereule]
ref|XP_008861450.1|  hypothetical protein H310_00430                    121   2e-28   Aphanomyces invadans
ref|XP_008615121.1|  hypothetical protein SDRG_10884                    121   2e-28   Saprolegnia diclina VS20
gb|KFW01190.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    119   2e-28   Eurypyga helias
gb|ACO10518.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    121   3e-28   Caligus rogercresseyi
sp|P0CD61.1|GPT_DICDI  RecName: Full=UDP-N-acetylglucosamine--dol...    120   4e-28   Dictyostelium discoideum
ref|XP_007910471.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   4e-28   Callorhinchus milii [Australian ghost shark]
ref|XP_009566928.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   4e-28   Cuculus canorus
ref|XP_008425918.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   5e-28   Poecilia reticulata
ref|XP_002288625.1|  udp-n-acetylglucosamin-dolichyl-phosphate : ...    120   5e-28   Thalassiosira pseudonana CCMP1335
ref|XP_007563267.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   5e-28   Poecilia formosa
ref|XP_009080521.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   5e-28   Acanthisitta chloris
ref|XP_010306250.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   5e-28   Balearica regulorum gibbericeps
ref|XP_005815465.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   5e-28   Xiphophorus maculatus
ref|XP_005922220.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   5e-28   Haplochromis burtoni
ref|XP_002730450.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   5e-28   Saccoglossus kowalevskii
ref|XP_004563989.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   5e-28   Maylandia zebra
ref|XP_006119782.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   5e-28   Pelodiscus sinensis [Chinese softshell turtle]
gb|KFO81888.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    119   5e-28   Cuculus canorus
ref|XP_009918530.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   5e-28   Haliaeetus albicilla
ref|XP_009806606.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   5e-28   Gavia stellata
ref|XP_007062456.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   6e-28   Chelonia mydas [green seaturtle]
gb|KFQ19762.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    119   6e-28   Merops nubicus
gb|KFV41369.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    119   6e-28   Gavia stellata
ref|XP_005427639.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    120   7e-28   
ref|XP_008942827.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   8e-28   Merops nubicus
ref|XP_005494718.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   8e-28   
ref|XP_002139236.1|  glycosyl transferase                               119   8e-28   Cryptosporidium muris RN66
ref|XP_003446913.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   9e-28   Oreochromis niloticus
ref|XP_005494717.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   9e-28   Zonotrichia albicollis
ref|XP_004076382.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   1e-27   Oryzias latipes [Japanese rice fish]
ref|XP_009484363.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   1e-27   Pelecanus crispus
ref|XP_003391111.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   1e-27   Amphimedon queenslandica
ref|XP_003057554.1|  predicted protein                                  119   1e-27   Micromonas pusilla CCMP1545
ref|XP_010214593.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   1e-27   Tinamus guttatus
emb|CCI49482.1|  unnamed protein product                                119   1e-27   Albugo candida
ref|XP_006890914.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   1e-27   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005187153.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   1e-27   Musca domestica
ref|XP_010126904.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   1e-27   Chlamydotis macqueenii
ref|XP_010171382.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   1e-27   Antrostomus carolinensis
gb|KFW85175.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    118   1e-27   Manacus vitellinus
ref|XP_003230162.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   1e-27   Anolis carolinensis [Carolina anole]
ref|XP_009096089.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   1e-27   
gb|KFV78816.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    118   1e-27   Struthio camelus australis
ref|XP_007441559.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   1e-27   
ref|XP_002188220.2|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   1e-27   
gb|KFP45865.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    118   2e-27   Chlamydotis macqueenii
gb|KGL88731.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    118   2e-27   Charadrius vociferus
gb|KGL78355.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    118   2e-27   Tinamus guttatus
dbj|GAM22214.1|  hypothetical protein SAMD00019534_053890               119   2e-27   Acytostelium subglobosum LB1
emb|CDW60532.1|  UDP N acetylglucosamine dolichyl phosphate             119   2e-27   Trichuris trichiura
ref|XP_010748499.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    119   2e-27   
ref|XP_009582479.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   2e-27   Fulmarus glacialis
ref|XP_010075283.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   2e-27   Pterocles gutturalis
ref|XP_009508052.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   2e-27   Phalacrocorax carbo [common cormorant]
ref|XP_009668379.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   2e-27   Struthio camelus australis
ref|XP_003293643.1|  UDP-N-acetylglucosamine-dolichyl-phosphate N...    118   2e-27   Dictyostelium purpureum
gb|ETK73671.1|  hypothetical protein L915_19433                         118   2e-27   Phytophthora parasitica
gb|KFW93759.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    117   2e-27   Phalacrocorax carbo [common cormorant]
ref|XP_008914058.1|  hypothetical protein PPTG_17919                    118   2e-27   Phytophthora parasitica INRA-310
ref|XP_008927171.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   2e-27   
gb|KFP61117.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    118   2e-27   Cariama cristata
gb|KFV74829.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    118   2e-27   Picoides pubescens
ref|XP_009701941.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   2e-27   Cariama cristata
gb|KFZ67233.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    118   2e-27   Podiceps cristatus
gb|KFW66640.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    118   2e-27   Pygoscelis adeliae
ref|XP_011600077.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   2e-27   Aquila chrysaetos canadensis
ref|XP_002897227.1|  UDP-N-acetylglucosamine-dolichyl-phosphate N...    118   2e-27   Phytophthora infestans T30-4
ref|XP_009534154.1|  hypothetical protein PHYSODRAFT_352487             118   2e-27   Phytophthora sojae
ref|XP_010007220.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   2e-27   Chaetura pelagica
ref|XP_010130039.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   2e-27   Buceros rhinoceros silvestris
ref|XP_010573231.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   2e-27   Haliaeetus leucocephalus
gb|ELT97140.1|  hypothetical protein CAPTEDRAFT_171012                  118   2e-27   Capitella teleta
gb|KFR13709.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    117   2e-27   Opisthocomus hoazin [hoatzin]
ref|XP_009936595.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   3e-27   Opisthocomus hoazin [hoatzin]
ref|XP_006037679.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   3e-27   Alligator sinensis
ref|XP_005988202.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   3e-27   Latimeria chalumnae
ref|XP_009321673.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   3e-27   Pygoscelis adeliae
gb|KFU83750.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    117   3e-27   Chaetura pelagica
ref|XP_004356507.1|  UDPN-acetylglucosamine-dolichyl-phosphate N-...    118   3e-27   Acanthamoeba castellanii str. Neff
ref|XP_009983766.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   3e-27   Tauraco erythrolophus
ref|XP_009877828.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   3e-27   Charadrius vociferus
ref|XP_005437763.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   3e-27   
ref|XP_006266894.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    118   3e-27   Alligator mississippiensis
ref|XP_005142706.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    118   3e-27   Melopsittacus undulatus
ref|XP_010289799.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   4e-27   Phaethon lepturus
ref|XP_009906620.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   4e-27   Picoides pubescens
ref|XP_002610663.1|  hypothetical protein BRAFLDRAFT_275916             117   4e-27   Branchiostoma floridae
ref|XP_005240101.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   4e-27   Falco peregrinus [peregrine]
ref|XP_009906619.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   4e-27   Picoides pubescens
ref|XP_008498102.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    117   4e-27   Calypte anna
emb|CCA20633.1|  UDPNacetylglucosaminedolichylphosphate Nacetylgl...    117   4e-27   Albugo laibachii Nc14
ref|XP_011450418.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   4e-27   Crassostrea gigas
ref|XP_006890912.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   4e-27   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KFR01418.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    117   4e-27   Nipponia nippon
gb|KDO33306.1|  hypothetical protein SPRG_02115                         117   5e-27   Saprolegnia parasitica CBS 223.65
ref|XP_006642237.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   5e-27   
ref|XP_010774923.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   5e-27   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006890913.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   5e-27   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_417845.2|  PREDICTED: UDP-N-acetylglucosamine--dolichyl-ph...    117   6e-27   Gallus gallus [bantam]
gb|KFP10497.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    117   6e-27   Egretta garzetta
ref|XP_011415481.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   6e-27   Crassostrea gigas
ref|XP_001421050.1|  predicted protein                                  117   6e-27   Ostreococcus lucimarinus CCE9901
gb|KFM00648.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    116   6e-27   Aptenodytes forsteri
ref|XP_004947975.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   7e-27   
ref|XP_010868751.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   7e-27   Esox lucius
ref|XP_001604731.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   7e-27   Nasonia vitripennis
ref|XP_010402061.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   7e-27   
ref|XP_010022908.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   7e-27   Nestor notabilis
ref|XP_009467361.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   7e-27   Nipponia nippon
gb|KFQ89292.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    116   7e-27   Phoenicopterus ruber ruber
ref|XP_004947976.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   7e-27   
emb|CDQ58600.1|  unnamed protein product                                117   7e-27   Oncorhynchus mykiss
ref|XP_010187177.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   8e-27   Mesitornis unicolor
gb|KFQ24509.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    116   8e-27   Mesitornis unicolor
ref|XP_009646369.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   8e-27   Egretta garzetta
ref|NP_001133317.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    117   8e-27   Salmo salar
ref|XP_005058606.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    117   8e-27   Ficedula albicollis
ref|XP_009959038.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   9e-27   Leptosomus discolor
ref|XP_009271861.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   9e-27   Aptenodytes forsteri
ref|XP_009872304.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   9e-27   Apaloderma vittatum
ref|XP_003386308.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   9e-27   Amphimedon queenslandica
ref|XP_008283320.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   9e-27   Stegastes partitus
ref|XP_007260565.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   9e-27   Astyanax mexicanus [blind cave fish]
ref|XP_005538009.1|  UDP-GlcNAc:dolichol phosphate N-acetylglucos...    117   9e-27   Cyanidioschyzon merolae strain 10D
ref|XP_005531162.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   1e-26   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_008556930.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   1e-26   Microplitis demolitor
ref|XP_003012372.1|  hypothetical protein ARB_01331                     114   1e-26   Trichophyton benhamiae CBS 112371
emb|CAG02872.1|  unnamed protein product                                116   1e-26   Tetraodon nigroviridis
gb|EMC78303.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    115   1e-26   
ref|XP_001624100.1|  hypothetical protein NEMVEDRAFT_v1g247774          116   1e-26   Nematostella vectensis
ref|XP_008331193.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   1e-26   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011314644.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    116   1e-26   Fopius arisanus
ref|XP_003211428.2|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    117   2e-26   Meleagris gallopavo [common turkey]
ref|XP_004346324.1|  dolichyl-phosphate acetylglucosaminephosphot...    117   2e-26   Capsaspora owczarzaki ATCC 30864
ref|XP_002108838.1|  hypothetical protein TRIADDRAFT_18613              116   2e-26   Trichoplax adhaerens
ref|XP_002722757.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   2e-26   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004456339.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   2e-26   Dasypus novemcinctus
ref|XP_008635286.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   2e-26   
ref|XP_005897186.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   2e-26   Bos mutus
ref|XP_004636478.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   2e-26   Octodon degus
gb|KFO61717.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    115   2e-26   Corvus brachyrhynchos
ref|XP_006510058.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   2e-26   Mus musculus [mouse]
ref|XP_005710816.1|  unnamed protein product                            115   2e-26   Chondrus crispus [carageen]
ref|XP_005500757.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   2e-26   Columba livia [carrier pigeon]
ref|XP_004667433.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   2e-26   Jaculus jaculus
ref|XP_005328414.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   2e-26   
ref|XP_005706380.1|  UDP-N-acetylglucosamine--dolichyl-phosphateN...    115   2e-26   Galdieria sulphuraria
ref|XP_002935051.2|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   2e-26   
gb|EDL95293.1|  dolichyl-phosphate (UDP-N-acetylglucosamine) N-ac...    114   2e-26   Rattus norvegicus [brown rat]
ref|XP_009044300.1|  hypothetical protein LOTGIDRAFT_184756             115   2e-26   Lottia gigantea
ref|XP_011235942.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   3e-26   
ref|XP_011183569.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   3e-26   Zeugodacus cucurbitae [melon fruit fly]
gb|AAH47771.1|  DPAGT1 protein                                          114   3e-26   Homo sapiens [man]
ref|XP_010195155.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   3e-26   Colius striatus
ref|XP_004427282.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   3e-26   
ref|NP_001082880.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    115   3e-26   
ref|XP_004750076.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   3e-26   
ref|NP_001230970.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    115   3e-26   
ref|XP_004531198.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   3e-26   
gb|KFM57402.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    115   3e-26   
ref|XP_008688206.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   3e-26   
ref|NP_596244.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-a...    115   4e-26   
ref|XP_004750075.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   4e-26   
ref|XP_011200075.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    115   4e-26   
sp|P23338.1|GPT_CRILO  RecName: Full=UDP-N-acetylglucosamine--dol...    115   4e-26   
ref|XP_001744247.1|  hypothetical protein                               115   4e-26   
ref|XP_795026.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl-ph...    115   4e-26   
ref|XP_001527101.1|  hypothetical protein LELG_01930                    115   4e-26   
ref|XP_968050.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl-ph...    114   5e-26   
ref|XP_006833967.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   5e-26   
gb|ERE75025.1|  UDP-N-acetylglucosamine--dolichyl-phosphateN-acet...    114   5e-26   
emb|CCD59784.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ac...    115   5e-26   
dbj|BAG63385.1|  unnamed protein product                                114   5e-26   
ref|XP_006510054.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   5e-26   
ref|XP_008971682.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   5e-26   
ref|XP_011540950.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   5e-26   
ref|XP_005004999.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   5e-26   
ref|XP_008971681.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_005689596.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_004456338.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_007523650.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_004893723.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_004412656.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_011396475.1|  UDP-N-acetylglucosamine-dolichyl-phosphate N...    114   6e-26   
ref|XP_003234160.1|  UDP-N-acetyl-glucosamine-1-P transferase           114   6e-26   
gb|EYE97580.1|  hypothetical protein EURHEDRAFT_450670                  114   6e-26   
gb|EZF32486.1|  hypothetical protein H101_03920                         114   6e-26   
gb|KDR24230.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    114   6e-26   
gb|EGD99081.1|  UDP-N-acetyl-glucosamine-1-P transferase                114   6e-26   
emb|CCD59785.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ac...    115   6e-26   
ref|XP_003129975.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_006510055.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_011782326.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   6e-26   
ref|XP_010355260.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   6e-26   
ref|XP_004016144.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_010627589.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_008019355.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   6e-26   
ref|XP_004456337.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_004585212.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_004427280.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_003472825.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_006510056.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_004893722.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_006833968.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   6e-26   
ref|XP_006078743.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|XP_006242983.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   7e-26   
gb|AAI02418.1|  Dolichyl-phosphate (UDP-N-acetylglucosamine) N-ac...    114   7e-26   
ref|XP_008576127.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   7e-26   
ref|XP_008511626.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|NP_001015664.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    114   7e-26   
ref|XP_001503182.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|XP_004385691.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
emb|CAA46553.1|  GlcNAc-1-P transferase                                 114   7e-26   
ref|XP_008576128.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|XP_003992481.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|XP_001380584.2|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|NP_031901.2|  UDP-N-acetylglucosamine--dolichyl-phosphate N-a...    114   7e-26   
ref|XP_005378360.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|XP_002929636.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|XP_004412655.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
dbj|BAG35646.1|  unnamed protein product                                114   7e-26   
emb|CAB04787.1|  GlcNac-1-P transferase                                 114   7e-26   
ref|XP_010627587.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|XP_008688205.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
ref|XP_006152365.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   7e-26   
gb|KFB46431.1|  AGAP008131-PA-like protein                              114   7e-26   
ref|NP_955420.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-a...    114   7e-26   
gb|AAG43168.1|  GlcNAc-1-P transferase                                  114   7e-26   
ref|XP_011271106.1|  UDP-N-acetylglucosamine-dolichyl-phosphate N...    114   8e-26   
ref|XP_007072957.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   8e-26   
ref|XP_005328413.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   8e-26   
ref|XP_004750074.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   8e-26   
ref|XP_007934632.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   8e-26   
ref|XP_004712829.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   8e-26   
ref|XP_002849285.1|  UDP-N-acetylglucosamine-1-P transferase            114   8e-26   
ref|XP_005347232.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   8e-26   
gb|EPQ01778.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    113   8e-26   
ref|NP_001373.2|  UDP-N-acetylglucosamine--dolichyl-phosphate N-a...    114   8e-26   
ref|XP_546489.3|  PREDICTED: UDP-N-acetylglucosamine--dolichyl-ph...    114   8e-26   
ref|XP_001165129.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   8e-26   
ref|XP_004893718.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   8e-26   
gb|AAP36164.1|  Homo sapiens dolichyl-phosphate (UDP-N-acetylgluc...    114   8e-26   
dbj|BAG54694.1|  unnamed protein product                                114   8e-26   
ref|XP_011908470.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_011235941.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_004689242.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_003923660.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_003253312.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_005069480.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_004712828.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_004750073.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_008688204.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_002754555.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_008824191.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   9e-26   
ref|XP_011820319.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_009245428.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|XP_008066442.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   9e-26   
ref|NP_001244785.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    114   9e-26   
ref|XP_011782325.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   1e-25   
ref|XP_010979653.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   1e-25   
ref|XP_010355258.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   1e-25   
ref|XP_006175358.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   1e-25   
ref|XP_005271479.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   1e-25   
ref|XP_008971680.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   1e-25   
ref|XP_008824190.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   1e-25   
ref|XP_006992837.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_004604804.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_011908468.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   1e-25   
ref|XP_010332751.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   1e-25   
ref|XP_003796877.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_007679198.1|  hypothetical protein BAUCODRAFT_36912              114   1e-25   
ref|XP_010355259.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_011908469.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_006992838.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_011860768.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_003175414.1|  Alg7p                                              114   1e-25   
gb|EPY53951.1|  UDP-N-acetylglucosamine-dolichyl-phosphateN-acety...    114   1e-25   
ref|XP_006912665.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_011172045.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_005579953.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_002614663.1|  hypothetical protein CLUG_05441                    114   1e-25   
ref|XP_001320417.1|  glycosyl transferase                               113   1e-25   
ref|XP_002130460.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_010355257.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   1e-25   
ref|XP_001842541.1|  glucosaminephosphotransferase                      113   1e-25   
ref|XP_006110221.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-pho...    113   1e-25   
ref|XP_011151652.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   2e-25   
ref|XP_005826078.1|  hypothetical protein GUITHDRAFT_76635              112   2e-25   
ref|XP_317328.3|  AGAP008131-PA                                         113   2e-25   
ref|XP_006758793.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   2e-25   
ref|XP_007124268.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   2e-25   
ref|XP_004456340.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   2e-25   
ref|XP_004273355.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   2e-25   
ref|XP_004313135.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   2e-25   
ref|XP_002064630.1|  GK23958                                            113   2e-25   
ref|XP_006739770.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    114   2e-25   
ref|XP_005856944.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   2e-25   
gb|EPX72479.1|  UDP-N-acetylglucosamine-dolichyl-phosphateN-acety...    113   2e-25   
ref|XP_007196714.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   2e-25   
ref|XP_011151651.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   2e-25   
gb|EFN76420.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    112   2e-25   
gb|KGO48715.1|  Glycosyl transferase, family 4                          113   2e-25   
ref|XP_008148301.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   2e-25   
gb|EJY83422.1|  hypothetical protein OXYTRI_18956                       112   2e-25   
ref|XP_007456347.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   2e-25   
gb|AAA51872.1|  uridine diphosphate N-acetyl-D-glucosamine-1-phos...    108   2e-25   
ref|XP_011559377.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   3e-25   
ref|XP_011493290.1|  AAEL017268-PA                                      108   3e-25   
ref|NP_507859.2|  Protein Y60A3A.14                                     112   3e-25   
gb|EHJ71712.1|  hypothetical protein KGM_15746                          112   3e-25   
ref|XP_002170305.2|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    111   3e-25   
ref|XP_005096228.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   3e-25   
ref|XP_002433019.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    112   3e-25   
ref|XP_001962847.1|  GF14223                                            112   3e-25   
gb|AAW26578.1|  SJCHGC01805 protein                                     113   3e-25   
ref|XP_005096226.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   3e-25   
emb|CAX70364.1|  putative dolichyl-phosphate (UDP-N-acetylglucosa...    112   3e-25   
ref|XP_001260594.1|  UDP-N-acetylglucosamine-dolichyl-phosphate N...    112   3e-25   
ref|XP_010596230.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   3e-25   
ref|XP_004991031.1|  hypothetical protein PTSG_08009                    112   3e-25   
ref|XP_001651323.1|  AAEL005705-PA                                      112   3e-25   
ref|XP_003018613.1|  hypothetical protein TRV_07373                     112   3e-25   
ref|XP_003418231.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   3e-25   
ref|XP_007374517.1|  hypothetical protein SPAPADRAFT_60327              112   4e-25   
ref|XP_002841340.1|  hypothetical protein                               112   4e-25   
ref|XP_003764214.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    113   4e-25   
ref|XP_001943782.2|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   4e-25   
emb|CDW76986.1|  udp-n-acetylglucosamine--dolichyl-phosphate n-ac...    111   4e-25   
ref|XP_003396168.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   4e-25   
ref|XP_011690368.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   4e-25   
ref|XP_010596229.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   4e-25   
ref|XP_011690369.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    112   4e-25   
emb|CCW61207.1|  unnamed protein product                                112   4e-25   
gb|ELU44515.1|  UDP-N-acetylglucosamine-dolichyl                        112   5e-25   
gb|EDP54640.1|  UDP-N-acetylglucosamine-dolichyl-phosphate N-acet...    112   5e-25   
ref|NP_609608.1|  CG5287                                                111   5e-25   
ref|XP_002042120.1|  GM10202                                            111   5e-25   
ref|XP_755457.1|  UDP-N-acetyl-glucosamine-1-P transferase Alg7         112   5e-25   
gb|EMS18953.1|  UDP-N-acetylglucosamine-dolichyl-phosphate N-acet...    112   5e-25   
ref|XP_003484905.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    111   5e-25   
ref|XP_009016038.1|  hypothetical protein HELRODRAFT_94198              111   5e-25   
ref|XP_001275415.1|  UDP-N-acetylglucosamine-dolichyl-phosphate N...    112   5e-25   
gb|EPZ35316.1|  Glycosyl transferase, family 4 domain-containing ...    111   6e-25   
ref|XP_002079290.1|  GD23869                                            111   6e-25   
ref|XP_001399460.1|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    112   6e-25   
dbj|GAA82349.1|  UDP-N-acetylglucosamine-dolichyl-phosphate N-ace...    112   6e-25   
ref|XP_001208817.1|  hypothetical protein ATEG_01452                    112   6e-25   
emb|CEL52199.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ac...    111   6e-25   
emb|CBN75494.1|  N-acetylglucosaminephosphotransferase                  111   6e-25   
dbj|GAD93855.1|  UDP-N-acetyl-glucosamine-1-P transferase Alg7          111   6e-25   
ref|XP_011563965.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    111   6e-25   
dbj|GAA27363.2|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ac...    111   7e-25   
gb|ESA02322.1|  hypothetical protein GLOINDRAFT_68034                   111   7e-25   
ref|XP_001355917.1|  GA18787                                            111   7e-25   
ref|XP_002027270.1|  GL24744                                            111   7e-25   
ref|WP_028831195.1|  hypothetical protein                               112   7e-25   
ref|XP_003703283.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    111   7e-25   
gb|KEQ71392.1|  UDP-GlcNAc-1-phosphate transferase                      111   7e-25   
gb|EIT78142.1|  glycosyltransferase                                     111   7e-25   
gb|EXX70507.1|  hypothetical protein RirG_086870                        111   7e-25   
ref|XP_002177727.1|  predicted protein                                  111   7e-25   
ref|XP_002051683.1|  GJ16886                                            111   8e-25   
ref|XP_004925547.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    110   8e-25   
ref|XP_500980.1|  YALI0B16588p                                          111   8e-25   
dbj|BAE59962.1|  unnamed protein product                                111   8e-25   
gb|KHJ83617.1|  glycosyltransferase, group 4 family                     108   8e-25   
gb|KJJ35169.1|  Glycosyl transferase family 4                           111   8e-25   
gb|KFX48035.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    111   9e-25   
ref|XP_007654457.1|  PREDICTED: UDP-N-acetylglucosamine--dolichyl...    106   1e-24   
dbj|GAM37060.1|  Alg7 homolog                                           111   1e-24   
ref|XP_001821964.2|  UDP-N-acetylglucosamine--dolichyl-phosphate ...    111   1e-24   
gb|KFX48036.1|  UDP-N-acetylglucosamine--dolichyl-phosphate N-ace...    111   1e-24   
ref|XP_002152042.1|  UDP-N-acetyl-glucosamine-1-P transferase Alg...    111   1e-24   
ref|XP_001988861.1|  GH11394                                            110   1e-24   
gb|ETO30405.1|  hypothetical protein RFI_06714                          112   1e-24   
gb|ERG80018.1|  udp-n-acetylglucosamine--dolichyl-phosphate n-ace...    110   1e-24   



>ref|NP_001274821.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Solanum tuberosum]
 gb|AEK25530.1| UDP-GlcNac-dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Solanum tuberosum]
Length=425

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLSVPQLAGI+PC
Sbjct  300  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFLPQVLNFLLSVPQLAGIVPC  359

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDPQTGLLTGTNDGTLVN FLRQLGRMSEQSLCVVLL+FQA CC FCFLLRW+
Sbjct  360  PRHRLPKFDPQTGLLTGTNDGTLVNLFLRQLGRMSEQSLCVVLLVFQALCCGFCFLLRWL  419

Query  377  LTGWYK  360
            LTGWYK
Sbjct  420  LTGWYK  425



>ref|XP_009784799.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Nicotiana sylvestris]
Length=425

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            S+NWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGIIPC
Sbjct  300  SFNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFLPQVLNFLLSLPQLAGIIPC  359

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDPQTGLLTGTNDGTLVNFFLRQLGRMSEQSLCVVLL+FQA CCCFCFLLRW+
Sbjct  360  PRHRLPKFDPQTGLLTGTNDGTLVNFFLRQLGRMSEQSLCVVLLVFQAICCCFCFLLRWL  419

Query  377  LTGWYK  360
            LTGWYK
Sbjct  420  LTGWYK  425



>ref|XP_009597845.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Nicotiana tomentosiformis]
Length=425

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            S+NWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGIIPC
Sbjct  300  SFNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFLPQVLNFLLSLPQLAGIIPC  359

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDPQTGLLTGTNDGTLVNFFLRQLGRMSEQSLCVVLL+FQA CCCFCFLLRW+
Sbjct  360  PRHRLPKFDPQTGLLTGTNDGTLVNFFLRQLGRMSEQSLCVVLLVFQAICCCFCFLLRWL  419

Query  377  LTGWYK  360
            LTGWYK
Sbjct  420  LTGWYK  425



>ref|XP_004236571.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Solanum lycopersicum]
Length=425

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLSVPQLAGI+PC
Sbjct  300  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFLPQVLNFLLSVPQLAGIVPC  359

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP+TGLLTGTNDGTLVN FLRQLGRMSEQSLCV LL+FQA CC FCFLLRW+
Sbjct  360  PRHRLPKFDPKTGLLTGTNDGTLVNLFLRQLGRMSEQSLCVTLLVFQAMCCGFCFLLRWL  419

Query  377  LTGWYK  360
            LTGWYK
Sbjct  420  LTGWYK  425



>ref|XP_011075374.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Sesamum indicum]
Length=418

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+PCP
Sbjct  294  YNWYPSSVFVGDTYTYFAGMTMAVAGILGHFSETLLIFFAPQVLNFLLSLPQLAGIVPCP  353

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQ+GLLTGTNDGTLVNFFLRQ GR +E+ LC+ LL+FQA CC FCFLLRW+L
Sbjct  354  RHRLPRFDPQSGLLTGTNDGTLVNFFLRQFGRKTEKRLCISLLVFQALCCGFCFLLRWLL  413

Query  374  TGWYK  360
            TGWYK
Sbjct  414  TGWYK  418



>gb|EYU20786.1| hypothetical protein MIMGU_mgv1a007085mg [Erythranthe guttata]
Length=420

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGM MAVAGILGHFSETLL+FF PQVLNFLLS+PQLAGIIPCP
Sbjct  296  YNWYPSSVFVGDTYTYFAGMAMAVAGILGHFSETLLVFFAPQVLNFLLSLPQLAGIIPCP  355

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLPKFDP++GLLTGTNDGTLVN FLRQ GRMSE++LC+ LL+FQ  CC FCFLLRW L
Sbjct  356  RHRLPKFDPKSGLLTGTNDGTLVNLFLRQFGRMSEKTLCIQLLVFQGVCCGFCFLLRWFL  415

Query  374  TGWYK  360
            TGWYK
Sbjct  416  TGWYK  420



>ref|XP_010672937.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Beta vulgaris subsp. vulgaris]
Length=430

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGH+SETLLIFF PQVLNFLLS+PQLAGIIPC
Sbjct  305  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHYSETLLIFFAPQVLNFLLSLPQLAGIIPC  364

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQTGLLTGT DGTLVNF LR  GRMSEQS+C+VLL  QA  C FCFLLRW+
Sbjct  365  PRHRLPRFDPQTGLLTGTKDGTLVNFSLRLFGRMSEQSICIVLLSLQAIACGFCFLLRWL  424

Query  377  LTGWYK  360
            L GWYK
Sbjct  425  LAGWYK  430



>ref|XP_011078942.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Sesamum indicum]
Length=421

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS+VFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+PCP
Sbjct  297  YNWYPSAVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFAPQVLNFLLSLPQLAGIVPCP  356

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLPKFDP +GLLTGTNDGTLVN FLRQ GR SE+SLC++LL+FQA CC FCFLLRW+L
Sbjct  357  RHRLPKFDPHSGLLTGTNDGTLVNLFLRQFGRRSEKSLCILLLVFQAICCGFCFLLRWLL  416

Query  374  TGWYK  360
            TGWYK
Sbjct  417  TGWYK  421



>ref|XP_010102703.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Morus notabilis]
 gb|EXB93955.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Morus notabilis]
Length=421

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+PC
Sbjct  296  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFAPQVLNFLLSLPQLAGIVPC  355

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQT LLTGTNDGTLVNFFLRQ GRMSE+SLC+ LL+FQA  C FCFLL + 
Sbjct  356  PRHRLPRFDPQTKLLTGTNDGTLVNFFLRQFGRMSEKSLCIYLLVFQAIACFFCFLLGYF  415

Query  377  LTGWYK  360
            L GWYK
Sbjct  416  LAGWYK  421



>ref|XP_009346976.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009346977.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X2 [Pyrus x bretschneideri]
Length=423

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSS FVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLSVPQLAGI+PC
Sbjct  298  AYNWYPSSAFVGDTYTYFAGMTMAVAGILGHFSETLLIFFAPQVLNFLLSVPQLAGIVPC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP+TGLLTGT DGT+VN FLRQ GRM+E+SLCV LL+FQA  CCFCFLLR+ 
Sbjct  358  PRHRLPRFDPETGLLTGTKDGTVVNLFLRQFGRMTEKSLCVSLLVFQAMACCFCFLLRFF  417

Query  377  LTGWYK  360
            L GWYK
Sbjct  418  LAGWYK  423



>ref|XP_008373011.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Malus domestica]
Length=423

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSS FVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLSVPQLAGI+PC
Sbjct  298  AYNWYPSSAFVGDTYTYFAGMTMAVAGILGHFSETLLIFFAPQVLNFLLSVPQLAGIVPC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP+TGLLTGT DGT+VN FLRQ GRM+E+SLCV LL+FQA  CCFCFLLR+ 
Sbjct  358  PRHRLPRFDPETGLLTGTKDGTVVNLFLRQFGRMTEKSLCVSLLVFQAMACCFCFLLRFF  417

Query  377  LTGWYK  360
            L GWYK
Sbjct  418  LAGWYK  423



>gb|EYU18679.1| hypothetical protein MIMGU_mgv1a007110mg [Erythranthe guttata]
Length=419

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGIIPCP
Sbjct  295  FNWYPSSVFVGDTYTYFAGMTMAVAGILGHFSETLLIFFAPQVLNFLLSLPQLAGIIPCP  354

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDP++GLLTGTNDGTLVN FLRQ GR +E+SLC++LL+FQA CC FCFLLRW L
Sbjct  355  RHRLPRFDPKSGLLTGTNDGTLVNLFLRQFGRKTEKSLCILLLIFQALCCGFCFLLRWFL  414

Query  374  TGWYK  360
            TGWYK
Sbjct  415  TGWYK  419



>ref|XP_008240755.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Prunus mume]
Length=423

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSS FVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+PC
Sbjct  298  SYNWYPSSAFVGDTYTYFAGMTMAVAGILGHFSETLLIFFVPQVLNFLLSLPQLAGIVPC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGTNDGTLVNFFLR+ GRM+E+SLC+ LL+FQA  CCFCF+LR+ 
Sbjct  358  PRHRLPKFDPGTGLLTGTNDGTLVNFFLRRFGRMTEKSLCIYLLVFQAIACCFCFVLRFF  417

Query  377  LTGWYK  360
            L GWYK
Sbjct  418  LAGWYK  423



>ref|XP_007215436.1| hypothetical protein PRUPE_ppa006193mg [Prunus persica]
 gb|EMJ16635.1| hypothetical protein PRUPE_ppa006193mg [Prunus persica]
Length=423

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSS FVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+PC
Sbjct  298  SYNWYPSSAFVGDTYTYFAGMTMAVAGILGHFSETLLIFFVPQVLNFLLSLPQLAGIVPC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGTNDGTLVNFFLR+ GRM+E+SLC+ LL+FQA  CCFCF+LR+ 
Sbjct  358  PRHRLPKFDPGTGLLTGTNDGTLVNFFLRRFGRMTEKSLCIYLLVFQAIACCFCFVLRFF  417

Query  377  LTGWYK  360
            L GWYK
Sbjct  418  LAGWYK  423



>ref|XP_009349656.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Pyrus x bretschneideri]
Length=423

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSS FVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLSVPQLAGI+PC
Sbjct  298  SYNWYPSSAFVGDTYTYFAGMTMAVAGILGHFSETLLIFFAPQVLNFLLSVPQLAGIVPC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP+TGLLTGT DGT+VN FLR+ GRM+E+SLC+ LL+FQA  CCFC L R+ 
Sbjct  358  PRHRLPRFDPETGLLTGTKDGTVVNLFLRRFGRMTEKSLCISLLVFQAMACCFCILPRFF  417

Query  377  LTGWYK  360
            L GWYK
Sbjct  418  LPGWYK  423



>ref|XP_008392344.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Malus domestica]
 ref|XP_008367413.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Malus domestica]
Length=423

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSS FVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+PC
Sbjct  298  SYNWYPSSAFVGDTYTYFAGMTMAVAGILGHFSETLLIFFAPQVLNFLLSMPQLAGIVPC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP+TGLLTGT DGT+VN FLR  GRM+E+SLC+ LL+FQA  CCFCFLLR+ 
Sbjct  358  PRHRLPRFDPETGLLTGTKDGTVVNLFLRXFGRMTEKSLCISLLVFQATACCFCFLLRYF  417

Query  377  LTGWYK  360
            L GWYK
Sbjct  418  LAGWYK  423



>gb|AFK37996.1| unknown [Lotus japonicus]
Length=417

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            S+NWYPSSVFVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQL+G IPC
Sbjct  292  SFNWYPSSVFVGDTYTYFAGMTMAVAGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPC  351

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQTGLLTGTNDGTLVNFFLR LGR SE++LCV LL+FQA  CCFCF LR++
Sbjct  352  PRHRLPRFDPQTGLLTGTNDGTLVNFFLRTLGRKSEKALCVYLLVFQALACCFCFFLRYL  411

Query  377  LTGWYK  360
            L GWYK
Sbjct  412  LAGWYK  417



>ref|XP_007222545.1| hypothetical protein PRUPE_ppa006198mg [Prunus persica]
 gb|EMJ23744.1| hypothetical protein PRUPE_ppa006198mg [Prunus persica]
Length=423

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            S+NWYPSS FVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+PC
Sbjct  298  SHNWYPSSAFVGDTYTYFAGMTMAVAGILGHFSETLLIFFVPQVLNFLLSLPQLAGIVPC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGTNDGTLVNFFLR+ GRM+E+S+C+ LL+FQA  CCFCF+LR+ 
Sbjct  358  PRHRLPRFDPGTGLLTGTNDGTLVNFFLRRFGRMTEKSICICLLVFQAIACCFCFVLRFF  417

Query  377  LTGWYK  360
            L GWYK
Sbjct  418  LAGWYK  423



>ref|XP_004303626.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Fragaria vesca subsp. vesca]
Length=417

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSS FVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGIIPC
Sbjct  292  SYNWYPSSAFVGDTYTYFAGMTMAVVGILGHFSETLLIFFIPQVLNFLLSLPQLAGIIPC  351

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGTNDGTLVN FLRQ GRM+E+ LCV LL+FQA  C FCFLLR+ 
Sbjct  352  PRHRLPRFDPDTGLLTGTNDGTLVNLFLRQFGRMTEKRLCVYLLVFQALACGFCFLLRYF  411

Query  377  LTGWYK  360
            L GWYK
Sbjct  412  LAGWYK  417



>ref|XP_002274738.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Vitis vinifera]
 emb|CBI30063.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G + CP
Sbjct  301  YNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFIPQVLNFLLSLPQLSGYVKCP  360

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGTNDGT+VN FLRQ GRMSE+SLC++LL+FQA  CCFCF+LRW L
Sbjct  361  RHRLPRFDPQTGLLTGTNDGTVVNLFLRQFGRMSEKSLCILLLVFQAIGCCFCFVLRWFL  420

Query  374  TGWYK  360
             GWYK
Sbjct  421  AGWYK  425



>ref|XP_008224408.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Prunus mume]
Length=423

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSS FVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+PC
Sbjct  298  SYNWYPSSAFVGDTYTYFAGMTMAVAGILGHFSETLLIFFVPQVLNFLLSLPQLAGIVPC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRL +FDP TGLLTGTNDGTLVNFFLR+ GRM+E+S+C+ LL+FQA  CCFCF+LR+ 
Sbjct  358  PRHRLSRFDPGTGLLTGTNDGTLVNFFLRRFGRMTEKSICICLLVFQAIACCFCFVLRFF  417

Query  377  LTGWYK  360
            L GWYK
Sbjct  418  LAGWYK  423



>gb|KEH33522.1| UDP-glcnac-adolichol phosphate glcnac-1-P-transferase [Medicago 
truncatula]
Length=416

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G IPCP
Sbjct  292  YNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCP  351

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGTNDGTLVNFFLR+LGR SE+SLC+ LL+FQ   CCFCF+LR+ L
Sbjct  352  RHRLPRFDPQTGLLTGTNDGTLVNFFLRKLGRKSEKSLCIYLLIFQGIACCFCFMLRYFL  411

Query  374  TGWYK  360
             GWYK
Sbjct  412  AGWYK  416



>gb|KHN36406.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Glycine soja]
Length=419

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G IPCP
Sbjct  295  YNWYPSSVFVGDTYTYFAGMTMAVIGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCP  354

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGTNDGTLVNFFLR LGR SE++LC+ LL FQA  CC CFLLR+ L
Sbjct  355  RHRLPRFDPQTGLLTGTNDGTLVNFFLRNLGRKSEKALCIYLLAFQAIACCLCFLLRYFL  414

Query  374  TGWYK  360
             GWYK
Sbjct  415  AGWYK  419



>ref|NP_001241234.1| uncharacterized protein LOC100801463 [Glycine max]
 gb|ACU23271.1| unknown [Glycine max]
Length=423

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G IPCP
Sbjct  299  YNWYPSSVFVGDTYTYFAGMTMAVIGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCP  358

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGTNDGTLVNFFLR LGR SE++LC+ LL FQA  CC CFLLR+ L
Sbjct  359  RHRLPRFDPQTGLLTGTNDGTLVNFFLRNLGRKSEKALCIYLLAFQAIACCLCFLLRYFL  418

Query  374  TGWYK  360
             GWYK
Sbjct  419  AGWYK  423



>ref|XP_008224412.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Prunus mume]
Length=421

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSS FVGDT+TYFAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+PC
Sbjct  298  SYNWYPSSAFVGDTYTYFAGMTMAVAGILGHFSETLLIFFVPQVLNFLLSLPQLAGIVPC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGTNDGTLVNFFLR+ GRM+E+S+C+ LL+FQA  CCFCF+LR+ 
Sbjct  358  PRHRLPRFDPGTGLLTGTNDGTLVNFFLRRFGRMTEKSICICLLVFQAIACCFCFVLRFF  417

Query  377  LTGW  366
            L GW
Sbjct  418  LAGW  421



>gb|EPS69334.1| hypothetical protein M569_05432, partial [Genlisea aurea]
Length=390

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+GI+PCP
Sbjct  266  FNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFAPQVLNFLLSLPQLSGIVPCP  325

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+F+P++GLLTGTNDGTLVN FLR+ GR +E+SLC++LLLFQA CC FCFLLRW+L
Sbjct  326  RHRLPRFNPESGLLTGTNDGTLVNLFLRKFGRRTEKSLCILLLLFQALCCGFCFLLRWLL  385

Query  374  TGWYK  360
             GWYK
Sbjct  386  AGWYK  390



>ref|XP_010056578.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Eucalyptus grandis]
 gb|KCW90099.1| hypothetical protein EUGRSUZ_A02296 [Eucalyptus grandis]
Length=427

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGH+SETLLIFF PQ+LNFLLS+PQLAG + C
Sbjct  302  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHYSETLLIFFLPQILNFLLSLPQLAGFVKC  361

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQ+GLLTGTNDGTLVNFFLR  G+ +E+SLC++LLLFQA  C FCFLLRW+
Sbjct  362  PRHRLPRFDPQSGLLTGTNDGTLVNFFLRAFGQKTEKSLCILLLLFQAMACGFCFLLRWL  421

Query  377  LTGWYK  360
            L GWYK
Sbjct  422  LAGWYK  427



>ref|XP_004516363.1| PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetylglucosamine--dolichyl-phosphate 
N-acetylglucosaminephosphotransferase-like [Cicer 
arietinum]
Length=425

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G IPC
Sbjct  300  SYNWYPSSVFVGDTYTYFAGMTMAVIGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPC  359

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQTGLLTGTNDGTLVNFFLR LG  SE+SLC+ LL+FQA  CCFCFLLR+ 
Sbjct  360  PRHRLPRFDPQTGLLTGTNDGTLVNFFLRNLGPKSEKSLCIYLLIFQAIACCFCFLLRYF  419

Query  377  LTGWYK  360
            L GWYK
Sbjct  420  LAGWYK  425



>ref|XP_006421198.1| hypothetical protein CICLE_v10005020mg [Citrus clementina]
 gb|ESR34438.1| hypothetical protein CICLE_v10005020mg [Citrus clementina]
Length=427

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLSVPQL G + C
Sbjct  302  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSVPQLFGFVKC  361

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+F+PQTGLLTGTNDGTLVNFFLR  G+MSE SLC  LL+FQA  CC CF+LR+ 
Sbjct  362  PRHRLPRFNPQTGLLTGTNDGTLVNFFLRLFGKMSEGSLCAALLVFQAIACCLCFVLRYF  421

Query  377  LTGWYK  360
            LTGWYK
Sbjct  422  LTGWYK  427



>emb|CDP14191.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            S+NW PSSVFVGDTFTYFAGMTMAV GILGHFSETLLIFFTPQVLNFL S+PQLAGII C
Sbjct  292  SFNWNPSSVFVGDTFTYFAGMTMAVVGILGHFSETLLIFFTPQVLNFLASLPQLAGIIYC  351

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQ+GLLTGT DGTLVN FLR  GR SE+SLC++LL+FQ  CCCFCF LR+I
Sbjct  352  PRHRLPRFDPQSGLLTGTKDGTLVNIFLRLFGRRSERSLCILLLVFQGICCCFCFYLRYI  411

Query  377  LTGWYK  360
            LTGWYK
Sbjct  412  LTGWYK  417



>ref|XP_003535894.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Glycine max]
 gb|KHN05229.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Glycine soja]
Length=426

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G IPCP
Sbjct  302  YNWYPSSVFVGDTYTYFAGMTMAVIGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCP  361

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGTNDGTLVNFFLR LG+ SE++LC+ LL FQA  CCFCFLLR+ L
Sbjct  362  RHRLPRFDPQTGLLTGTNDGTLVNFFLRNLGQKSEKTLCIYLLAFQAIACCFCFLLRYFL  421

Query  374  TGWYK  360
             GWYK
Sbjct  422  AGWYK  426



>gb|KEH17477.1| UDP-glcnac-adolichol phosphate glcnac-1-P-transferase [Medicago 
truncatula]
Length=416

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G IPCP
Sbjct  292  YNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCP  351

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGTNDGTLVNFFLR+LG  SE+SLC+ LL+FQ   CCFCF+LR+ L
Sbjct  352  RHRLPRFDPQTGLLTGTNDGTLVNFFLRKLGPKSEKSLCIYLLIFQGIACCFCFMLRYFL  411

Query  374  TGWYK  360
             GWYK
Sbjct  412  AGWYK  416



>gb|AFK44971.1| unknown [Medicago truncatula]
Length=416

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G IPCP
Sbjct  292  YNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCP  351

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGTNDGTLVNFFLR+LG  SE+SLC+ LL+FQ   CCFCF+LR+ L
Sbjct  352  RHRLPRFDPQTGLLTGTNDGTLVNFFLRKLGPKSEKSLCIYLLIFQGIACCFCFMLRYFL  411

Query  374  TGWYK  360
             GWYK
Sbjct  412  AGWYK  416



>gb|KDO42332.1| hypothetical protein CISIN_1g014480mg [Citrus sinensis]
Length=423

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLSVPQL G + C
Sbjct  298  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSVPQLFGFVKC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP F+PQTGLLTGTNDGTLVNFFLR  G+MSE SLC  LL+FQA  CC CF+LR+ 
Sbjct  358  PRHRLPGFNPQTGLLTGTNDGTLVNFFLRLFGKMSEGSLCAALLVFQAIACCLCFVLRYF  417

Query  377  LTGWYK  360
            LTGWYK
Sbjct  418  LTGWYK  423



>ref|XP_006491510.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Citrus sinensis]
Length=425

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLSVPQL G + C
Sbjct  300  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSVPQLFGFVKC  359

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP F+PQTGLLTGTNDGTLVNFFLR  G+MSE SLC  LL+FQA  CC CF+LR+ 
Sbjct  360  PRHRLPGFNPQTGLLTGTNDGTLVNFFLRLFGKMSEGSLCAALLVFQAIACCLCFVLRYF  419

Query  377  LTGWYK  360
            LTGWYK
Sbjct  420  LTGWYK  425



>ref|XP_007145569.1| hypothetical protein PHAVU_007G249500g [Phaseolus vulgaris]
 gb|ESW17563.1| hypothetical protein PHAVU_007G249500g [Phaseolus vulgaris]
Length=423

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G IPCP
Sbjct  299  YNWYPSSVFVGDTYTYFAGMTMAVIGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCP  358

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDP+TGLLTGTNDGTLVNFFLR LG  SE++LC+ LL FQA  C FCFLLR+ L
Sbjct  359  RHRLPRFDPKTGLLTGTNDGTLVNFFLRNLGPKSEKALCIYLLAFQAIACGFCFLLRYFL  418

Query  374  TGWYK  360
             GWYK
Sbjct  419  AGWYK  423



>gb|ACU24599.1| unknown [Glycine max]
Length=426

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL+G IPCP
Sbjct  302  YNWYPSSVFVGDTYTYFAGMTMAVIGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCP  361

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHR P+FDPQTGLLTGTNDGTLVNFFLR LG+ SE++LC+ LL FQA  CCFCFLLR+ L
Sbjct  362  RHRPPRFDPQTGLLTGTNDGTLVNFFLRNLGQKSEKTLCIYLLAFQAIACCFCFLLRYFL  421

Query  374  TGWYK  360
             GWYK
Sbjct  422  AGWYK  426



>ref|XP_008449205.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Cucumis melo]
Length=424

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL G I C
Sbjct  299  AYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFFPQVLNFLLSLPQLFGFIAC  358

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQTGLLTGTNDGTLVNFFLR  GR +E+SLC  LL+FQ   CCFCFLLR++
Sbjct  359  PRHRLPRFDPQTGLLTGTNDGTLVNFFLRIFGRKTEKSLCTYLLVFQGVFCCFCFLLRYL  418

Query  377  LTGWYK  360
            L GWYK
Sbjct  419  LAGWYK  424



>ref|XP_011653758.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Cucumis sativus]
Length=424

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQL G I C
Sbjct  299  AYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFFPQVLNFLLSLPQLFGFIAC  358

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQTGLLTGTNDGTLVNFFLR  GR +E+SLC  LL+FQ   CCFCFLLR++
Sbjct  359  PRHRLPRFDPQTGLLTGTNDGTLVNFFLRIFGRKTEKSLCTYLLVFQGVFCCFCFLLRYL  418

Query  377  LTGWYK  360
            L GWYK
Sbjct  419  LAGWYK  424



>emb|CDX76041.1| BnaA04g03050D [Brassica napus]
Length=394

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  269  AYNWYPSAVFVGDTYTVFAGMTMAVAGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  328

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQA  C  CFLLR  
Sbjct  329  PRHRLPKFDPATGLLTGTKDGTLVNVYLRIFGRKSEKSLCIHLLVFQALACALCFLLRHF  388

Query  377  LTGWYK  360
            L GWYK
Sbjct  389  LAGWYK  394



>ref|XP_002322650.1| UDP-GLCNAC:DOLICHOL PHOSPHATE GLCNAC-1-P TRANSFERASE family protein 
[Populus trichocarpa]
 gb|EEF04411.1| UDP-GLCNAC:DOLICHOL PHOSPHATE GLCNAC-1-P TRANSFERASE family protein 
[Populus trichocarpa]
Length=430

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF  QVLNFLLSVPQL G   C
Sbjct  305  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLAQVLNFLLSVPQLFGFRHC  364

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQTGLLTGT+DGTLVNF+LR  GR SE SLCV LLL QA  CC CF LR++
Sbjct  365  PRHRLPRFDPQTGLLTGTDDGTLVNFYLRMFGRKSENSLCVHLLLVQALGCCICFGLRYL  424

Query  377  LTGWYK  360
            LTGWYK
Sbjct  425  LTGWYK  430



>ref|XP_011033163.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Populus euphratica]
Length=430

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF  QVLNFLLSVPQL G   C
Sbjct  305  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLAQVLNFLLSVPQLFGFRHC  364

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQTGLLTGT+DGTLVNF+LR  GR SE SLCV LLL QA  CC CF LR++
Sbjct  365  PRHRLPRFDPQTGLLTGTDDGTLVNFYLRMFGRKSENSLCVHLLLVQALGCCICFGLRYL  424

Query  377  LTGWYK  360
            LTGWYK
Sbjct  425  LTGWYK  430



>emb|CDY30973.1| BnaC04g24510D [Brassica napus]
Length=420

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  295  AYNWYPSAVFVGDTYTVFAGMTMAVAGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  354

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQA  C FCFLLR  
Sbjct  355  PRHRLPKFDPATGLLTGTKDGTLVNVYLRIFGRKSEKSLCIHLLVFQALACAFCFLLRHF  414

Query  377  LTGWYK  360
            L GWYK
Sbjct  415  LAGWYK  420



>ref|XP_011027325.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Populus euphratica]
Length=431

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF  QVLNFLLSVPQL G   CP
Sbjct  307  YNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLAQVLNFLLSVPQLFGFKHCP  366

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGTNDGTLVNF+LR LGR +E SLCV LLL QA  CC CF LR++L
Sbjct  367  RHRLPRFDPQTGLLTGTNDGTLVNFYLRMLGRKTENSLCVHLLLVQALGCCICFGLRYLL  426

Query  374  TGWYK  360
            TGWYK
Sbjct  427  TGWYK  431



>gb|KFK34957.1| hypothetical protein AALP_AA5G216000 [Arabis alpina]
Length=428

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPSSVFVGDT+T FAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  303  AFNWYPSSVFVGDTYTVFAGMTMAVAGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  362

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQA  C FCFLLR  
Sbjct  363  PRHRLPKFDPATGLLTGTKDGTLVNVYLRIFGRKSEKSLCIHLLVFQALACAFCFLLRHF  422

Query  377  LTGWYK  360
            L GWYK
Sbjct  423  LAGWYK  428



>ref|XP_009139045.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Brassica rapa]
Length=419

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAVAGILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  294  AYNWYPSAVFVGDTYTVFAGMTMAVAGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  353

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQA  C FCFLLR  
Sbjct  354  PRHRLPKFDPATGLLTGTKDGTLVNVYLRIFGRKSEKSLCIHLLVFQALACAFCFLLRHF  413

Query  377  LTGWYK  360
            L GWYK
Sbjct  414  LAGWYK  419



>ref|XP_011626535.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Amborella trichopoda]
Length=436

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLL+FF PQVLNFL S PQL  IIPC
Sbjct  311  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLLFFLPQVLNFLYSCPQLFKIIPC  370

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQT LLTGT D  LVN FL   GR SE+SLC+ LL+FQA  C FCF LR+I
Sbjct  371  PRHRLPRFDPQTRLLTGTKDWNLVNLFLNLFGRCSEKSLCIRLLVFQALACLFCFWLRYI  430

Query  377  LTGWYK  360
            L GWYK
Sbjct  431  LAGWYK  436



>ref|XP_002876403.1| hypothetical protein ARALYDRAFT_907180 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52662.1| hypothetical protein ARALYDRAFT_907180 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  301  AYNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  360

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQA  C FCF+LR  
Sbjct  361  PRHRLPKFDPATGLLTGTKDGTLVNVYLRIFGRKSEKSLCIHLLVFQALACAFCFMLRHF  420

Query  377  LTGWYK  360
            L GWYK
Sbjct  421  LAGWYK  426



>gb|KJB35917.1| hypothetical protein B456_006G134300 [Gossypium raimondii]
Length=260

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGH+SETLLIFF PQVLNFLLS+PQL+G + CP
Sbjct  136  YNWYPSSVFVGDTYTYFAGMTMAVVGILGHYSETLLIFFLPQVLNFLLSLPQLSGYVKCP  195

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+F+P+TGLLTGT DGTL+NF+LR +G  SE++LC+ LLL QA  CCFCFLLR++L
Sbjct  196  RHRLPRFNPETGLLTGTRDGTLINFYLRMVGPKSEKTLCIHLLLVQALGCCFCFLLRYLL  255

Query  374  TGWYK  360
             GWYK
Sbjct  256  AGWYK  260



>ref|XP_010544355.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Tarenaya hassleriana]
Length=418

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  293  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  352

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQA  C FCFLLR  
Sbjct  353  PRHRLPRFDPSTGLLTGTKDGTLVNVYLRIFGRKSEKSLCIHLLVFQALACAFCFLLRHF  412

Query  377  LTGWYK  360
            L GWYK
Sbjct  413  LAGWYK  418



>ref|XP_010427590.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Camelina sativa]
Length=426

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  301  AYNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  360

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQ   C FCF+LR  
Sbjct  361  PRHRLPKFDPATGLLTGTKDGTLVNVYLRIFGRKSEKSLCIHLLVFQGLACAFCFMLRHF  420

Query  377  LTGWYK  360
            L GWYK
Sbjct  421  LAGWYK  426



>ref|XP_002308006.2| hypothetical protein POPTR_0006s04420g [Populus trichocarpa]
 gb|EEE91529.2| hypothetical protein POPTR_0006s04420g [Populus trichocarpa]
Length=429

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF  QVLNFLLSVPQL G   CP
Sbjct  305  YNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLAQVLNFLLSVPQLFGFRHCP  364

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGTNDGTLVNF+LR  GR +E SLCV LLL QA  CC CF LR++L
Sbjct  365  RHRLPRFDPQTGLLTGTNDGTLVNFYLRMFGRKTENSLCVHLLLVQALGCCICFGLRYLL  424

Query  374  TGWYK  360
            TGWYK
Sbjct  425  TGWYK  429



>ref|XP_010504649.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Camelina sativa]
Length=426

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  301  AYNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  360

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQ   C FCF+LR  
Sbjct  361  PRHRLPKFDPATGLLTGTKDGTLVNVYLRIFGRKSEKSLCIHLLVFQGLACAFCFMLRHF  420

Query  377  LTGWYK  360
            L GWYK
Sbjct  421  LAGWYK  426



>ref|XP_006291106.1| hypothetical protein CARUB_v10017217mg, partial [Capsella rubella]
 gb|EOA24004.1| hypothetical protein CARUB_v10017217mg, partial [Capsella rubella]
Length=456

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  331  AYNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  390

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTG  DGTLVN +LR  GR SE+SLC+ LL+FQ   C FCF+LR  
Sbjct  391  PRHRLPKFDPATGLLTGAKDGTLVNVYLRIFGRKSEKSLCIHLLVFQGLACAFCFMLRHF  450

Query  377  LTGWYK  360
            L GWYK
Sbjct  451  LAGWYK  456



>ref|XP_010516334.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Camelina sativa]
Length=426

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  301  AYNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  360

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE++LC+ LL+FQ   C FCF+LR  
Sbjct  361  PRHRLPKFDPATGLLTGTKDGTLVNVYLRIFGRKSEKTLCIHLLVFQGLACAFCFMLRHF  420

Query  377  LTGWYK  360
            L GWYK
Sbjct  421  LAGWYK  426



>ref|XP_006396060.1| hypothetical protein EUTSA_v10007732mg [Eutrema salsugineum]
 gb|ESQ33346.1| hypothetical protein EUTSA_v10007732mg [Eutrema salsugineum]
Length=360

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  235  AYNWYPSTVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  294

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTL+N +LR  GR SE+ LC+ LL+FQA  C FCFLLR  
Sbjct  295  PRHRLPKFDPATGLLTGTKDGTLINVYLRIFGRKSEKYLCIHLLVFQALACAFCFLLRHF  354

Query  377  LTGWYK  360
            L GWYK
Sbjct  355  LAGWYK  360



>ref|XP_009116428.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Brassica rapa]
Length=422

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  297  AFNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  356

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQA  C FCFLLR  
Sbjct  357  PRHRLPKFDPATGLLTGTRDGTLVNVYLRIFGRKSEKSLCIHLLVFQALACAFCFLLRHF  416

Query  377  LTGWYK  360
            L GWYK
Sbjct  417  LAGWYK  422



>emb|CDY06123.1| BnaA09g36570D [Brassica napus]
Length=422

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  297  AFNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  356

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTLVN +LR  GR SE+SLC+ LL+FQA  C FCFLLR  
Sbjct  357  PRHRLPKFDPATGLLTGTRDGTLVNVYLRIFGRKSEKSLCIHLLVFQALACAFCFLLRHF  416

Query  377  LTGWYK  360
            L GWYK
Sbjct  417  LAGWYK  422



>ref|XP_008776982.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Phoenix dactylifera]
Length=418

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGM MAV GILGHFSETLL+FF PQVLNFL S PQL  IIPCP
Sbjct  294  YNWYPSSVFVGDTYTYFAGMAMAVVGILGHFSETLLLFFLPQVLNFLYSCPQLFKIIPCP  353

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGT DGTLVN FLR  GR SE+SLC+ LL+FQA  C  CF LR  L
Sbjct  354  RHRLPRFDPQTGLLTGTKDGTLVNLFLRLFGRCSEKSLCIRLLIFQALSCLLCFGLRHFL  413

Query  374  TGWYK  360
             GWYK
Sbjct  414  AGWYK  418



>ref|NP_191281.1| Glycosyl transferase family 4 protein [Arabidopsis thaliana]
 emb|CAB68128.1| UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase-like protein [Arabidopsis thaliana]
 gb|AAM67237.1| UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase-like protein [Arabidopsis thaliana]
 dbj|BAD42931.1| UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase-like protein [Arabidopsis thaliana]
 gb|ABI93914.1| At3g57220 [Arabidopsis thaliana]
 gb|AEE79628.1| Glycosyl transferase family 4 protein [Arabidopsis thaliana]
Length=426

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  301  AYNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  360

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPK+DP TGLLTGT DGTLVN +LR  GR +E+SLC+ LL+FQA  C FCF+LR  
Sbjct  361  PRHRLPKYDPATGLLTGTKDGTLVNVYLRIFGRKTEKSLCIHLLVFQALACAFCFMLRHF  420

Query  377  LTGWYK  360
            L GWYK
Sbjct  421  LAGWYK  426



>ref|XP_012085942.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Jatropha curcas]
 gb|KDP26201.1| hypothetical protein JCGZ_22447 [Jatropha curcas]
Length=424

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQV+NFLLS+PQL G + C
Sbjct  299  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLPQVINFLLSLPQLFGFVHC  358

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQTGLLTGTNDGTLVN +LR  GR SE  LC  LLL Q   CCFCFLLR++
Sbjct  359  PRHRLPRFDPQTGLLTGTNDGTLVNVYLRIFGRKSESLLCAHLLLVQGIGCCFCFLLRYL  418

Query  377  LTGWYK  360
            L GWYK
Sbjct  419  LAGWYK  424



>gb|KCW90100.1| hypothetical protein EUGRSUZ_A02296 [Eucalyptus grandis]
Length=414

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGH+SETLLIFF PQ+LNFLLS+PQLAG + C
Sbjct  302  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHYSETLLIFFLPQILNFLLSLPQLAGFVKC  361

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQS  444
            PRHRLP+FDPQ+GLLTGTNDGTLVNFFLR  G+ +E+S
Sbjct  362  PRHRLPRFDPQSGLLTGTNDGTLVNFFLRAFGQKTEKS  399



>ref|XP_010921906.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Elaeis guineensis]
Length=418

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGM MAV GILGHFSETLL+FF PQVLNFL S PQL  IIPCP
Sbjct  294  YNWYPSSVFVGDTYTYFAGMAMAVVGILGHFSETLLLFFLPQVLNFLYSCPQLFKIIPCP  353

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGT DGTLVN FLR  GR SE+SLC+ LL+FQA  C  CF LR  L
Sbjct  354  RHRLPRFDPQTGLLTGTKDGTLVNLFLRLFGRCSEKSLCIRLLIFQALSCLLCFGLRHFL  413

Query  374  TGWYK  360
             GWYK
Sbjct  414  AGWYK  418



>ref|XP_006402897.1| hypothetical protein EUTSA_v10005999mg [Eutrema salsugineum]
 gb|ESQ44350.1| hypothetical protein EUTSA_v10005999mg [Eutrema salsugineum]
Length=421

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  296  AYNWYPSTVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  355

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTL+N +LR  GR SE+ LC+ LL+FQA  C FCFLLR  
Sbjct  356  PRHRLPKFDPATGLLTGTKDGTLINVYLRIFGRKSEKYLCIHLLVFQALACAFCFLLRHF  415

Query  377  LTGWYK  360
            L GWYK
Sbjct  416  LAGWYK  421



>ref|XP_006396061.1| hypothetical protein EUTSA_v10007732mg [Eutrema salsugineum]
 gb|ESQ33347.1| hypothetical protein EUTSA_v10007732mg [Eutrema salsugineum]
Length=420

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  295  AYNWYPSTVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  354

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPKFDP TGLLTGT DGTL+N +LR  GR SE+ LC+ LL+FQA  C FCFLLR  
Sbjct  355  PRHRLPKFDPATGLLTGTKDGTLINVYLRIFGRKSEKYLCIHLLVFQALACAFCFLLRHF  414

Query  377  LTGWYK  360
            L GWYK
Sbjct  415  LAGWYK  420



>gb|KJB35919.1| hypothetical protein B456_006G134300 [Gossypium raimondii]
Length=418

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGH+SETLLIFF PQVLNFLLS+PQL+G + CP
Sbjct  294  YNWYPSSVFVGDTYTYFAGMTMAVVGILGHYSETLLIFFLPQVLNFLLSLPQLSGYVKCP  353

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+F+P+TGLLTGT DGTL+NF+LR +G  SE++LC+ LLL QA  CCFCFLLR++L
Sbjct  354  RHRLPRFNPETGLLTGTRDGTLINFYLRMVGPKSEKTLCIHLLLVQALGCCFCFLLRYLL  413

Query  374  TGWYK  360
             GWYK
Sbjct  414  AGWYK  418



>ref|XP_002879934.1| hypothetical protein ARALYDRAFT_483226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56193.1| hypothetical protein ARALYDRAFT_483226 [Arabidopsis lyrata subsp. 
lyrata]
Length=431

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  306  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  365

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLPK+DP TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C FCF+LR  
Sbjct  366  PRHRLPKYDPATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACAFCFILRHF  425

Query  377  LTGWYK  360
            L GWYK
Sbjct  426  LAGWYK  431



>ref|XP_007028608.1| UDP-glcnac-adolichol phosphate glcnac-1-p-transferase [Theobroma 
cacao]
 gb|EOY09110.1| UDP-glcnac-adolichol phosphate glcnac-1-p-transferase [Theobroma 
cacao]
Length=422

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGMTMAV GILGH+SETLLIFF PQVLNFLLS+PQL+G + CP
Sbjct  298  YNWYPSSVFVGDTYTYFAGMTMAVVGILGHYSETLLIFFLPQVLNFLLSLPQLSGYVKCP  357

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+F+P+TGLLTGT+DGTLVNF+LR +G  SE+SLC+ LL  QA  CCFCF+LR+ L
Sbjct  358  RHRLPRFNPETGLLTGTHDGTLVNFYLRIVGPKSEKSLCLHLLFVQALGCCFCFMLRYFL  417

Query  374  TGWYK  360
             GWYK
Sbjct  418  AGWYK  422



>ref|XP_010251963.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Nelumbo nucifera]
Length=340

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLS PQL G   C
Sbjct  215  CYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFMPQVLNFLLSFPQLIGYYKC  274

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP FDPQTGLLTGT+DGTLVN FLR  GR +E+SLC+ LL FQ F CC CFLLR +
Sbjct  275  PRHRLPSFDPQTGLLTGTDDGTLVNKFLRWFGRATEKSLCLRLLAFQVFGCCICFLLRHL  334

Query  377  LTGWYK  360
            L GWYK
Sbjct  335  LAGWYK  340



>gb|KDO42331.1| hypothetical protein CISIN_1g014480mg [Citrus sinensis]
Length=420

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQVLNFLLSVPQL G + C
Sbjct  298  SYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSVPQLFGFVKC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQS  444
            PRHRLP F+PQTGLLTGTNDGTLVNFFLR  G+MSE S
Sbjct  358  PRHRLPGFNPQTGLLTGTNDGTLVNFFLRLFGKMSEGS  395



>gb|EMS64138.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Triticum urartu]
Length=376

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDT+TYFAGMT+AV GILGHFSETLL+FF PQVLNFL SVPQL   +PCP
Sbjct  252  FNWYPSSVFVGDTYTYFAGMTLAVVGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPCP  311

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FD QTGLLTGT DG LVN FLR  G+ SE+SLC+ LL+FQA  C FCF LR++L
Sbjct  312  RHRLPRFDTQTGLLTGTKDGNLVNIFLRLFGKCSEKSLCIRLLIFQAVSCLFCFWLRYML  371

Query  374  TGWYK  360
            TGWYK
Sbjct  372  TGWYK  376



>ref|XP_010525507.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Tarenaya hassleriana]
Length=423

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  298  AFNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP  GLLTGT DGTLVN +LR  GR SE+ LC+ LLLFQA  C FCFLLR  
Sbjct  358  PRHRLPRFDPAAGLLTGTKDGTLVNVYLRVFGRKSEKRLCIHLLLFQALACAFCFLLRHF  417

Query  377  LTGWYK  360
            L GWYK
Sbjct  418  LAGWYK  423



>ref|XP_002530099.1| glucosaminephosphotransferase, putative [Ricinus communis]
 gb|EEF32298.1| glucosaminephosphotransferase, putative [Ricinus communis]
Length=418

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            SYNWYPSSVFVGDTFTYFAGMTMAV GILGHFSETLLIFF PQV+NFLLS+PQL+G + C
Sbjct  295  SYNWYPSSVFVGDTFTYFAGMTMAVVGILGHFSETLLIFFLPQVINFLLSLPQLSGYVYC  354

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQS  444
            PRHRLP+FDPQTGLLTGTNDGTLVN +LR  GR SE+S
Sbjct  355  PRHRLPRFDPQTGLLTGTNDGTLVNVYLRLFGRKSEKS  392



>gb|ADE76135.1| unknown [Picea sitchensis]
Length=419

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDTFTYFAGM +AV GILGHFSETLL+FF PQVLNFL S PQL  ++PC
Sbjct  294  AYNWYPSSVFVGDTFTYFAGMALAVVGILGHFSETLLLFFLPQVLNFLYSCPQLFKLVPC  353

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP +DPQTGLLTG+ D  LVN FLR  GR SE SLCV LL FQA  C FCF LR +
Sbjct  354  PRHRLPSYDPQTGLLTGSKDMNLVNLFLRLFGRCSEASLCVKLLAFQALACAFCFGLRSV  413

Query  377  LTGWYK  360
            + GWYK
Sbjct  414  MAGWYK  419



>gb|KFK36996.1| hypothetical protein AALP_AA4G198800 [Arabis alpina]
Length=421

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  296  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  355

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGT DGTLVN +LR  G  +E+SLC+ LL+FQ   C FCF+LR  
Sbjct  356  PRHRLPRFDPATGLLTGTKDGTLVNVYLRLFGPKTEKSLCIHLLVFQTLACAFCFILRHF  415

Query  377  LTGWYK  360
            L GWYK
Sbjct  416  LAGWYK  421



>gb|AAM61102.1| putative UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Arabidopsis thaliana]
Length=431

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  306  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  365

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP++DP TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C FCF+LR  
Sbjct  366  PRHRLPRYDPATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACAFCFILRHF  425

Query  377  LTGWYK  360
            L GWYK
Sbjct  426  LAGWYK  431



>ref|XP_001780524.1| predicted protein [Physcomitrella patens]
 gb|EDQ54618.1| predicted protein [Physcomitrella patens]
Length=258

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPSSVFVGDT+TYFAGM +AV GILGHFSET+L+FF PQ+LNFL S+PQL  I+PC
Sbjct  133  AFNWYPSSVFVGDTYTYFAGMALAVVGILGHFSETMLLFFLPQILNFLYSIPQLFKIVPC  192

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP FDP +GLL G+ND  LVN FLR  GR SEQ LC+ LL+FQ  CC FCF LR++
Sbjct  193  PRHRLPSFDPHSGLLIGSNDMNLVNLFLRWFGRCSEQQLCIRLLIFQVLCCGFCFGLRYL  252

Query  377  LTGWYK  360
            + GWYK
Sbjct  253  MAGWYK  258



>ref|NP_565950.1| UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase [Arabidopsis thaliana]
 gb|AAL06557.1|AF412104_1 T26J13.8/T26J13.8 [Arabidopsis thaliana]
 dbj|BAA83586.1| UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase [Arabidopsis thaliana]
 dbj|BAA83587.1| UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase [Arabidopsis thaliana]
 gb|AAL90925.1| T26J13.8/T26J13.8 [Arabidopsis thaliana]
 gb|AAB84331.2| putative UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Arabidopsis thaliana]
 gb|AAM14968.1| putative UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Arabidopsis thaliana]
 gb|AEC09990.1| UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase [Arabidopsis thaliana]
Length=431

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  306  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  365

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP++DP TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C FCF+LR  
Sbjct  366  PRHRLPRYDPATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACAFCFILRHF  425

Query  377  LTGWYK  360
            L GWYK
Sbjct  426  LAGWYK  431



>ref|XP_006411415.1| hypothetical protein EUTSA_v10016688mg [Eutrema salsugineum]
 gb|ESQ52868.1| hypothetical protein EUTSA_v10016688mg [Eutrema salsugineum]
Length=428

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  303  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  362

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FD  TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQ   C FCF+LR+ 
Sbjct  363  PRHRLPRFDTATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQTLACAFCFILRYF  422

Query  377  LTGWYK  360
            L GWYK
Sbjct  423  LAGWYK  428



>emb|CDX79934.1| BnaA05g02220D [Brassica napus]
Length=422

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  297  AFNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  356

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C FCFLLR  
Sbjct  357  PRHRLPRFDPATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLIFQALACAFCFLLRHF  416

Query  377  LTGWYK  360
            L GWYK
Sbjct  417  LAGWYK  422



>ref|XP_009142749.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Brassica rapa]
Length=422

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  297  AFNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  356

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C FCFLLR  
Sbjct  357  PRHRLPRFDPATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACAFCFLLRHF  416

Query  377  LTGWYK  360
            L GWYK
Sbjct  417  LAGWYK  422



>ref|XP_006411416.1| hypothetical protein EUTSA_v10016688mg [Eutrema salsugineum]
 gb|ESQ52869.1| hypothetical protein EUTSA_v10016688mg [Eutrema salsugineum]
Length=430

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  305  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  364

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FD  TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQ   C FCF+LR+ 
Sbjct  365  PRHRLPRFDTATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQTLACAFCFILRYF  424

Query  377  LTGWYK  360
            L GWYK
Sbjct  425  LAGWYK  430



>ref|XP_009384591.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Musa acuminata subsp. 
malaccensis]
 ref|XP_009384592.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPSSVFVGDT+TYFAGM +AV GILGH+SETLL+FF PQVLNFL S PQL  IIPCP
Sbjct  294  YNWYPSSVFVGDTYTYFAGMALAVVGILGHYSETLLLFFLPQVLNFLYSCPQLFKIIPCP  353

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDPQTGLLTGT DGTLVN FLR  GR +EQ LC+ LL+FQA  C  CF LR +L
Sbjct  354  RHRLPRFDPQTGLLTGTKDGTLVNLFLRLFGRCTEQMLCIRLLIFQALSCLLCFWLRHVL  413

Query  374  TGWYK  360
             GWYK
Sbjct  414  AGWYK  418



>emb|CDY23846.1| BnaC04g01910D [Brassica napus]
Length=422

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  297  AFNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  356

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGT DGTLVN +LR  G  SE+SLC+ LL FQA  C FCFLLR  
Sbjct  357  PRHRLPRFDPATGLLTGTKDGTLVNVYLRLFGPRSEKSLCIHLLAFQALACAFCFLLRHF  416

Query  377  LTGWYK  360
            L GWYK
Sbjct  417  LAGWYK  422



>dbj|BAJ92673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDT+TYFAGMT+AV GILGHFSETLL+FF PQVLNFL SVPQL   +PCP
Sbjct  300  FNWYPSSVFVGDTYTYFAGMTLAVVGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPCP  359

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FD QTGLLTGT DG LVN FLR  G+ SE+SLC+ LL+FQA  C FCF LR++L
Sbjct  360  RHRLPRFDTQTGLLTGTKDGNLVNIFLRLFGKCSEKSLCIRLLIFQAVSCLFCFWLRYML  419

Query  374  TGWYK  360
            TGWYK
Sbjct  420  TGWYK  424



>ref|XP_003562516.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Brachypodium distachyon]
Length=415

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDT+TYFAGMT+AV GILGHFSETLL+FF PQVLNFL SVPQL   +PCP
Sbjct  291  FNWYPSSVFVGDTYTYFAGMTLAVVGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPCP  350

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FD +TGLLTGT DG LVN FLR  G+ SE+SLC+ LL+FQA  C FCF LR++L
Sbjct  351  RHRLPRFDTRTGLLTGTKDGNLVNIFLRMFGKCSEKSLCIRLLVFQALSCLFCFWLRYVL  410

Query  374  TGWYK  360
            TGWYK
Sbjct  411  TGWYK  415



>ref|XP_010244857.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Nelumbo nucifera]
Length=400

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             YNWYPSSVFVGDT+TYFAGMTMAV GILGHFSETLLIFF PQ+LNFLLS PQL G   C
Sbjct  275  CYNWYPSSVFVGDTYTYFAGMTMAVVGILGHFSETLLIFFMPQILNFLLSFPQLIGYYKC  334

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP FDPQTGLLTGT+DGTLVN FLR  GR +E+SLC+ LL FQ F CC CFLLR +
Sbjct  335  PRHRLPSFDPQTGLLTGTDDGTLVNKFLRWFGRATEKSLCLWLLAFQVFGCCICFLLRHL  394

Query  377  LTGWYK  360
            L GWYK
Sbjct  395  LAGWYK  400



>ref|XP_006658923.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Oryza brachyantha]
Length=345

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPSSVFVGDT+TYFAGM +AV GILGHFSETLL+FF P+VLNFL SVPQL   +PC
Sbjct  220  AFNWYPSSVFVGDTYTYFAGMALAVVGILGHFSETLLLFFLPEVLNFLCSVPQLFKFVPC  279

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGT DG LVN FLR  GR +E++LC+ LL+FQA  C FCF LR++
Sbjct  280  PRHRLPRFDPHTGLLTGTKDGNLVNIFLRIFGRCTERTLCIRLLIFQALSCLFCFWLRYM  339

Query  377  LTGWYK  360
            +TGWYK
Sbjct  340  ITGWYK  345



>ref|XP_010517642.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Camelina sativa]
Length=431

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  306  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  365

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP++D  TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C  CF+LR  
Sbjct  366  PRHRLPRYDTATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACALCFILRHF  425

Query  377  LTGWYK  360
            L GWYK
Sbjct  426  LAGWYK  431



>ref|XP_004958590.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Setaria italica]
Length=424

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDT+TYFAGM +AV GILGHFSETLL+FF PQVLNFL SVPQL   +PC
Sbjct  299  AFNWYPSIVFVGDTYTYFAGMALAVVGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPC  358

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDPQTGLLTGT DG LVN FLR  G+ SE++LC+ LL+FQA CC FCF LR++
Sbjct  359  PRHRLPRFDPQTGLLTGTKDGNLVNIFLRLFGKCSEKALCIRLLIFQALCCVFCFWLRYV  418

Query  377  LTGWYK  360
            LTGWYK
Sbjct  419  LTGWYK  424



>gb|EAZ05022.1| hypothetical protein OsI_27203 [Oryza sativa Indica Group]
Length=386

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPSSVFVGDT+TYFAGM +AV GILGHFSETLL+FF P+VLNFL SVPQL   +PC
Sbjct  261  AFNWYPSSVFVGDTYTYFAGMALAVVGILGHFSETLLLFFLPEVLNFLCSVPQLFKFVPC  320

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGT DG LVN FLR  GR +E++LC+ LL+FQA  C FCF LR++
Sbjct  321  PRHRLPRFDPHTGLLTGTKDGNLVNIFLRIFGRCTERTLCIRLLIFQALSCLFCFWLRYM  380

Query  377  LTGWYK  360
            +TGWYK
Sbjct  381  ITGWYK  386



>ref|XP_010505933.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Camelina sativa]
Length=431

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  306  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  365

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP++D  TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C FCF+LR  
Sbjct  366  PRHRLPRYDTATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACAFCFILRHF  425

Query  377  LTGWYK  360
            L GWYK
Sbjct  426  LAGWYK  431



>ref|XP_010508713.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Camelina sativa]
Length=431

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  306  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  365

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP++D  TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C FCF+LR  
Sbjct  366  PRHRLPRYDTATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACAFCFILRHF  425

Query  377  LTGWYK  360
            L GWYK
Sbjct  426  LAGWYK  431



>ref|XP_006294271.1| hypothetical protein CARUB_v10023269mg [Capsella rubella]
 gb|EOA27169.1| hypothetical protein CARUB_v10023269mg [Capsella rubella]
Length=428

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  303  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  362

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP++D  +GLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C FCF+LR  
Sbjct  363  PRHRLPRYDSASGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACTFCFILRHF  422

Query  377  LTGWYK  360
            L GWYK
Sbjct  423  LAGWYK  428



>ref|NP_001142327.1| hypothetical protein [Zea mays]
 gb|ACF79561.1| unknown [Zea mays]
 gb|ACF88197.1| unknown [Zea mays]
 tpg|DAA41669.1| TPA: hypothetical protein ZEAMMB73_004711 [Zea mays]
Length=422

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDT+TYFAGM +AV GILGHFSETLL+FF PQVLNFL SVPQL   +PC
Sbjct  297  AFNWYPSIVFVGDTYTYFAGMALAVIGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPC  356

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP+TGLLTGT DG LVN FLR  G+ SE++LC+ LL+FQA CC FCF LR++
Sbjct  357  PRHRLPRFDPETGLLTGTKDGNLVNIFLRLFGKCSEKALCIRLLIFQALCCVFCFWLRYM  416

Query  377  LTGWYK  360
            LTGWYK
Sbjct  417  LTGWYK  422



>ref|XP_002971204.1| hypothetical protein SELMODRAFT_94941, partial [Selaginella moellendorffii]
 gb|EFJ27802.1| hypothetical protein SELMODRAFT_94941, partial [Selaginella moellendorffii]
Length=270

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             YNWYPSSVFVGDT+TYFAGMTMAVAGILGHFSETLL+FF  Q++NF+ S+PQL   +PC
Sbjct  145  CYNWYPSSVFVGDTYTYFAGMTMAVAGILGHFSETLLLFFLAQIINFVYSIPQLFKWVPC  204

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP F+P+TGLLTG+ D  LVN FLR  GR +EQ LC+ LL+FQ  C  FCFLLR++
Sbjct  205  PRHRLPSFEPKTGLLTGSKDMNLVNLFLRWFGRCTEQQLCIRLLIFQGLCSGFCFLLRFL  264

Query  377  LTGWYK  360
            + GWYK
Sbjct  265  MAGWYK  270



>ref|XP_002463333.1| hypothetical protein SORBIDRAFT_02g041960 [Sorghum bicolor]
 gb|EER99854.1| hypothetical protein SORBIDRAFT_02g041960 [Sorghum bicolor]
Length=421

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDT+TYFAGM +AV GILGHFSETLL+FF PQVLNFL SVPQL   +PC
Sbjct  296  AFNWYPSIVFVGDTYTYFAGMALAVIGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPC  355

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP+TGLLTGT DG LVN FLR  G+ SE+ LC+ LL+FQA CC FCF LR++
Sbjct  356  PRHRLPRFDPETGLLTGTKDGNLVNIFLRLFGKCSEKVLCIRLLIFQALCCVFCFWLRYM  415

Query  377  LTGWYK  360
            LTGWYK
Sbjct  416  LTGWYK  421



>ref|NP_001060535.1| Os07g0661100 [Oryza sativa Japonica Group]
 dbj|BAC83573.1| putative UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase [Oryza sativa Japonica Group]
 dbj|BAF22449.1| Os07g0661100 [Oryza sativa Japonica Group]
Length=430

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPSSVFVGDT+TYF+GM +AV GILGHFSETLL+FF P+VLNFL SVPQL   +PC
Sbjct  305  AFNWYPSSVFVGDTYTYFSGMALAVVGILGHFSETLLLFFLPEVLNFLCSVPQLFKFVPC  364

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGT DG LVN FLR  GR +E++LC+ LL+FQA  C FCF LR++
Sbjct  365  PRHRLPRFDPHTGLLTGTKDGNLVNIFLRIFGRCTERTLCIRLLIFQALSCLFCFWLRYM  424

Query  377  LTGWYK  360
            +TGWYK
Sbjct  425  ITGWYK  430



>gb|EAZ40970.1| hypothetical protein OsJ_25452 [Oryza sativa Japonica Group]
Length=432

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPSSVFVGDT+TYF+GM +AV GILGHFSETLL+FF P+VLNFL SVPQL   +PC
Sbjct  307  AFNWYPSSVFVGDTYTYFSGMALAVVGILGHFSETLLLFFLPEVLNFLCSVPQLFKFVPC  366

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP TGLLTGT DG LVN FLR  GR +E++LC+ LL+FQA  C FCF LR++
Sbjct  367  PRHRLPRFDPHTGLLTGTKDGNLVNIFLRIFGRCTERTLCIRLLIFQALSCLFCFWLRYM  426

Query  377  LTGWYK  360
            +TGWYK
Sbjct  427  ITGWYK  432



>ref|NP_001147607.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Zea mays]
 gb|ACG28060.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Zea mays]
Length=422

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDT+TYFAGM +AV GILGHFSETLL+FF PQVLNFL SVPQL   +PC
Sbjct  297  AFNWYPSIVFVGDTYTYFAGMALAVIGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPC  356

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP  GLLTGT DG LVN FLR  G+ SE++LC+ LL+FQA CC FCF LR++
Sbjct  357  PRHRLPRFDPGAGLLTGTKDGNLVNIFLRLFGKCSERALCIRLLIFQALCCVFCFWLRYM  416

Query  377  LTGWYK  360
            LTGWYK
Sbjct  417  LTGWYK  422



>ref|XP_002971205.1| hypothetical protein SELMODRAFT_171816 [Selaginella moellendorffii]
 gb|EFJ27803.1| hypothetical protein SELMODRAFT_171816 [Selaginella moellendorffii]
Length=414

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             YNWYPSSVFVGDT+TYFAGMTMAVAGILGHFSETLL+FF PQ++NF+ S+PQL   +PC
Sbjct  289  CYNWYPSSVFVGDTYTYFAGMTMAVAGILGHFSETLLLFFLPQIINFVYSIPQLFKWVPC  348

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP F+P+TGLLTG+ D  LVN FLR  GR +E+ LC+ LL+FQ  C  FCFLLR++
Sbjct  349  PRHRLPSFEPKTGLLTGSKDMNLVNLFLRWFGRCTERQLCIRLLIFQGLCSGFCFLLRFL  408

Query  377  LTGWYK  360
            + GWYK
Sbjct  409  MAGWYK  414



>ref|XP_002961599.1| hypothetical protein SELMODRAFT_77123 [Selaginella moellendorffii]
 gb|EFJ36859.1| hypothetical protein SELMODRAFT_77123 [Selaginella moellendorffii]
Length=414

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             YNWYPSSVFVGDT+TYFAGMTMAVAGILGHFSETLL+FF PQ++NF+ S+PQL   +PC
Sbjct  289  CYNWYPSSVFVGDTYTYFAGMTMAVAGILGHFSETLLLFFLPQIINFVYSIPQLFKWVPC  348

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP F+P+TGLLTG+ D  LVN FLR  GR +E+ LC+ LL+FQ  C  FCFLLR++
Sbjct  349  PRHRLPSFEPKTGLLTGSKDMNLVNLFLRWFGRCTERQLCIRLLIFQGLCSGFCFLLRFL  408

Query  377  LTGWYK  360
            + GWYK
Sbjct  409  MAGWYK  414



>tpg|DAA63995.1| TPA: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Zea mays]
Length=422

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDT+TYFAGM +AV GILGHFSETLL+FF PQVLNFL SVPQL   +PC
Sbjct  297  AFNWYPSIVFVGDTYTYFAGMALAVIGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPC  356

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP+FDP  GLLTGT DG LVN FLR  G+ SE++LC+ LL+FQA CC FCF LR +
Sbjct  357  PRHRLPRFDPGAGLLTGTKDGNLVNIFLRLFGKCSERALCIRLLIFQALCCVFCFWLRHM  416

Query  377  LTGWYK  360
            LTGWYK
Sbjct  417  LTGWYK  422



>gb|EMT11571.1| hypothetical protein F775_14154 [Aegilops tauschii]
Length=359

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDT+TYFAGMT+AV GILGHFSETLL+FF PQVLNFL SVPQL   +PCP
Sbjct  252  FNWYPSSVFVGDTYTYFAGMTLAVVGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPCP  311

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQS  444
            RHRLP+FD QTGLLTGT DG LVN FLR  G+ SE+S
Sbjct  312  RHRLPRFDTQTGLLTGTKDGNLVNIFLRLFGKCSEKS  348



>emb|CDY70450.1| BnaCnng68390D, partial [Brassica napus]
Length=386

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS+VFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLNFLLS+PQLAGI+ C
Sbjct  298  AFNWYPSAVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKC  357

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLR  471
            PRHRLPKFDP TGLLTGT DGTLVN +LR
Sbjct  358  PRHRLPKFDPATGLLTGTKDGTLVNVYLR  386



>ref|XP_005843853.1| hypothetical protein CHLNCDRAFT_49159 [Chlorella variabilis]
 gb|EFN51751.1| hypothetical protein CHLNCDRAFT_49159 [Chlorella variabilis]
Length=374

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYP+ VFVGDTFTYFAGM +AVAGILGHFSETLL+FF PQ++NF+ S+PQL  I+PCP
Sbjct  250  FNWYPAQVFVGDTFTYFAGMALAVAGILGHFSETLLMFFIPQIINFVYSLPQLFKIVPCP  309

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDP TGLL  T +  +VN  LR LG  +E  LC+ +LL+Q  CC   F  R  L
Sbjct  310  RHRLPRFDPATGLLHATPNMNVVNLVLRLLGPCTELWLCIRILLWQMACCLTAFAARHAL  369

Query  374  TGWYK  360
             GWYK
Sbjct  370  AGWYK  374



>ref|XP_005645078.1| hypothetical protein COCSUDRAFT_54347 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20534.1| hypothetical protein COCSUDRAFT_54347 [Coccomyxa subellipsoidea 
C-169]
Length=412

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDT+TYFAGMT+AVAGILGH SETLL+F  PQVLNF  S+PQL  I+PCP
Sbjct  288  FNWYPSQVFVGDTYTYFAGMTIAVAGILGHLSETLLLFLIPQVLNFAYSLPQLFKIVPCP  347

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWIL  375
            RHRLP+FDP TGLL  T +  LVN  L   G  +E+ LC  LL FQ FCC F   LRW+L
Sbjct  348  RHRLPRFDPATGLLHATPNWNLVNLTLHMFGPCTEEQLCWRLLKFQMFCCGFGLGLRWVL  407

Query  374  TGWYK  360
            TG YK
Sbjct  408  TGIYK  412



>gb|KDD74929.1| glycosyl transferase [Helicosporidium sp. ATCC 50920]
Length=443

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             +NW+P+ VFVGDT+TYFAGMT+A AGILGHFSETLL F  PQVLNFL S+PQL  I+PC
Sbjct  318  GFNWFPAQVFVGDTYTYFAGMTLACAGILGHFSETLLCFLLPQVLNFLYSLPQLLHIVPC  377

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP++DP T LL  T +  LVN  LR LG  +E+ LC  LL FQ   C   F  R  
Sbjct  378  PRHRLPRYDPHTRLLHPTPNMNLVNLALRVLGPCTEEQLCARLLAFQGVSCLVGFAGRAA  437

Query  377  LTGWYK  360
            L+G YK
Sbjct  438  LSGIYK  443



>ref|XP_002950828.1| hypothetical protein VOLCADRAFT_91192 [Volvox carteri f. nagariensis]
 gb|EFJ48143.1| hypothetical protein VOLCADRAFT_91192 [Volvox carteri f. nagariensis]
Length=411

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTFTYFAGMT+AVAGILGHFSETLL+F  PQV NFL S+PQL  I+PCP
Sbjct  285  FNWYPSRVFVGDTFTYFAGMTIAVAGILGHFSETLLLFLLPQVFNFLYSLPQLFKIVPCP  344

Query  554  RHRLPKFDPQtglltgtndg--tLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRW  381
            RHRLP FDP TGLL   +     LVN  L+  GR  E +LCV +L+FQ   C   F +R+
Sbjct  345  RHRLPVFDPATGLLRPKDAPDWNLVNLTLQLFGRCGENALCVRVLMFQVASCGLAFGVRY  404

Query  380  ILTGWYK  360
            +L G+YK
Sbjct  405  LLQGYYK  411



>ref|XP_001697886.1| hypothetical protein CHLREDRAFT_139119 [Chlamydomonas reinhardtii]
 gb|EDO99769.1| predicted protein [Chlamydomonas reinhardtii]
Length=396

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTFTYFAGMT+AVAGILGHFSETLL+F  PQV NF+ S+PQL GI+ CP
Sbjct  270  FNWYPSKVFVGDTFTYFAGMTIAVAGILGHFSETLLLFLLPQVFNFVYSLPQLFGIVHCP  329

Query  554  RHRLPKFDPQtglltgtndg--tLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRW  381
            RHRLP FDP TGLL   +     LVN  L+  GR  E +LC+ LL  Q   C   F LR+
Sbjct  330  RHRLPVFDPATGLLRPKDAPDWNLVNLTLQLFGRCGENALCIRLLALQVASCALTFGLRY  389

Query  380  ILTGWYK  360
            +L G+YK
Sbjct  390  LLQGYYK  396



>dbj|BAJ61158.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB701]
 dbj|BAJ61161.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB702]
 dbj|BAJ61164.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB702omega]
 dbj|BAJ61168.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB704]
 dbj|BAJ61172.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB705]
 dbj|BAJ61175.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB706]
 dbj|BAJ61178.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB707]
 dbj|BAJ61181.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB708]
 dbj|BAJ61184.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB709]
 dbj|BAJ61187.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB710]
 dbj|BAJ61190.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB711]
 dbj|BAJ61193.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB712]
 dbj|BAJ61196.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB713]
 dbj|BAJ61199.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB714]
 dbj|BAJ61202.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB715]
 dbj|BAJ61205.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB716]
 dbj|BAJ61208.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB717]
 dbj|BAJ61211.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB718]
 dbj|BAJ61214.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB719]
 dbj|BAJ61217.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB720]
 dbj|BAJ61220.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB721]
 dbj|BAJ61223.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB722]
 dbj|BAJ61226.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB723]
 dbj|BAJ61229.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB724]
 dbj|BAJ61232.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB725]
 dbj|BAJ61235.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB726]
 dbj|BAJ61238.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB727]
 dbj|BAJ61241.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB728]
 dbj|BAJ61244.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB729]
 dbj|BAJ61248.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB733]
 dbj|BAJ61252.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB735]
 dbj|BAJ61255.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB740]
 dbj|BAJ61258.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB741]
 dbj|BAJ61261.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB742]
 dbj|BAJ61264.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB743]
 dbj|BAJ61267.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB744]
 dbj|BAJ61270.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB745]
 dbj|BAJ61274.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB750]
 dbj|BAJ61278.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB751]
 dbj|BAJ61281.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB752]
 dbj|BAJ61285.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB753]
 dbj|BAJ61289.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB754]
 dbj|BAJ61292.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB755]
 dbj|BAJ61296.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB759]
 dbj|BAJ61300.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB760]
 dbj|BAJ61303.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB761]
 dbj|BAJ61306.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB701]
 dbj|BAJ61310.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB704]
 dbj|BAJ61313.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB707]
 dbj|BAJ61316.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB710]
 dbj|BAJ61319.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB713]
 dbj|BAJ61322.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB716]
 dbj|BAJ61325.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB719]
 dbj|BAJ61328.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB722]
 dbj|BAJ61331.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB725]
 dbj|BAJ61334.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB728]
 dbj|BAJ61338.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB733]
 dbj|BAJ61342.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB735]
 dbj|BAJ61345.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB740]
 dbj|BAJ61348.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB743]
 dbj|BAJ61352.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB750]
 dbj|BAJ61356.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB753]
 dbj|BAJ61360.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4pGWB759]
 dbj|BAL45835.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4L1pGWB732]
 dbj|BAL45839.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4L1pGWB733]
 dbj|BAL45843.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4L1pGWB735]
 dbj|BAL45847.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4L1pGWB740]
 dbj|BAL45851.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4L1pGWB743]
 dbj|BAL45855.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4L1pGWB750]
 dbj|BAL45859.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector R4L1pGWB759]
 gb|AGO05991.1| UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P 
transferase [Gateway binary vector pGWB770]
Length=431

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            +YNWYPSSVFVGDT+T FAGMTMAV GILGHFSETLLIFF PQVLN LLS+PQLAGI+ C
Sbjct  306  AYNWYPSSVFVGDTYTVFAGMTMAVVGILGHFSETLLIFFLPQVLNLLLSLPQLAGIVKC  365

Query  557  PRHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLRWI  378
            PRHRLP++DP TGLLTGT DGTLVN +LR  G  SE+SLC+ LL+FQA  C FCF+LR  
Sbjct  366  PRHRLPRYDPATGLLTGTKDGTLVNVYLRLFGPKSEKSLCIHLLVFQALACAFCFILRHF  425

Query  377  LTGWYK  360
            L GWYK
Sbjct  426  LAGWYK  431



>gb|KIZ07810.1| hypothetical protein MNEG_0134 [Monoraphidium neglectum]
Length=412

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 93/128 (73%), Gaps = 2/128 (2%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDTFTYFAGMT+AVAGILGH SETLL+F  PQV NF+ S PQL G++PC
Sbjct  285  AFNWYPSRVFVGDTFTYFAGMTIAVAGILGHQSETLLLFLIPQVFNFVYSTPQLFGLVPC  344

Query  557  PRHRLPKFDPQtglltgtndg--tLVNFFLRQLGRMSEQSlcvvlllfqafcccfcflLR  384
            PRHRLP FDP+TGLL   +     LVN  L+  G  SE +LCV +L  Q  CC F F +R
Sbjct  345  PRHRLPVFDPKTGLLRPKDKPDWNLVNLTLQLFGNCSENALCVRILALQVACCAFGFGVR  404

Query  383  WILTGWYK  360
            W L G YK
Sbjct  405  WALQGIYK  412



>ref|XP_002501977.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63235.1| predicted protein [Micromonas sp. RCC299]
Length=301

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 93/132 (70%), Gaps = 6/132 (5%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDTFTYFAGM++ VAGILGHFSETL++FF PQ++NFL S PQL  I+ C
Sbjct  170  AHNWYPSKVFVGDTFTYFAGMSLGVAGILGHFSETLVLFFLPQIVNFLYSSPQLFKIVHC  229

Query  557  PRHRLPKFDPQt------glltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfc  396
            PRHRLPK D +T             +  LVN FLR LG  +E++LC+ LL  QA CC   
Sbjct  230  PRHRLPKLDTETGLLHPSKATETHYNMNLVNLFLRILGPQTERTLCMALLTLQAVCCMAG  289

Query  395  flLRWILTGWYK  360
            F +R +L+G +K
Sbjct  290  FGVRIVLSGKWK  301



>ref|XP_002680053.1| predicted protein [Naegleria gruberi]
 gb|EFC47309.1| predicted protein [Naegleria gruberi]
Length=356

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDT+TYFAGM +AV GI+GHFS+TL++F  PQ+LNFL+S PQL GIIPCP
Sbjct  231  YNWYPSEVFVGDTYTYFAGMILAVTGIMGHFSKTLMLFLIPQILNFLISTPQLFGIIPCP  290

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQS  444
            RHR+PKF+  TG L  + + TL+N  L   G M E +
Sbjct  291  RHRIPKFNQATGKLESSKNWTLLNLILEITGPMKEST  327



>ref|XP_007515020.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15260.1| predicted protein [Bathycoccus prasinos]
Length=472

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 6/102 (6%)
 Frame = -3

Query  731  NWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCPR  552
            NWYPS+VFVGD++TYFAGMT+AVAGILGHFSETLL+F  PQV+NFL S+PQL  I+PCPR
Sbjct  341  NWYPSAVFVGDSYTYFAGMTLAVAGILGHFSETLLLFCLPQVVNFLYSIPQLFKIVPCPR  400

Query  551  HRLPKFDPQt------glltgtndgtLVNFFLRQLGRMSEQS  444
            HRLP+F+ QT             +  LV  FLR  G+ +E+ 
Sbjct  401  HRLPRFETQTGLLSPSKATETRYNMNLVTLFLRVFGKTTERK  442



>emb|CEG00038.1| Glycosyl transferase, family 4 [Ostreococcus tauri]
Length=436

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 92/132 (70%), Gaps = 6/132 (5%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDT+TYFAGMT+ VAG LGHFSETLL+FF PQVLNFL S PQL   + C
Sbjct  305  THNWYPSKVFVGDTYTYFAGMTLGVAGTLGHFSETLLLFFFPQVLNFLYSTPQLFKFVHC  364

Query  557  PRHRLPKFDPQt------glltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfc  396
            PRHRLP FDP+T             +  LVN FLR  G  +E++LCV LL+FQA  C   
Sbjct  365  PRHRLPIFDPKTGLLHPSKATETRYNMNLVNLFLRLFGPCTERALCVRLLVFQASSCAAA  424

Query  395  flLRWILTGWYK  360
            F+ R +LTG +K
Sbjct  425  FVARHVLTGVWK  436



>ref|XP_009822384.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV87521.1| hypothetical protein, variant [Aphanomyces astaci]
Length=298

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF Y+AGMT AVAGILGHFS+TLL+FF PQ+LNF+ S+PQL  I+PCP
Sbjct  162  HNWYPSRVFVGDTFCYYAGMTFAVAGILGHFSKTLLLFFAPQILNFIYSIPQLFKIVPCP  221

Query  554  RHRLPKFDPQ  525
            RHRLPKF+P+
Sbjct  222  RHRLPKFNPK  231



>ref|XP_003082530.1| putative U (ISS) [Ostreococcus tauri]
Length=462

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 92/132 (70%), Gaps = 6/132 (5%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDT+TYFAGMT+ VAG LGHFSETLL+FF PQVLNFL S PQL   + C
Sbjct  331  THNWYPSKVFVGDTYTYFAGMTLGVAGTLGHFSETLLLFFFPQVLNFLYSTPQLFKFVHC  390

Query  557  PRHRLPKFDPQt------glltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfc  396
            PRHRLP FDP+T             +  LVN FLR  G  +E++LCV LL+FQA  C   
Sbjct  391  PRHRLPIFDPKTGLLHPSKATETRYNMNLVNLFLRLFGPCTERALCVRLLVFQASSCAAA  450

Query  395  flLRWILTGWYK  360
            F+ R +LTG +K
Sbjct  451  FVARHVLTGVWK  462



>ref|XP_009822383.1| hypothetical protein H257_01062 [Aphanomyces astaci]
 gb|ETV87520.1| hypothetical protein H257_01062 [Aphanomyces astaci]
Length=375

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF Y+AGMT AVAGILGHFS+TLL+FF PQ+LNF+ S+PQL  I+PCP
Sbjct  239  HNWYPSRVFVGDTFCYYAGMTFAVAGILGHFSKTLLLFFAPQILNFIYSIPQLFKIVPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLPKF+P+
Sbjct  299  RHRLPKFNPK  308



>ref|XP_002172193.1| UDP-N-acetylglucosamine-dolichyl-phosphateN-acetylglucosaminephosphotransferase 
[Schizosaccharomyces japonicus yFS275]
 gb|EEB05900.1| UDP-N-acetylglucosamine-dolichyl-phosphateN-acetylglucosaminephosphotransferase 
[Schizosaccharomyces japonicus yFS275]
Length=448

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             YNW+PS VFVGDT+ YFAGM +AVAGILGHFS+TLL+FF PQ+ NF+LS+PQL G++PC
Sbjct  277  KYNWWPSRVFVGDTYCYFAGMVLAVAGILGHFSKTLLLFFLPQIFNFVLSIPQLFGLVPC  336

Query  557  PRHRLPKFDPQ  525
            PRHRLP+F+P+
Sbjct  337  PRHRLPRFNPE  347



>ref|XP_008861451.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 ref|XP_008861452.1| hypothetical protein, variant 2 [Aphanomyces invadans]
 gb|ETW10040.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 gb|ETW10041.1| hypothetical protein, variant 2 [Aphanomyces invadans]
Length=298

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF Y+AGMT AVAGILGHFS+TLL+FF PQ+LNF+ S+PQL   IPCP
Sbjct  162  HNWYPSRVFVGDTFCYYAGMTFAVAGILGHFSKTLLLFFAPQILNFIYSIPQLFKFIPCP  221

Query  554  RHRLPKFDPQ  525
            RHRLPKF+P+
Sbjct  222  RHRLPKFNPK  231



>ref|XP_005299870.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Chrysemys picta bellii]
Length=406

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  298

Query  554  RHRLPKFDP  528
            RHRLP+F+P
Sbjct  299  RHRLPRFNP  307



>ref|XP_010145626.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Eurypyga helias]
Length=242

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  75   HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  134

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  135  RHRLPRLNPS  144



>ref|XP_009962690.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Tyto alba]
Length=242

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  75   HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  134

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  135  RHRLPRLNPD  144



>ref|XP_008861450.1| hypothetical protein H310_00430 [Aphanomyces invadans]
 gb|ETW10039.1| hypothetical protein H310_00430 [Aphanomyces invadans]
Length=376

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF Y+AGMT AVAGILGHFS+TLL+FF PQ+LNF+ S+PQL   IPCP
Sbjct  240  HNWYPSRVFVGDTFCYYAGMTFAVAGILGHFSKTLLLFFAPQILNFIYSIPQLFKFIPCP  299

Query  554  RHRLPKFDPQ  525
            RHRLPKF+P+
Sbjct  300  RHRLPKFNPK  309



>ref|XP_008615121.1| hypothetical protein SDRG_10884 [Saprolegnia diclina VS20]
 gb|EQC31280.1| hypothetical protein SDRG_10884 [Saprolegnia diclina VS20]
Length=375

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF Y+AGMT AVAGILGHFS+TLL+FF PQ+LNFL S+PQL  ++PCP
Sbjct  239  YNWYPSRVFVGDTFCYYAGMTFAVAGILGHFSKTLLLFFAPQILNFLYSMPQLVKLVPCP  298

Query  554  RHRLPKFD  531
            RHRLPKF+
Sbjct  299  RHRLPKFN  306



>gb|KFW01190.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Eurypyga helias]
Length=251

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  84   HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  143

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  144  RHRLPRLNPS  153



>gb|ACO10518.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Caligus rogercresseyi]
Length=396

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYP+ VF GDTF YF+GMT+AV  ILGHFS+TLL+FF PQVLNFLLS PQL  ++PCP
Sbjct  233  YNWYPARVFCGDTFCYFSGMTLAVVAILGHFSKTLLLFFVPQVLNFLLSTPQLFKLLPCP  292

Query  554  RHRLPKFDPQ  525
            RHRLPK+DP 
Sbjct  293  RHRLPKYDPD  302



>sp|P0CD61.1|GPT_DICDI RecName: Full=UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase; 
AltName: Full=GlcNAc-1-P 
transferase; Short=G1PT; Short=GPT; AltName: Full=N-acetylglucosamine-1-phosphate 
transferase [Dictyostelium discoideum]
Length=408

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDT+TYF+GM  AV  IL HFS+TLL+FF PQ+LNFL SVPQL GIIPCP
Sbjct  278  YNWYPSRVFVGDTYTYFSGMCFAVVAILCHFSKTLLLFFIPQILNFLYSVPQLFGIIPCP  337

Query  554  RHRLPKFDPQtglltgt-ndgtLVNFFLRQLGRMSEQ  447
            RHR+PKF+P+TG +     + T++N  L   G ++E+
Sbjct  338  RHRVPKFNPETGKMEAIPTNLTIINLLLMITGPLTER  374



>ref|XP_007910471.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Callorhinchus milii]
Length=406

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  239  HNWYPSGVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLIHVIPCP  298

Query  554  RHRLPKFDP  528
            RHRLP+ DP
Sbjct  299  RHRLPRLDP  307



>ref|XP_009566928.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Cuculus canorus]
Length=301

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  134  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  193

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  194  RHRLPRLNPS  203



>ref|XP_008425918.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Poecilia reticulata]
Length=406

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  IIPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFIYSLPQLFHIIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ DP 
Sbjct  299  RHRLPRLDPD  308



>ref|XP_002288625.1| udp-n-acetylglucosamin-dolichyl-phosphate : n-acetylglucosamin-phosphate 
transferase [Thalassiosira pseudonana CCMP1335]
 gb|EED94061.1| udp-n-acetylglucosamin-dolichyl-phosphate : n-acetylglucosamin-phosphate 
transferase, partial [Thalassiosira pseudonana CCMP1335]
Length=356

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 77/108 (71%), Gaps = 11/108 (10%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYP+SVFVGDT+ YFAGMT AV GILGHFS+TLL+FF PQV+NFL S PQL   IPCP
Sbjct  225  HNWYPASVFVGDTYCYFAGMTFAVVGILGHFSKTLLLFFIPQVINFLWSTPQLFKRIPCP  284

Query  554  RHRLPKFDPQtgll-----------tgtndgtLVNFFLRQLGRMSEQS  444
            +HRLPKF+ QTG +               + TL+N  L+ LG MSEQ+
Sbjct  285  KHRLPKFNSQTGKMEPSRVLLKSGKKEIANMTLINLCLQMLGPMSEQN  332



>ref|XP_007563267.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Poecilia formosa]
Length=406

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  IIPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFIYSLPQLFHIIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ DP 
Sbjct  299  RHRLPRLDPD  308



>ref|XP_009080521.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Acanthisitta chloris]
Length=300

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  134  HNWYPSQVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  193

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  194  RHRLPRLNPS  203



>ref|XP_010306250.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Balearica regulorum gibbericeps]
Length=301

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  134  HNWYPSQVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  193

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  194  RHRLPRLNPS  203



>ref|XP_005815465.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Xiphophorus maculatus]
Length=406

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  IIPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFIYSLPQLFHIIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ DP 
Sbjct  299  RHRLPRLDPD  308



>ref|XP_005922220.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Haplochromis burtoni]
Length=406

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ SVPQL  IIPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFVYSVPQLFHIIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  299  RHRLPRLNPE  308



>ref|XP_002730450.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Saccoglossus kowalevskii]
Length=442

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQ+ NF+ S+PQL   +PCP
Sbjct  273  YNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQIFNFIYSIPQLFHFVPCP  332

Query  554  RHRLPKFDPQ  525
            RHRLPK+DP+
Sbjct  333  RHRLPKYDPK  342



>ref|XP_004563989.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Maylandia zebra]
 ref|XP_005735568.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Pundamilia nyererei]
 ref|XP_006802279.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Neolamprologus brichardi]
Length=406

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ SVPQL  IIPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFVYSVPQLFHIIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  299  RHRLPRLNPE  308



>ref|XP_006119782.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X1 [Pelodiscus sinensis]
Length=406

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  298

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  299  RHRLPRLNP  307



>gb|KFO81888.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Cuculus canorus]
Length=315

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  148  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  207

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  208  RHRLPRLNPS  217



>ref|XP_009918530.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Haliaeetus albicilla]
Length=301

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  134  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  193

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  194  RHRLPRLNPS  203



>ref|XP_009806606.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Gavia stellata]
Length=301

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  134  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  193

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  194  RHRLPRLNPR  203



>ref|XP_007062456.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Chelonia mydas]
 gb|EMP33405.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Chelonia mydas]
Length=406

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  298

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  299  RHRLPRLNP  307



>gb|KFQ19762.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Merops nubicus]
Length=354

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  247  RHRLPRLNPK  256



>gb|KFV41369.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Gavia stellata]
Length=315

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  148  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  207

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  208  RHRLPRLNPR  217



>ref|XP_005427639.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Geospiza fortis]
Length=397

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  230  YNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  289

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  290  RHRLPRLNPS  299



>ref|XP_008942827.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Merops nubicus]
Length=390

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  223  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  282

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  283  RHRLPRLNPK  292



>ref|XP_005494718.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X2 [Zonotrichia albicollis]
Length=385

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  239  YNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPS  308



>ref|XP_002139236.1| glycosyl transferase  [Cryptosporidium muris RN66]
 gb|EEA04887.1| glycosyl transferase family protein [Cryptosporidium muris RN66]
Length=426

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YN YPS VFVGDT+TYFAG+ +AV  ILGHFS+TLL+FF PQ++NFL+S+PQL G+I CP
Sbjct  300  YNKYPSLVFVGDTYTYFAGVCLAVVSILGHFSKTLLLFFIPQIINFLISIPQLFGLIHCP  359

Query  554  RHRLPKFDPQtglltgtndgtLVNFFLRQLGRMSEQS  444
            RHR+PK +P+TG L  + + TL+N  L   G MSE++
Sbjct  360  RHRVPKINPKTGKLESSKNLTLLNLMLEVFGPMSEKT  396



>ref|XP_003446913.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Oreochromis niloticus]
Length=406

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ SVPQL  +IPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFVYSVPQLFHVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  299  RHRLPRLNPE  308



>ref|XP_005494717.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X1 [Zonotrichia albicollis]
Length=406

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  239  YNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPS  308



>ref|XP_004076382.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Oryzias latipes]
Length=409

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  IIPCP
Sbjct  243  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVINFVYSLPQLFHIIPCP  302

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  303  RHRLPRLNPE  312



>ref|XP_009484363.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Pelecanus crispus]
Length=301

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  134  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  193

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  194  RHRLPRLNP  202



>ref|XP_003391111.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like, 
partial [Amphimedon queenslandica]
Length=250

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDT  YFAGMT AV  ILG FS+T+L+FF PQV NFL SVPQL GIIPCP
Sbjct  78   HNWYPSKVFVGDTLCYFAGMTFAVVAILGSFSKTMLLFFIPQVFNFLYSVPQLFGIIPCP  137

Query  554  RHRLPKFD  531
            RHRLPKFD
Sbjct  138  RHRLPKFD  145



>ref|XP_003057554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59199.1| predicted protein [Micromonas pusilla CCMP1545]
Length=446

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 93/132 (70%), Gaps = 6/132 (5%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
            ++NWYPS VFVGDT+TYFAGMT+ V G+LGHFSETL++FF PQ+ NFL S PQL  ++PC
Sbjct  315  THNWYPSRVFVGDTYTYFAGMTLGVVGVLGHFSETLVLFFLPQIFNFLYSSPQLFKLVPC  374

Query  557  PRHRLPKFDPQtglltgtndg------tLVNFFLRQLGRMSEQSlcvvlllfqafcccfc  396
            PRHRLPK D  TGLL  +          LVN +LR  G  +E+ LCV L+  QA CC F 
Sbjct  375  PRHRLPKLDAATGLLHASKATPTRYNMNLVNAYLRAFGPQTERDLCVALVSLQAACCGFG  434

Query  395  flLRWILTGWYK  360
            FL R +LTG +K
Sbjct  435  FLARHVLTGVWK  446



>ref|XP_010214593.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Tinamus guttatus]
Length=348

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  181  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  240

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  241  RHRLPRLNPN  250



>emb|CCI49482.1| unnamed protein product [Albugo candida]
Length=385

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             +NWYP+ VFVGDTF Y+AGM+ AVAGILGH+S+TLL+FF PQV+NFL S+PQL  I+PC
Sbjct  248  KHNWYPARVFVGDTFCYYAGMSFAVAGILGHYSKTLLLFFMPQVINFLYSIPQLCNIVPC  307

Query  557  PRHRLPKFDPQ  525
            PRHRLPKF+ +
Sbjct  308  PRHRLPKFNAK  318



>ref|XP_006890914.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X3 [Elephantulus edwardii]
Length=327

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV NFL S+PQL  IIPCP
Sbjct  134  YNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFMPQVFNFLYSLPQLFHIIPCP  193

Query  554  RHRLPKFDPQ  525
            RHR+P+F+ +
Sbjct  194  RHRIPRFNTK  203



>ref|XP_005187153.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Musca domestica]
Length=408

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             YN YPS VFVGDTF YFAGMT AV GILGHFS+TL++FF PQ++NFL S+PQL   +PC
Sbjct  243  KYNKYPSQVFVGDTFCYFAGMTFAVVGILGHFSKTLILFFLPQIINFLYSIPQLFKFVPC  302

Query  557  PRHRLPKFDPQ  525
            PRHRLPK+DPQ
Sbjct  303  PRHRLPKYDPQ  313



>ref|XP_010126904.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Chlamydotis macqueenii]
Length=330

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  163  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  222

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  223  RHRLPRLNPS  232



>ref|XP_010171382.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Caprimulgus carolinensis]
 gb|KFZ63252.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Caprimulgus carolinensis]
Length=354

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  187  HNWYPSQVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>gb|KFW85175.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Manacus vitellinus]
Length=354

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  246

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  247  RHRLPRLNP  255



>ref|XP_003230162.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Anolis carolinensis]
Length=406

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  I+PCP
Sbjct  239  HNWYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLLHIVPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+F+P 
Sbjct  299  RHRLPRFNPD  308



>ref|XP_009096089.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Serinus canaria]
Length=396

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  ++PCP
Sbjct  229  YNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVVPCP  288

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  289  RHRLPRLNPS  298



>gb|KFV78816.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Struthio camelus australis]
Length=354

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>ref|XP_007441559.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Python bivittatus]
Length=274

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NFL S+PQL  IIPCP
Sbjct  107  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVINFLYSLPQLFHIIPCP  166

Query  554  RHRLPKFDPQ  525
            RHRLP+F+  
Sbjct  167  RHRLPRFNAD  176



>ref|XP_002188220.2| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Taeniopygia guttata]
Length=358

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  191  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  250

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  251  RHRLPRLNPS  260



>gb|KFP45865.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Chlamydotis macqueenii]
Length=332

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  165  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  224

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  225  RHRLPRLNPS  234



>gb|KGL88731.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Charadrius vociferus]
Length=354

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  246

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  247  RHRLPRLNP  255



>gb|KGL78355.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Tinamus guttatus]
Length=373

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  206  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  265

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  266  RHRLPRLNPN  275



>dbj|GAM22214.1| hypothetical protein SAMD00019534_053890 [Acytostelium subglobosum 
LB1]
Length=403

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTFTYFAGM  AV  IL HFS+TLL+FF PQ+LNFL SVPQL G+I CP
Sbjct  278  HNWYPSRVFVGDTFTYFAGMCFAVVAILCHFSKTLLLFFIPQILNFLYSVPQLFGLIECP  337

Query  554  RHRLPKFDPQtglltgt-ndgtLVNFFLRQLGRMSEQ  447
            RHR+P+F+P TG +     + T++N FL   G M+E+
Sbjct  338  RHRVPRFNPSTGKMEAIPTNLTILNLFLMIFGPMTEK  374



>emb|CDW60532.1| UDP N acetylglucosamine dolichyl phosphate [Trichuris trichiura]
Length=409

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYP+ VFVGDTF YF+GM  AV GILGHFS+TLL+FF PQVLNFLLS+PQL  +IPCP
Sbjct  240  WNWYPARVFVGDTFCYFSGMLFAVVGILGHFSKTLLLFFMPQVLNFLLSLPQLFHVIPCP  299

Query  554  RHRLPKFD  531
            RHRLPK+D
Sbjct  300  RHRLPKYD  307



>ref|XP_010748499.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Larimichthys crocea]
Length=406

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  +IPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFIYSLPQLFHVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  299  RHRLPRLNPE  308



>ref|XP_009582479.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Fulmarus glacialis]
Length=289

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNF+ S+PQL  +IPCP
Sbjct  122  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFVYSLPQLFHVIPCP  181

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  182  RHRLPRLNPS  191



>ref|XP_010075283.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Pterocles gutturalis]
Length=301

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  134  HNWYPSQAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  193

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  194  RHRLPRLNPS  203



>ref|XP_009508052.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Phalacrocorax carbo]
Length=269

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  107  HNWYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  166

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  167  RHRLPRLNPS  176



>ref|XP_009668379.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Struthio camelus australis]
Length=388

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  221  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  280

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  281  RHRLPRLNPS  290



>ref|XP_003293643.1| UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Dictyostelium purpureum]
 gb|EGC29822.1| UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Dictyostelium purpureum]
Length=388

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTFTYF+GM  AV  IL HFS+TLL+FF PQ+LNFL S PQL G+IPCP
Sbjct  263  YNWYPSRVFVGDTFTYFSGMCFAVVAILCHFSKTLLLFFIPQILNFLYSTPQLFGVIPCP  322

Query  554  RHRLPKFDPQtglltgt-ndgtLVNFFLRQLGRMSEQS  444
            RHR+PK++P T  +     + T++N  L   G +SE+ 
Sbjct  323  RHRVPKYNPTTDKMEAIPTNLTIINLLLMVTGPLSERK  360



>gb|ETK73671.1| hypothetical protein L915_19433 [Phytophthora parasitica]
 gb|ETL27084.1| hypothetical protein L916_19331 [Phytophthora parasitica]
 gb|ETL80344.1| hypothetical protein L917_19164 [Phytophthora parasitica]
 gb|ETM33582.1| hypothetical protein L914_19207 [Phytophthora parasitica]
 gb|ETO62125.1| hypothetical protein F444_19948 [Phytophthora parasitica P1976]
 gb|ETP03211.1| hypothetical protein F441_19816 [Phytophthora parasitica CJ01A1]
Length=395

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             +NWYPS VFVGDTF Y+AGMT AV GILGHFS+TLL+FF PQVLNFL S+PQL  I+PC
Sbjct  258  KHNWYPSRVFVGDTFCYYAGMTFAVCGILGHFSKTLLLFFLPQVLNFLYSLPQLFKIVPC  317

Query  557  PRHRLPKFDPQ  525
            PRHRLPKF+ +
Sbjct  318  PRHRLPKFNAK  328



>gb|KFW93759.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Phalacrocorax carbo]
Length=273

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  109  HNWYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  168

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  169  RHRLPRLNPS  178



>ref|XP_008914058.1| hypothetical protein PPTG_17919 [Phytophthora parasitica INRA-310]
 gb|ETI33368.1| hypothetical protein F443_19956 [Phytophthora parasitica P1569]
 gb|ETN00737.1| hypothetical protein PPTG_17919 [Phytophthora parasitica INRA-310]
 gb|ETP31326.1| hypothetical protein F442_19794 [Phytophthora parasitica P10297]
Length=395

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             +NWYPS VFVGDTF Y+AGMT AV GILGHFS+TLL+FF PQVLNFL S+PQL  I+PC
Sbjct  258  KHNWYPSRVFVGDTFCYYAGMTFAVCGILGHFSKTLLLFFLPQVLNFLYSLPQLFKIVPC  317

Query  557  PRHRLPKFDPQ  525
            PRHRLPKF+ +
Sbjct  318  PRHRLPKFNAK  328



>ref|XP_008927171.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Manacus vitellinus]
Length=400

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  233  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  292

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  293  RHRLPRLNP  301



>gb|KFP61117.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Cariama cristata]
Length=354

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>gb|KFV74829.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Picoides pubescens]
Length=354

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>ref|XP_009701941.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Cariama cristata]
Length=356

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  189  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  248

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  249  RHRLPRLNPS  258



>gb|KFZ67233.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Podiceps cristatus]
Length=354

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>gb|KFW66640.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Pygoscelis adeliae]
Length=354

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>ref|XP_011600077.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Aquila chrysaetos canadensis]
Length=406

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  239  HNWYPSQVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPS  308



>ref|XP_002897227.1| UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
putative [Phytophthora infestans T30-4]
 gb|EEY65364.1| UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
putative [Phytophthora infestans T30-4]
Length=395

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             +NWYPS VFVGDTF Y+AGMT AV GILGHFS+TLL+FF PQVLNFL S+PQL  I+PC
Sbjct  258  KHNWYPSRVFVGDTFCYYAGMTFAVCGILGHFSKTLLLFFLPQVLNFLYSLPQLFKIVPC  317

Query  557  PRHRLPKFDPQ  525
            PRHRLPKF+ +
Sbjct  318  PRHRLPKFNAK  328



>ref|XP_009534154.1| hypothetical protein PHYSODRAFT_352487 [Phytophthora sojae]
 gb|EGZ11409.1| hypothetical protein PHYSODRAFT_352487 [Phytophthora sojae]
Length=395

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             +NWYPS VFVGDTF Y+AGMT AV GILGHFS+TLL+FF PQVLNFL S+PQL  I+PC
Sbjct  258  KHNWYPSRVFVGDTFCYYAGMTFAVCGILGHFSKTLLLFFLPQVLNFLYSLPQLFKIVPC  317

Query  557  PRHRLPKFDPQ  525
            PRHRLPKF+ +
Sbjct  318  PRHRLPKFNAK  328



>ref|XP_010007220.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Chaetura pelagica]
Length=325

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNF+ S+PQL  +IPCP
Sbjct  166  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFIYSLPQLLQVIPCP  225

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  226  RHRLPRLNPS  235



>ref|XP_010130039.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Buceros rhinoceros 
silvestris]
Length=350

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  183  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  242

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  243  RHRLPRLNPS  252



>ref|XP_010573231.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Haliaeetus leucocephalus]
Length=406

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  239  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPS  308



>gb|ELT97140.1| hypothetical protein CAPTEDRAFT_171012 [Capitella teleta]
Length=409

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YF+GMT AV  ILGHFS+T+L+FF PQV NF+LS PQL   +PCP
Sbjct  240  HNWYPSGVFVGDTFCYFSGMTFAVVAILGHFSKTMLLFFIPQVFNFILSTPQLFRFVPCP  299

Query  554  RHRLPKFDPQ  525
            RHRLP+FDPQ
Sbjct  300  RHRLPRFDPQ  309



>gb|KFR13709.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Opisthocomus hoazin]
Length=345

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>ref|XP_009936595.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Opisthocomus hoazin]
Length=376

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  216  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  275

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  276  RHRLPRLNPS  285



>ref|XP_006037679.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Alligator sinensis]
Length=388

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  221  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFLPQVLNFLYSLPQLFHIIPCP  280

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  281  RHRLPRLNP  289



>ref|XP_005988202.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Latimeria chalumnae]
Length=406

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  239  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPD  308



>ref|XP_009321673.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Pygoscelis adeliae]
Length=387

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  220  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  279

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  280  RHRLPRLNPS  289



>gb|KFU83750.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Chaetura pelagica]
Length=354

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNF+ S+PQL  +IPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFIYSLPQLLQVIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>ref|XP_004356507.1| UDPN-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform 6, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR24607.1| UDPN-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform 6, putative [Acanthamoeba castellanii 
str. Neff]
Length=422

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL SVPQL   IPC
Sbjct  255  KHNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSVPQLFHFIPC  314

Query  557  PRHRLPKFDPQ  525
            PRHRLPK++ +
Sbjct  315  PRHRLPKYNRK  325



>ref|XP_009983766.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Tauraco erythrolophus]
Length=388

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  221  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  280

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  281  RHRLPRLNPS  290



>ref|XP_009877828.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Charadrius vociferus]
Length=448

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  281  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  340

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  341  RHRLPRLNP  349



>ref|XP_005437763.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Falco cherrug]
Length=397

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  230  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  289

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  290  RHRLPRLNPS  299



>ref|XP_006266894.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Alligator mississippiensis]
Length=405

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  238  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFLPQVLNFLYSLPQLFHIIPCP  297

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  298  RHRLPRLNP  306



>ref|XP_005142706.1| PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetylglucosamine--dolichyl-phosphate 
N-acetylglucosaminephosphotransferase [Melopsittacus 
undulatus]
Length=406

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  239  HNWYPSQVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPS  308



>ref|XP_010289799.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Phaethon lepturus]
 gb|KFQ79316.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Phaethon lepturus]
Length=354

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  ++PCP
Sbjct  187  HNWYPSQVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVVPCP  246

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  247  RHRLPRLNP  255



>ref|XP_009906620.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X2 [Picoides pubescens]
Length=406

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  239  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPS  308



>ref|XP_002610663.1| hypothetical protein BRAFLDRAFT_275916 [Branchiostoma floridae]
 gb|EEN66673.1| hypothetical protein BRAFLDRAFT_275916 [Branchiostoma floridae]
Length=405

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YFAGMT AV GIL HFS+T+L+FF PQ+LNFL S PQL  ++PCP
Sbjct  238  YNWYPSQVFVGDTFCYFAGMTFAVVGILSHFSKTMLLFFIPQILNFLYSCPQLFRLVPCP  297

Query  554  RHRLPKFDPQ  525
            RHRLP+FD +
Sbjct  298  RHRLPRFDAK  307



>ref|XP_005240101.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Falco peregrinus]
Length=406

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  239  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPS  308



>ref|XP_009906619.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X1 [Picoides pubescens]
Length=416

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  239  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPS  308



>ref|XP_008498102.1| PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetylglucosamine--dolichyl-phosphate 
N-acetylglucosaminephosphotransferase [Calypte 
anna]
Length=406

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNF+ S+PQL  +IPCP
Sbjct  239  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFIYSMPQLLQVIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPS  308



>emb|CCA20633.1| UDPNacetylglucosaminedolichylphosphate Nacetylglucosaminephosphotransferase 
putative [Albugo laibachii Nc14]
Length=385

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             +NWYP+ VFVGDTF Y+AGMT AV GILGH+S+TLL+FF PQV+NFL S+PQL  I+PC
Sbjct  248  KHNWYPARVFVGDTFCYYAGMTFAVGGILGHYSKTLLLFFMPQVINFLYSIPQLCNIVPC  307

Query  557  PRHRLPKFDPQ  525
            PRHRLP+F+ +
Sbjct  308  PRHRLPRFNAK  318



>ref|XP_011450418.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Crassostrea gigas]
Length=408

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYP+ VFVGDTF YF+GMT AV  ILGHFS+T+L+FF PQV NF+ SVPQL  ++PCP
Sbjct  241  HNWYPADVFVGDTFCYFSGMTFAVVAILGHFSKTMLLFFIPQVFNFIYSVPQLFKMVPCP  300

Query  554  RHRLPKFDPQ  525
            RHRLPK+DP+
Sbjct  301  RHRLPKYDPK  310



>ref|XP_006890912.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X1 [Elephantulus edwardii]
Length=434

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV NFL S+PQL  IIPCP
Sbjct  241  YNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFMPQVFNFLYSLPQLFHIIPCP  300

Query  554  RHRLPKFDPQ  525
            RHR+P+F+ +
Sbjct  301  RHRIPRFNTK  310



>gb|KFR01418.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Nipponia nippon]
Length=354

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  187  HNWYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPN  256



>gb|KDO33306.1| hypothetical protein SPRG_02115 [Saprolegnia parasitica CBS 223.65]
Length=375

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF Y+AGMT AVAGILGHFS+TLL+FF PQ+LNF+ S+PQL  ++PCP
Sbjct  239  HNWYPSRVFVGDTFCYYAGMTFAVAGILGHFSKTLLLFFAPQILNFIYSMPQLFKLVPCP  298

Query  554  RHRLPKFD  531
            RHRLPKF+
Sbjct  299  RHRLPKFN  306



>ref|XP_006642237.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Lepisosteus oculatus]
Length=406

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSS FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  ++PCP
Sbjct  239  HNWYPSSAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVVPCP  298

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  299  RHRLPRLNP  307



>ref|XP_010774923.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Notothenia coriiceps]
 ref|XP_010774924.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Notothenia coriiceps]
Length=410

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  +IPCP
Sbjct  243  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFLPQVVNFVYSLPQLFHVIPCP  302

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  303  RHRLPRLNPD  312



>ref|XP_006890913.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X2 [Elephantulus edwardii]
Length=408

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV NFL S+PQL  IIPCP
Sbjct  241  YNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFMPQVFNFLYSLPQLFHIIPCP  300

Query  554  RHRLPKFDPQ  525
            RHR+P+F+ +
Sbjct  301  RHRIPRFNTK  310



>ref|XP_417845.2| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X4 [Gallus gallus]
Length=406

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GI+GHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  239  HNWYPSQVFVGDTFCYFAGMTFAVVGIVGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  298

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  299  RHRLPRLNP  307



>gb|KFP10497.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Egretta garzetta]
Length=354

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GI+GHFS+T+L+FF PQVLNFL S+PQL  I+PCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGIVGHFSKTMLLFFIPQVLNFLYSLPQLFHIVPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>ref|XP_011415481.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Crassostrea gigas]
Length=408

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYP+ VFVGDTF YF+GMT AV  ILGHFS+T+L+FF PQV NF+ SVPQL  ++PCP
Sbjct  241  HNWYPADVFVGDTFCYFSGMTFAVVAILGHFSKTMLLFFIPQVFNFIYSVPQLFRMVPCP  300

Query  554  RHRLPKFDPQ  525
            RHRLPK+DP+
Sbjct  301  RHRLPKYDPK  310



>ref|XP_001421050.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99343.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=358

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 86/131 (66%), Gaps = 6/131 (5%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS +FVGDT+TYFAGMT+ V G LGHFSETLL+FF PQVLNF+ S PQL  I+ CP
Sbjct  228  HNWYPSKIFVGDTYTYFAGMTLGVVGTLGHFSETLLLFFLPQVLNFVYSTPQLFKIVHCP  287

Query  554  RHRLPKFDPQt------glltgtndgtLVNFFLRQLGRMSEQSlcvvlllfqafcccfcf  393
            RHRLP FDP+T             +  LV  FLR  G  +E+ LC  LL FQ   C F F
Sbjct  288  RHRLPIFDPKTGLLHPSMATETRYNMNLVTLFLRLFGPCTERVLCARLLAFQFLSCAFAF  347

Query  392  lLRWILTGWYK  360
            + R  LTG +K
Sbjct  348  VARHALTGVWK  358



>gb|KFM00648.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Aptenodytes forsteri]
Length=354

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQ+LNFL S+PQL  +IPCP
Sbjct  187  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQLLNFLYSLPQLFHVIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>ref|XP_004947975.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X5 [Gallus gallus]
Length=417

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GI+GHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  250  HNWYPSQVFVGDTFCYFAGMTFAVVGIVGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  309

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  310  RHRLPRLNP  318



>ref|XP_010868751.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Esox lucius]
Length=406

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  +IPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFVYSLPQLFHVIPCP  298

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  299  RHRLPRLNP  307



>ref|XP_001604731.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Nasonia vitripennis]
Length=404

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  737  SYNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPC  558
             +NWYPS VFVGDTF YF+GMT AV GI+GHFS+T L+FF PQ+LNFL SVPQL  ++PC
Sbjct  239  KHNWYPSRVFVGDTFCYFSGMTFAVVGIIGHFSKTTLLFFIPQILNFLYSVPQLFKLVPC  298

Query  557  PRHRLPKFDPQ  525
            PRHRLP+++P+
Sbjct  299  PRHRLPRYNPK  309



>ref|XP_010402061.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Corvus cornix cornix]
Length=301

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  134  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  193

Query  554  RHRLPKFDPQ  525
            RHRLP+ +  
Sbjct  194  RHRLPRLNAS  203



>ref|XP_010022908.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Nestor notabilis]
Length=301

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  134  HNWYPSQVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  193

Query  554  RHRLPKFD  531
            RHRLP+ +
Sbjct  194  RHRLPRLN  201



>ref|XP_009467361.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Nipponia nippon]
Length=407

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  240  HNWYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  299

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  300  RHRLPRLNPN  309



>gb|KFQ89292.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Phoenicopterus ruber ruber]
Length=352

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  185  HNWYPSQAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  244

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  245  RHRLPRLNPS  254



>ref|XP_004947976.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
isoform X6 [Gallus gallus]
Length=401

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GI+GHFS+T+L+FF PQVLNFL S+PQL  IIPCP
Sbjct  250  HNWYPSQVFVGDTFCYFAGMTFAVVGIVGHFSKTMLLFFIPQVLNFLYSLPQLFHIIPCP  309

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  310  RHRLPRLNP  318



>emb|CDQ58600.1| unnamed protein product [Oncorhynchus mykiss]
Length=417

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  ++PCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFVYSLPQLFHVVPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPD  308



>ref|XP_010187177.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Mesitornis unicolor]
Length=347

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  180  HNWYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  239

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  240  RHRLPRLNPS  249



>gb|KFQ24509.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Mesitornis unicolor]
Length=349

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  182  HNWYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  241

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  242  RHRLPRLNPS  251



>ref|XP_009646369.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Egretta garzetta]
Length=461

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GI+GHFS+T+L+FF PQVLNFL S+PQL  I+PCP
Sbjct  294  HNWYPSRVFVGDTFCYFAGMTFAVVGIVGHFSKTMLLFFIPQVLNFLYSLPQLFHIVPCP  353

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  354  RHRLPRLNPS  363



>ref|NP_001133317.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Salmo salar]
 gb|ACI33019.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Salmo salar]
Length=406

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  ++PCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFVYSLPQLFHVVPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPD  308



>ref|XP_005058606.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Ficedula albicollis]
Length=406

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYP+ VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  239  HNWYPARVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  298

Query  554  RHRLPKFDP  528
            RHRLP+ +P
Sbjct  299  RHRLPRLNP  307



>ref|XP_009959038.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Leptosomus discolor]
 gb|KFP96181.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Leptosomus discolor]
Length=354

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  187  HNWYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>ref|XP_009271861.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Aptenodytes forsteri]
Length=368

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQ+LNFL S+PQL  +IPCP
Sbjct  201  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQLLNFLYSLPQLFHVIPCP  260

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  261  RHRLPRLNPS  270



>ref|XP_009872304.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Apaloderma vittatum]
 gb|KFP78193.1| UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase, 
partial [Apaloderma vittatum]
Length=354

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS  FVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL  +IPCP
Sbjct  187  HNWYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCP  246

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  247  RHRLPRLNPS  256



>ref|XP_003386308.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
[Amphimedon queenslandica]
Length=401

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDT  YFAGMT AV  ILG FS+T+L+FF PQV NFL SVPQL GIIPCP
Sbjct  229  HNWYPSKVFVGDTLCYFAGMTFAVVAILGSFSKTMLLFFIPQVFNFLYSVPQLFGIIPCP  288

Query  554  RHRLPKFD  531
            RHRLPKFD
Sbjct  289  RHRLPKFD  296



>ref|XP_008283320.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Stegastes partitus]
Length=406

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQ++NF+ S+PQL  IIPCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQLVNFVYSLPQLFRIIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPD  308



>ref|XP_007260565.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Astyanax mexicanus]
Length=405

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPSSVFVGDTF YFAGMT AV GILGHFS+T+L+FF PQV+NF+ S+PQL  I+PCP
Sbjct  239  HNWYPSSVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVVNFIYSLPQLFHIVPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+  P 
Sbjct  299  RHRLPRLQPD  308



>ref|XP_005538009.1| UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM81973.1| UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate 
transferase [Cyanidioschyzon merolae strain 10D]
Length=433

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS+VFVGDT+ YFAGM +A+A ILGH+SETLL+FF PQV NFL S+PQL GII CP
Sbjct  305  HNWYPSAVFVGDTYCYFAGMCLAMAAILGHYSETLLLFFVPQVFNFLYSLPQLLGIIRCP  364

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P+
Sbjct  365  RHRLPRLNPK  374



>ref|XP_005531162.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Pseudopodoces humilis]
Length=406

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            +NWYPS VFVGDTF YFAGMT AV GILGHFS+T+L+FF PQVLNFL S+PQL   IPCP
Sbjct  239  HNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHTIPCP  298

Query  554  RHRLPKFDPQ  525
            RHRLP+ +P 
Sbjct  299  RHRLPRLNPD  308



>ref|XP_008556930.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase 
[Microplitis demolitor]
 gb|EZA44673.1| UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase-like 
protein [Microplitis demolitor]
Length=409

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  734  YNWYPSSVFVGDTFTYFAGMTMAVAGILGHFSETLLIFFTPQVLNFLLSVPQLAGIIPCP  555
            YNWYPS VFVGDTF YF+GMT AV GI+GHFS+T+L+FF PQV+NFL SVPQL  ++PCP
Sbjct  245  YNWYPSQVFVGDTFCYFSGMTFAVVGIIGHFSKTVLLFFIPQVINFLYSVPQLFHLVPCP  304

Query  554  RHRLPKFD  531
            RHRLP+F+
Sbjct  305  RHRLPRFN  312



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1386214017500